Модифицированные витамин к-зависимые полипептиды

Изобретение относится к биотехнологии. Описан способ получения модифицированного витамин К-зависимого полипептида, включающий модификацию активационного пептида, которая включает, по меньшей мере, часть последовательности аминокислот другого витамин К-зависимого полипептида и где указанная часть представляет собой, по меньшей мере, 3 смежных аминокислоты активационного пептида FVII, или 5 смежных аминокислот активационного пептида FX, или 5 смежных аминокислот активационного пептида FIX с условием, что пептид QSFNDFTR исключен, или 8 смежных аминокислот активационного пептида протромбина, или удлинение на смежные аминокислоты активационного пептида второго витамин К-зависимого полипептида, которое имеет длину, по меньшей мере, равную 15% полной длины последовательности аминокислот активационного пептида второго витамин К-зависимого полипептида, в котором второй витамин К-зависимый полипептид выбран из группы, состоящей из протеина Z, GAS 6 и протеина S, и где второй витамин К-зависимый полипептида имеет увеличенное время полужизни в плазме. Раскрыт модифицированный витамин К-зависимый полипептид, полученный описанным способом, обладающий коагуляционной активностью. Изобретение позволяет создавать модифицированные витамин К-зависимые полипептиды с увеличенным временем полужизни в плазме. 8 н. и 32 з.п ф-лы, 2 ил., 5 табл.

 

Область изобретения

Настоящее изобретение относится к кодированию последовательностей модифицированной комплиментарной ДНК (кДНК) для витамин К-зависимых полипептидов в конкретном человеческом факторе VII, человеческом факторе VIIa, человеческом факторе IX и человеческом протеине С и их производных с улучшенной устойчивостью и увеличенным временем полужизни плазмы, рекомбинантным вектором экспрессии, содержащим такие последовательности кДНК, клетки хозяина, преобразованные такими рекомбинантными векторами экспрессии, рекомбинантные полипептиды и производные, которые имеют биологическую активность немодифицированного белка дикого типа, но с повышенной устойчивостью, и к процессам для изготовления таких рекомбинантных белков и их производных. Изобретение также охватывает вектор передачи для использования в человеческой генной терапии, включающей такие последовательности модифицированной ДНК.

Предпосылки создания изобретения

Витамин К-зависимые белки используются для лечения некоторых видов гемофилии. Классическая гемофилия или гемофилия А является наследственным геморрагическим диатез-нарушением. Оно вызвано связанным с хромосомой Х недостатком фактора VIII (антигемофильного глобулина А) и является почти исключительно мужским заболеванием с частотой между одним и двумя индивидуумами на 10,000 человек. Нарушение Х-хромосомы передается женскими носителями, которые сами по себе не страдают гемофилией. Клиническое проявление гемофилии состоит в тенденции к повышенному кровотечению. До внедрения лечения фактором VIII и концентратами фактора VIII средняя продолжительность жизни для человека с серьезной гемофилией была менее 20 лет. Использование концентратов фактора VIII из плазмы и позже их рекомбинантных форм FVIII значительно улучшило ситуацию для пациентов, страдающих гемофилией, экстенсивно увеличивая среднюю продолжительность жизни и давая большинству пациентов возможность жить более или менее нормальной жизнью. Гемофилия В встречается в 5 раза реже, чем гемофилия А, вызвана нефункционирующими или отсутствующими факторами FDC и лечится концентратами из плазмы или рекомбинантными формами FIX. Как в случае гемофилии А, так и в случае гемофилии В, наиболее серьезная медицинская проблема при лечении этой болезни заключается в создании аллогенных антител против факторов реплантации. До 30% всех пациентов, страдающих гемофилией, показывают антитела до FVIII. Антитела до FIX развиваются в меньшей степени, но с более тяжелыми последствиями, поскольку они менее восприимчивы к иммунной толерантности индукционной терапии.

Принятая в настоящее время модель свертывания крови предполагает, что физиологическая схема начала свертывания крови состоит в формировании комплекса между фактором ткани (TF) и фактором VIIa (FVIIa) на поверхности ткани с определением клеток, которые обычно находятся вне сети сосудов. Это приводит к активации факторов FIX и FX и, в конечном счете, к образованию тромбина. В цепи положительной обратной связи тромбин активизирует факторы FVIII и FIX, так называемое «внутреннее» плечо каскада свертывания крови, таким образом усиливая выработку фактора FXa, который является необходимым для появления полного выхода тромбина для достижения полного гемостаза. Доказано, что путем ввода надфизиологических концентраций гемостаза FVIIa достигается путем обхода потребности в факторах FVIIIa и FIXa. Клонирование кДНК для фактора FVII (US 4.784.950) позволяет развить рекомбинантную замену фактора свертывания крови, полученного из этой плазмы. Этот фактор FVIIa был впервые успешно введен в 1988 году пациенту с высоким титром подавляющих антител для фактора FVIII. С тех пор число признаков FVIIa постоянно росло, выявляя потенциал фактора FVIIa как универсального гемостатического агента (Erhardtsen, 2002).

Фактор FVII - одноцепочный гликопротеид с молекулярным весом 50 kDa, который выделяется ячейками печени в кровоток, как неактивный профермент аминокислот 406. Он содержит 10 γ-карбокси-глютаминовые кислотные остатки (положения 6, 7, 14, 16, 19, 20, 25, 26, 29 и 35), локализованные в Gla-области белка. Остатки Gla требуют витамина К для их биосинтеза. Локализованный С-терминал домена Gla состоит из двух областей эпидермального фактора роста и области серин-протеазы трипсин-типа. Дальнейшие посттрансляционные модификации фактора FVII включают гидроксилирование (Asp 63), N-(Asn145 и Asn322) и гликозилирование (Ser52 и Ser60) O-типа.

Фактор FVII преобразуется в свою активную форму FVIIa путем расщепления белка одиночной пептидной связи в Arg152-Ile153, приводя к формированию двух полипептидных цепей: легкую цепь N-терминала (17 kDa) и тяжелую цепь С-терминала (28 kDa), которые соединяются одной дисульфидной связью. В отличие от других витамин К-зависимых полипептидов, активационный пептид, который расщепляется при активации, не был описан для фактора FVII. Сайт расщепления Arg152-Ile153 по сравнению с гомологией соответствует сайту разрыва активации С-терминала других витамин К-зависимых полипептидов. Однако, поскольку Arg144 также мог бы создавать сайт расщепления протеазы, нельзя исключать того, что FVII, в отличие от общепринятого мнения, обладает активационным пептидом восьми аминокислот между Arg144 и Arg152.

Существенным для достижения активной конформации фактора FVIIa является формирование солевого мостика после раздела активации между Ile153 и Asp343. Активация FVII может быть достигнута в лабораторных условиях использованием FXA, FXIIa, FIXa, FVIIa, FSAP и тромбина. Моллерап и др. (Biotechnol. Bioeng. (1995 г.) 48: 501-505) сообщают, что определенный распад также происходит в тяжелой цепи в Arg290 и/или Arg315.

Фактор FVII присутствует в плазме в концентрации 500 нг/мл. Например, 1%, 5 нг/мл FVII присутствует как фактор FVIIa. Период полураспада плазмы FVII был найден равным приблизительно 4 часам и таковой для FVIIa приблизительно 2 часам. Хотя период полураспада фактора FVIIa в 2 часа является сравнительно долгим для активизированного фактора свертывания крови, который в другом случае составляет несколько минут из-за необратимого ингибирования серпина подобно антитромбину III, это является серьезным препятствием для терапевтического использования фактора FVIIa, поскольку он требует многократной внутривенной инъекции или непрерывного вливания для достижения гемостазы, что связано с очень высокой стоимостью лечения и неудобствами для пациента. С другой стороны, фактор FVIIa имеет потенциал, который нужно использовать как универсальное гемостатическое средство, и имеется медицинская потребность в развитии такой формы FVIIa, которая имеет более длительное функциональное время полужизни.

Было сделано несколько попыток модификации фактора FVII:

Николайсен и другие (WO 88/10295, 25 июня 1987 года) предложили, что удаляя или модифицируя следующие аминокислоты, фактор FVII будет стабилизирован против протеолитической деградации: Lys32, Lys38, Lys143, Arg290, Arg315, Lys316, Lys341, Arg392, Arg 396, Arg402, Ile42 и Tyr44.

Николайсен (US 5.580,560, 13 ноября 1989 года) в WO 88/10295 также включил мутации или удаление в Arg304, Phe278 и Tyr332, чтобы сделать фактор FVII/FVIIa менее восприимчивым к расщеплению белка.

Бхарадвей и другие (JBC (1996), 48, стр.30685-30691) описал мутант фактора FVII Phe328Ser, который не смог активизировать FX и не показал никакой обнаруживаемой амидолизной активности.

Дикинсон и другие (PNAS (1996) 93, 14379-14384) предложил варианты фактора FVIIa, в которых Lys157, Val158, Glu296, Met298, Asp334, Ser336 или Lys337 были заменены на Ala.

Неленсестуен (WO 99/29767, 23 октября 1997 года) модифицировал область Gla, используя способ точечных мутаций, чтобы приблизить ее свойства к фосфолипидным мембранам, получив, таким образом, модифицированный фактор FVIIa с повышенной специфической активностью. Предложенные точечные мутации представляют собой Pro10, Gly11, Arg28 и Lys32.

Неленсестуен (WO 00/66753, 29 апреля 1999 года) модифицировал область Gla, используя способ точковых мутаций, чтобы увеличить ее сродство с фосфолипидными мембранами, получив. таким образом, модифицированный фактор FVIIa с повышенной специфической активностью. Предложенные точковые мутации выполнены в точках 5, 9, 11, 12, 29, 33, 34, 35 и/или 36.

Корнфельд и другие (Archiv. Biochem. И Biophys., 363, рр 43-54) показали, что окисление Met298 и Met306 приводит к повышенной на 30% скорости диссоциации FVIIa-ox TF и на 20% сниженную активацию FX по сравнению с фактором FVIIa дикого типа.

Кембелл-Кук и другие (JBC (1998), 14, рр.8516-8521) описал мутант FVII Gin100Arg и показал, что он не имеет никакой обнаруживаемой коагулирующей активности, хотя и имеет амидолизную активность, сопоставимую с фактором FVIIa дикого типа, и предположил, что это может быть благодаря связи с фактором ткани (TF).

Иино и другие (Arch. Biochem. Biophys. (1998 г.) 352:182-192) показал, что мутации O-гликозилированных участков Ser-52 и Ser-60 снижают коагулирующую активность FVIIa, возможно, путем изменения взаимодействия с TF.

Руф и другие (Biochemistry (1999 г.) 16, pp.1957-66) показал, что мутация Arg36Ala снижает скорость активации FX.

Иванага и другие (Thromb. Haemost. (Приложение от августа 1999), 466 реферат 1474) ссылается на вариант FVII, в котором остатки 316-320 удалены или остатки 311-322 заменены соответствующими остатками трипсина.

Соэнджима Кенджи и другие (JP 2001061479, 24 августа 1999 года) создал модифицированный фактор FVIIa с увеличенной специфической активностью, расщепляя дисульфидную группу между Cys159 и Cys164 или заменяя, добавляя или удаляя, по меньшей мере, часть структуры петли от Thr233 до Asp244, или заменяя, добавления или удаляя, по меньшей мере, часть мешающей последовательности между Arg304 и Cys329.

Педкрсен и другие (US 2003/0096338 от 11 февраля 2000 года) заявляет связь между FVII и FVIIa с неполипептидными агентами, включая сахар, с целью продлить период полужизни FVIIa. Формула изобретения также охватывает ввод новых гликозилированных сайтов N- и/или O-типа или ввод новых гликозилированных сайтов, в сочетании с удалением существовавших ранее гликозилированных сайтов N- и/или O-типа, чтобы получить гликоконъюгаты в лабораторных условиях.

Петерсон и Олсен (US 2003/0170863, 3 мая 2000 года) описывают модифицированный фактор FVIIa, в котором Leu305 или Phe374 была заменена другой аминокислотой. Не менее 20 аминокислот в области протеазы (153-406) были заменены в сочетании с вышеупомянутыми мутациями. Раскрыты и другие модифицировавшие молекулы FVII, которые произвольно имеют другие аминокислоты, замененные в положениях 274, 300-304 и 306-312 в сочетании с Leu305 и Phe374. Эти модификации приводят к тому, что FVIIa спонтанно достигнет более активного уровня, чем тот, который обычно стимулирует TF.

Петерсон и Олсен (US 2003/0104978 и 2003/0100740, 29 сентября 2000 года) далее описывают другие модифицировавшие молекулы FVIIa с точковыми мутациями, отличающихся от замещений Ala в положениях Lys157, Lys337, Asp334, Ser336, Val158, Glu296 и Met298.

Рингель и Клаусен (US 2002/0151471 и US 2002/0137673, 2 октября 2000) заявляют препарат, содержащий множество факторов FVII или родственных полипептидов, которые содержат некоторые пропорции гликозилатов различного N-типа

Руф и другие (WO 02/38162, 9 ноября 2000 года) патентуют варианты FVII/FVIIa с модификациями Met298Gln, Glu296Ile и Val158Asn или их сочетания, обеспечивающие повышенную амидолизную активность в отсутствии TF и более высокое родовое сходство с TF. Этот фактор был далее модифицирован, чтобы увеличить его устойчивость в модифицированных трипсин-подобных сайтах расщепления в Lys32, Lys38, Arg290, Arg304, Arg315 и Lys341 и химотрипсин-подобных сайтах расщепления в Ile42, Tyr44, Phe278 и Tyr332.

Перссон (WO 02/077218, 22 марта 2001 года) заявляет мутанты FVII/FVIIa, в которых мутированы аминокислоты 247-260, 393-405 и Pro406, более конкретно R396, Q250 и Pro406, предпочтительно аминокислота, к которой может быть прикреплена химическая группа с целью увеличения полужизни FVII/FVIIa. Это может быть объединено с мутациями, которые увеличивают активность FVII/FVIIa в К157, V158, Е296, М298, L305, D334, S336, К337 и F374.

Перссон и Олсен (US 2003/0100075, 27 сентября 2001 года) заявляют, что Leu305 расположен в конце α-спирали в комплексной форме TF в FVIIa, который, как полагают, является важным для активности. В свободном факторе FVIIa эта спираль искажена и, таким образом, возможно, неустойчива. Замена Leu305 другими аминокислотами приводит согласно этому изобретению к вариантам, которые достигают активной конформации, которая в ином случае обеспечивается TF. Аминокислоты Lys157, Lys337, Asp334, Ser336, Val158, Glu296 и Met298 расположены в областях, которые влияют на формирование солевого мостика между Ile153 и Asp343. Замена этих аминокислот приводит согласно этому изобретению к облегчению вставки М-конца протеазы, в частности создание солевого мостика необходимо для повышения активности.

Перссон и Олсен (US 2003/0130191, 2 ноября 2001 года) далее предлагают модифицированные мутанты фактора FVII/VIIa с повышенной специфической активностью, которые замещаются другими аминокислотами в положениях: 313-329, 364, 366, 373 и 376, также как в положениях 330-339.

Haaning и другие (WO 03/093465, 30 апреля 2002 года) патентуют Nelseastuen (модификация домена Gla для повышения связывания фосфолипида, а именно замена в Pro10 предпочтительно Gln, Lys32, предпочтительно Glu, Asp33, предпочтительно гидрофобной аминокислотой, предпочтительно Phe, Ala34, предпочтительно отрицательно заряженной аминокислотой, предпочтительно Glu, и вставку аминокислоты после Ala3, предпочтительно Tyr, с введением дополнительных сайтов N-гликозилирования.

Foncuberta и другие (WO 2004/011675, 25 июля 2002 года) описывают встречающиеся в природе аллельные варианты фактора FVII, которые теоретически могут привести к более высоким уровням экспрессии и улучшению функции фактора FVIIa. Не приведены никакие данные по таким улучшенным свойствам. Два варианта из 49 были найдены в экзоне и привели к замещению аминокислот: A294V и R353Q.

Перссон и Олсен (WO 2004/029090, 25 сентября 2002 года) показали, что мутирующий Phe374 в сочетании с некоторыми другими аминокислотами приводит к увеличению активности TF независимо от фактора FVIIa TF, а именно, L305V, S314E, К337А и F374Y привели к увеличению амидолизной активности TF.

Хаанин и другие (WO 2004/029091, 30 сентября 2002 года) модифицировал фактор FVII при L39, I42, S43, К62, L65, F71, Е82 и F275 на сайте связи TF FVII/FVIIa, увеличивая сродство с TF.

Андерсен и другие (WO 2004/083361, 20 марта 2003 года) модифицировал фактор FVII/FVIIa в положениях 196 (D196N/K), 237 (G237L или вставках GAA GAAA или GAAAA) и 341 (K341N/Q), чтобы увеличить сродство с TF.

Блайчман и другие (WO 2004/108763, 5 июня 2003 года) модифицировал фактор FVII/FVIIa в области EGF на основании анализа различий между областями EGF человека и кролика, поскольку фактор VIIa кролика имеет более высокую степень сродства с человеческим фатором TF, как человеческий фактор VIIa. Было заявлено и показано, что мутанты в положениях 53, 62, 74, 75 и 83 имеют более высокую степень сродства с человеческим фактором TF и увеличивают гемостатический потенциал.

Хаанинг и другие (WO 2004/111242, 19 июня 2003 года) модифицировал фактор FVII/FVIIa в положениях: 4, 10, 28, 32, 33, 34, 36, 74, 77, 116, предпочтительно A3Y, P10Q, R28F, К32Е, D33F, A34L, R36E, К38Е, P74S, Е77А, E116D. Мутация R36E вызывает уменьшение связи с TF и снижает генерацию тромбинов в биопробах, зависимых от TF при поддержании той же активности в биопробах, зависимых от PL.

Джохансен и другие (WO 2005/032581, 7 октября 2003 года) описывает гибридные молекулы, состоящие из домена связи липидной мембраны с доменом активности фактора VII, опционно сопряженного с наполнителем, предпочтительно с PEG.

Маун и другие (Protein Sci. (2005) 14:1171-80) ввел новые дисульфидные связи, чтобы удержать конформацию фактора FVII в активном состоянии, подобном состоянию фактора TF*FVIIa. Кинетический анализ амидолизной активности показал, что все варианты фактора VIIa увеличили специфическую активность по сравнению с диким типом, причем наибольшая активность имела место в вариантах 136:160 и 138:160 с субстратом S-2765, имеющими 670-кратное и 330-кратное увеличение соответственно. Фактор VIIa в дисульфидно-блокированных вариантах больше не требовал TF в виде софактора для максимальной активности в амидолизной биопробе. В присутствии растворимого TF активность повышалась в 20 и 12 раз для вариантов 136:160 и 138:160, соответственно, по сравнению с диким типом.

Подробное описание изобретения

Целью настоящего изобретения является создание модифицированных витамин К-зависимых полипептидов, например модифицированных факторов FVII и FVIIa c увеличенным функциональным временем полужизни.

Фактор FVII относится к другим белкам домена Gla, подобно фактору FIX, FX, протеину С, протеину Z, протромбину, GAS6 и протеину S. В близком сродстве состоят факторы FVII, FIX, FX и Протеин С, в которых N-конец домена Gla сопровождается двумя эпидермальными доменами фактора роста (EGF), сопровождаемыми доменом серин-протеазы трипсин-типа. Протеин Z имеет аналогичную структуру, но с пассивным доменом протеазы. В протромбине домен Gla сопровождается двумя крингель-доменами вместо двух доменов EGF, которые сопровождаются доменом протеазы трипсин-типа. В GAS6 и протеине S домен Gla сопровождается четырьмя доменами EGF и затем двумя доменами ламинина-G вместо области протеазы.

Поразительна большая разница во времени полужизни плазмы близкородственных белков плазмы:

FVII 2-4 часа
Протеин С 6-8 часов
FIX 18-30 часов
FX 20-42 часа
Протеин S 24-58 часов
Протромбин 41-72 часа

Конкретная близкородственная подгруппа этих белков содержит FVII, FIX, FX и Протеин С.

На фиг.1 сравнивается гомология между FVII, белком С, FIX и FX человеческого происхождения и другими биологическими видами. Молекулы консервативны, и наиболее поразительное различие выявлено в домене активации. Для фактора FVII пептид активации не был описан. Однако при активации фактор FVII в дополнение к расщеплению в Arg152 мог также быть расщеплен в Arg144 с освобождением предполагаемого пептида активации восьми аминокислот, содержащих консервативный сайта N-гликозилирования.

Удивительно то, что длина пептидов активации и посттрансляционных модификаций пептидов активации коррелируется с увеличенным временем полужизни (табл.1).

Таблица 1
Время полужизни плазмы Длина активационного пептида человека Место N-глюзилирования в активационном пептиде
FVII 2-4 часа Активационный пептид (или предполагаемый активационный пептид 8 аминокислот) отсутствует 1 в предполагаемом активационном пептиде 8 аминокислот
Протеин С 6-8 часов 16 аминокислот 0
FIX 18-30 часов 34 аминокислоты 2
FX 20-42 часа 51 аминокислоты 2

Таким образом, изобретение относится к способу получения модификационного витамин К-зависимого полипептида, включающего модификацию активационного пептида первого витамин К-зависимого полипептида, в результате чего модифицированный витамин К-зависимый полипептид имеет увеличенный период полужизни по сравнению с первым полипептидом, зависимым от витамина К, в котором активационный пептид не был изменен.

Изобретение далее относится к способу приготовления такого модификационного витамин К-зависимого полипептида, включающего стадию модификации активационного пептида первого витамин К-зависимого полипептида, добавляя, по меньшей мере, часть активационного пептида второго витамин К-зависимого полипептида, или заменяя по меньшей мере, часть активационного пептида первого витамин К-зависимого полипептида, по меньшей мере, частью активационного пептида второго витамин К-зависимого полипептида.

Витамин К-зависимые полипептиды представляют собой группу белков, которые нуждаются в витамине К на своем биосинтетическом пути метаболизма к карбоксилатной группе или боковым цепям глютаминовых кислотных остатков своих белковых предшественников. Витамин К-зависимые полипептиды включает, но не ограничиваются этим, фактор VII, фактор VIIa, фактор IX, фактор IXa, фактор X, фактор Ха, фактор II (протромбин). Протеин С, активированный Протеин С, протеин S, активизированный протеин S, GAS6, активизированный GAS6, протеин Z, активизированный протеин Z и т.д. Кроме того, полезные витамин К-зависимые полипептиды могут быть дикого типа или могут содержать мутации. Степень и местоположение глюкозирования или других посттрансляционных модификаций могут изменяться в зависимости от выбранных клеток хозяина и природы главной окружающей клеточной среды. Что касается определенных аминокислотных последовательностей, то посттрансляционные модификации таких последовательностей описаны в настоящей заявке.

"Фактор VII/VIIa" как он используется в настоящей заявке, означает продукт, состоящий либо из неактивированной формы (фактор VII) или активизированной формы (фактор VIIa) либо их смесей. "Фактор VII/VIIa" в вышеупомянутом определении включает белки, которые имеют аминокислотную последовательность естественного человеческого фактора VII/VIIa. Этот фактор также включает белки со слегка модифицированной аминокислотной последовательностью, например модифицированный N-конец, включая N-конец для извлечения или добавки аминокислоты, в той мере, в какой белки, в основном, сохраняют активность фактора VIIa. «Фактор VII» в рамках вышеупомянутого определения также включает естественные аллельные изменения, которые могут существовать и переходить от одного индивидуума к другому. «Фактор VII» в рамках вышеупомянутого определения дополнительно включает варианты FVII/FVIIa. Такие варианты отличаются по одному или большему количеству аминокислотных остатков от последовательности дикого типа. Примеры таких различий могут включать укорочение N- и/или С-конца одного или нескольких аминокислотных остатков (например, от 1 до 10 аминокислотных остатков), или дополнений в виде одного или нескольких дополнительных остатков на N- и/или С-конце, например добавление остатка метионина в N-конец, также как консервативных замещений аминокислоты, т.е. замещений, выполненных в группах аминокислот с аналогичными характеристиками, например (1) небольшие аминокислоты, (2) кислые аминокислоты, (3) полярные аминокислоты, (4) основные аминокислоты, (5) гидрофобные аминокислоты и (6) ароматические аминокислоты. Примеры таких консервативных замен показаны в табл.2.

Таблица 2
(1) Аланин Глицин
(2) Аспартовая кислота Глутаминовая кислота
(3) Аспарагин Глутамин Серин Треонин
(4) Аргинин Гистидин Лизин
(5) Изолейцин Лейцин Ветионин Валин
(6) Фенилаланин Тирозин Триптофан

Аминокислотные последовательности различных витамин К-зависимых полипептидов и кодирующие их последовательности кДНК показаны в табл.3.

Первый витамин К-зависимый полипептид предпочтительно выбран из группы, состоящей из фактора VII, фактора VIIa, фактора IX, фактора IXa, протеина С и активированного протеина С. Более предпочтительно, чтобы первый витамин К-зависимый полипептид, был бы выбран из группы, состоящей из человеческого фактора VII, человеческого фактора VIIa, человеческого фактора IX, человеческого фактора IXa, человеческого протеина С и человеческого активизированного протеина С. Наиболее предпочтительно первый витамин К-зависимый полипептид - человеческий фактор VII или человеческий фактор VIIa. В конкретном варианте первый витамин К-зависимый полипептид содержит аминокислотную последовательность, выбранную из группы, состоящей из номеров идентификатора последовательностей (SEQ ID Nos): 3, 6 и 9.

Второй витамин К-зависимый полипептид отличается от первого витамин К-зависимого полипептида. Соответственно, модифицированный витамин К-зависимый полипептид, полученный по процессу настоящего изобретения, содержит, по меньшей мере, часть активационного пептида, в естественном виде не встречающегося в первом витамин К-зависимом полипептиде.

Второй витамин К-зависимый полипептид имеет более продолжительное время полужизни в плазме, чем первый витамин К-зависимый полипептид. В другом варианте длина активационного пептида второго витамин К-зависимого полипептида больше длины активационного пептида первого витамин К-зависимого полипептида.

Предпочтительно, чтобы второй витамин К-зависимый полипептид был бы выбран из группы, состоящей из фактора IX, фактора Х и протромбина. Более предпочтительно, если второй витамин К-зависимый полипептид выбран из группы, состоящей из человеческого фактора IX, человеческого фактора Х и человеческого протромбина. В конкретном варианте второй витамин К-зависимый полипептид содержит аминокислотную последовательность, выбранную из группы, состоящей номеров SEQ ID NO: 9, 12 и 15.

Часть добавленного активационного пептида второго витамин К-зависимого полипептида предпочтительно состоит, по меньшей мере, из 8, более предпочтительно, по меньшей мере, из 12 и еще более предпочтительно, по меньшей мере, из 15 смежных аминокислот в аминокислотной последовательности активационного пептида второго витамин К-зависимого полипептида.

В другом варианте часть добавленного активационного пептида второго витамин К-зависимого полипептида может состоять, по меньшей мере, из 0,15·N смежных аминокислот в аминокислотной последовательности активационного пептида второго витамин К-зависимого полипептида, в котором N - общее количество аминокислот активационного пептида второго витамин К-зависимого полипептида. Предпочтительно часть активационного пептида второго витамин К-зависимого полипептида состоит, по меньшей мере, из 0,5·N, более предпочтительно, по меньшей мере, из 0,75·N, еще более предпочтительно, по меньшей мере, из 0,9·N, и, наиболее предпочтительно, по меньшей мере, из 0,95·N смежных аминокислот в аминокислотной последовательности активационного пептида второго витамин К-зависимого полипептида. В еще одном варианте часть добавленного активационного пептида второго витамин К-зависимого полипептида состоит, по меньшей мере, из (N-x) смежных аминокислот в аминокислотной последовательности активационного пептида второго витамин К-зависимого полипептида, в котором N - общее количество аминокислот активационного пептида второго витамин К-зависимого полипептида и в котором х может быть 7, предпочтительно х - 5, более предпочтительно х - 4, более предпочтительно х - 3 и еще наиболее предпочтительно х - 2.

Также возможно, что часть добавленного активационного пептида второго витамин К-зависимого полипептида состоит из центральной части активационного пептида, т.е. она не содержит С-конца аминокислоты или N-конца аминокислоты активационного пептида.

Наиболее предпочтительно, чтобы полный активационный пептид второго витамин К-зависимого полипептида был бы добавлен к аминокислотной последовательности первого витамин К-зависимого полипептида при сохранении специфики активации первого витамин К-зависимого полипептида. Альтернативно вариант полного активационного пептида второго витамин К-зависимого полипептида может быть добавлен к аминокислотной последовательности первого витамин К-зависимого полипептида. Варианты включают активационные пептиды, в которые были добавлены, удалены и/или замещены в пределах от 1 до 10, предпочтительно от 1 до 7, более предпочтительно от 1 до 5 и наиболее предпочтительно от 1 до 3 аминокислот.

Если период полужизни профермента должен быть продлен, сайты расщепления N- и С-концов активации первого витамин К-зависимого полипептида предпочтительно удерживаются в различных активационных пептидах. Также, если период полужизни активизированной формы витамин К-зависимого полипептида должен быть продлен либо сайты расщепления N- или С-конца активации первого витамин К-зависимого полипептида должны быть удалены, предпочтительно должен быть удален сайт расщепления N-конца активации. Если период полужизни FVIIa должен быть продлен, предпочтительно сайты расщепления N-конца активации должны быть удалены, тогда как предпочтительно сайты расщепления С-конца активации должны быть сохранены.

В табл.3 просуммирована последовательность активационных пептидов от нескольких витамин К-зависимых полипептидов.

Термин "активационный пептид", как он используется здесь, включает известные активационные пептиды и предполагаемые активационные пептиды типа указанных в факторе VII.

В качестве не ограничивающего примера любая из следующих аминокислотных последовательностей может быть добавлена к аминокислотной последовательности SEQ ID номера 3 или 6

аа от 1 до 35 последовательности SEQ ID NO: 18;

аа от 1 до 34 последовательности SEQ ID NO: 18;

аа от 1 до 33 последовательности SEQ ID NO: 18;

[… …]

аа от 1 до 8 последовательности SEQ ID NO: 18;

аа от 1 до 7 последовательности SEQ ID NO: 18;

аа от 1 до 6 последовательности SEQ ID NO: 18;

аа от 1 до 5 последовательности SEQ ID NO: 18;

аа от 2 до 35 последовательности SEQ ID NO: 18;

аа от 2 до 34 последовательности SEQ ID NO: 18;

аа от 2 до 33 последовательности SEQ ID NO: 18;

[… …]

аа от 2 до 9 последовательности SEQ ID NO: 18;

аа от 2 до 8 последовательности SEQ ID NO: 18;

аа от 2 до 7 последовательности SEQ ID NO: 18;

аа от 2 до 6 последовательности SEQ ID NO: 18;

аа от 3 до 35 последовательности SEQ ID NO: 18;

аа от 3 до 34 последовательности SEQ ID NO: 18;

аа от 3 до 33 последовательности SEQ ID NO: 18;

[… …]

аа от 3 до 10 последовательности SEQ ID NO: 18;

аа от 3 до 9 последовательности SEQ ID NO: 18;

аа от 3 до 8 последовательности SEQ ID NO: 18;

аа от 3 до 7 последовательности SEQ ID NO: 18;

и т.д.

В качестве не ограничивающего примера любая из следующих аминокислотных последовательностей может быть добавлена к аминокислотной последовательности SEQ ID NO: 3, 6 или 9

аа от 1 до 52 последовательности SEQ ID NO: 19;

аа от 1 до 51 последовательности SEQ ID NO: 19;

аа от 1 до 50 последовательности SEQ ID NO: 19;

[… …]

аа от 1 до 8 последовательности SEQ ID NO: 19;

аа от 1 до 7 последовательности SEQ ID NO: 19;

аа от 1 до 6 последовательности SEQ ID NO: 19;

аа от 1 до 5 последовательности SEQ ID NO: 19;

аа от 2 до 52 последовательности SEQ ID NO: 19;

аа от 2 до 51 последовательности SEQ ID NO: 19;

аа от 2 до 50 последовательности SEQ ID NO: 19;

[… …]

аа от 2 до 9 последовательности SEQ ID NO: 19;

аа от 2 до 8 последовательности SEQ ID NO: 19;

аа от 2 до 7 последовательности SEQ ID NO: 19;

аа от 2 до 6 последовательности SEQ ID NO: 19;

аа от 3 до 52 последовательности SEQ ID NO: 19;

аа от 3 до 51 последовательности SEQ ID NO: 19;

аа от 3 до 50 последовательности SEQ ID NO: 19;

[… …]

аа от 3 до 10 последовательности SEQ ID NO: 19;

аа от 3 до 9 последовательности SEQ ID NO: 19;

аа от 3 до 8 последовательности SEQ ID NO: 19;

аа от 3 до 7 последовательности SEQ ID NO: 19;

и т.д.

Часть полного активационного пептида второго витамин К-зависимого полипептида вставлена вблизи около области активационного пептида первого витамин К-зависимого полипептида. Она может быть вставлена между двумя аминокислотами первого витамин К-зависимого полипептида без удаления аминокислот первого витамин К-зависимого полипептида. Например, в случае FVII, который является первым витамин К-зависимым полипептидом, часть полного активационного пептида второго витамин К-зависимого полипептида может быть вставлена между аминокислотами 144 и 145, между аминокислотами 145 и 146, между аминокислотами 146 и 147, между аминокислотами 147 и 148, между аминокислотами 148 и 149, между аминокислотами 149 и 150, между аминокислотами 150 и 151, между аминокислотами 151 и 152 или между аминокислотами 152 и 153, где нумерация относится к последовательности SEQ ID NO: 3. Предпочтительно часть полного активационного пептида второго витамин К-зависимого полипептида вставлена между аминокислотами 144 и 145, где нумерация относится к SEQ ID NO: 3. Предпочтительно Сайт расщепления С-конца и специфика активации первого витамин К-зависимого полипептида при вставке сохраняются. Сайт расщепления N-конца может быть удален вставкой.

С другой стороны, часть полного активационного пептида второго витамин К-зависимого полипептида заменяет участок аминокислот в первом витамин К-зависимом полипептиде. Например, в случае FVII, который является первым витамин К-зависимым полипептидом, часть полного активационного пептида второго витамин К-зависимого полипептида может заменять аминокислоты от 140 до 152 в последовательности SEQ ID NO: 3. Предпочтительно сайт расщепления С-конца и специфика активации первого витамин К-зависимого полипептида при вставке сохраняются. Сайт расщепления N-конца может быть уделен вставкой.

Сайт расщепления N-конца может быть удален, заменяя некоторые аминокислоты первого витамин К-зависимого полипептида частью или полным активационным пептидом второго витамин К-зависимого полипептида. Соответственно, часть полного активационного пептида второго витамин К-зависимого полипептида может заменять любую из следующих аминокислотных последовательностей SEQ ID NO: 3:

аа от 140 до 145;

аа от 141 до 145;

аа от 142 до 145;

аа от 143 до 145;

аа от 144 до 145;

аа 145;

аа от 140 до 144;

аа от 141 до 144;

аа от 142 до 144;

аа от 143 до 144; или

аа 144.

В другом варианте сайты протеолитического расщепления в первом витамин К-зависимом полипептиде, которые являются N-концом и С-концом области активационного пептида, сохраняются в процессе модификации. Таким образом, сохраняется специфика активации первого витамин К-зависимого полипептида.

В другом варианте, если время полужизни в плазме профермента должно быть продлено, сайты расщепления N-конца и С-конца активации второго витамин К-зависимого полипептида заменяют сайты первого витамин К-зависимого полипептида, или сайт расщепления N-конца активации может быть извлечен из первого витамин К-зависимого полипептида, и сайт расщепления С-конца активации может быть извлечен из второго витамин К-зависимого полипептида, или наоборот. Если время полужизни в плазме активизированного витамин К-зависимого полипептида должно быть стабилизировано, то сайт расщепления С-конца или N-конца активации должен быть удален, В случае устойчивого фактора FVIIa активационный пептид должен быть сохранен с легкой цепью N-конца. Это подразумевает то, что сайт расщепления С-конца активации должен быть сохранен, тогда как сайт расщепления N-конца активации, полученный от витамин К-зависимого полипептида, должен быть удален. Также может оказаться необходимым удалить гипотетический сайт расщепления активационного пептида в Arg144.

Модификация может дополнительно включать вставку активационного пептида второго витамин К-зависимого полипептида или, как вариант, удаление, по меньшей мере, части активационного пептида первого витамин К-зависимого полипептида, в то время как предпочтительно сохранить специфику активации первого витамин К-зависимого полипептида. Часть, которая будет удалена, может состоять, по меньшей мере, из 2, предпочтительно 4, более предпочтительно, по меньшей мере, из 6 и еще более предпочтительно, по меньшей мере, из 8 смежных аминокислот активационного пептида первого витамин К-зависимого полипептида.

В другом варианте часть активационного пептида первого удаленного витамин К-зависимого полипептида может состоять, по меньшей мере, из 0,15·N смежных аминокислот в аминокислотной последовательности активационного пептида первого витамин К-зависимого полипептида, в котором N - общее количество аминокислот активационного пептида первого витамин К-зависимого полипептида. Предпочтительно часть активационного пептида первого витамин К-зависимого полипептида состоит, по меньшей мере, из 0,5·N, более предпочтительно, по меньшей мере, из 0,75·N, еще более предпочтительно, по меньшей мере, из 0,9·N, наиболее предпочтительно, по меньшей мере, из 0,95·N смежных аминокислот в аминокислотной последовательности активационного пептида первого витамин К-зависимого полипептида.

В еще одном варианте часть активационного пептида первого удаленного витамин К-зависимого полипептида состоит, по меньшей мере, из (N-x) смежных аминокислот в аминокислотной последовательности активационного пептида первого витамин К-зависимого полипептида, в котором N - общее количество аминокислот активационного пептида первого витамин К-зависимого полипептида, в котором х может быть 7, предпочтительно х - 5, более предпочтительно х - 4, более предпочтительно х - 3 и наиболее более предпочтительно х - 2.

Также возможно, что часть активационного пептида первого удаленного витамин К-зависимого полипептида состоит из центральной части активационного пептида, т.е. он не содержит собственно аминокислоту С-конца или собственно аминокислоту N-конца активационного пептида.

В конкретном варианте полный активационный пептид первого витамин К-зависимого полипептида удален.

Обычно модификация включает замену, по меньшей мере, части активационного пептида первого витамин К-зависимого полипептида вместе с частью активационного пептида второго витамин К-зависимого полипептида. Предпочтительные варианты частей активационного пептида первого витамин К-зависимого полипептида и активационного пептида второго витамин К-зависимого полипептида соответствуют описанным выше.

В конкретном варианте полный активационный пептид первого витамин К-зависимого полипептида замещен полным активационным пептидом второго витамин К-зависимого полипептида или с вариантом полного активационного пептида второго витамин К-зависимого полипептида при сохранении аминокислот, необходимых для сохранения специфики активации первого витамин К-зависимого полипептида.

В качестве не ограничивающего примера изобретение включает ввод последовательностей активационного пептида животного витамин К-зависимых полипептидов (некоторые из них показаны на фиг.1) типа мышиного, собачьего, бычьего, свиного или иного животного протромбина, также как их сочетаний.

В качестве не ограничивающего примера изобретение включает ввод активационного пептида FIX или FX в сайт активации фактора FVII, а также замену активационного пептида протеина С пептидом FIX или FX, а также замену активационного пептида FIX пептидом FX. Путем иллюстрации этой цели изобретения с предпочтительной молекулой FVII время полужизни FVII увеличивается простой заменой предполагаемого активационного пептида 8 аминокислот одним из активационных пептидов, взятых из протеина С, FIX или FX, или путем создания гибридного активационного пептида, добавляя активационные пептиды, взятые из протеина С, FIX или FX, в одну из конечных аминокислот до полного предполагаемого активационного пептида FVII.

Еще одна цель изобретения состоит в изменении посттрансляционной модификации этих перемещенных активационных пептидов, как в одном неограничивающем примере, удаление сайтов N-гликозилирования в перемещенных активационных пептидах или, альтернативно, удаление участка N-гликозилирования в предполагаемом активационном пептиде FVII между Arg144 и Arg152 может привести к уменьшению количества асиалопротеин-рецепторов опосредственного клиренс-фактора свертывания крови. В одном варианте изобретения модификация включает изменение сайтов посттрансляционной модификации в активационном пептиде. Предпочтительно модификация включает удаление, по меньшей мере, одного участка N-гликозилирования в пределах активационного пептида.

Еще одной целью изобретения является продление периода полужизни в плазме путем передачи аналогов активационных пептидов витамин К-зависимых долгоживущих белков. Аналог в его широком смысле является вставкой, имеющей длину, превышающую длину 8 непрерывных аминокислот, или консервативная замена этих аминокислот активационного пептида более долгоживущим витамин К-зависимым белком дикого типа при сохранении его сайтов расщепления N- и С-концов активации, если период полужизни профермента первого витамин К-зависимого полипептида должен быть продлен, или при сохранении его сайта расщепления N- или С-конца активации, если период полужизни активизированного витамин К-зависимого полипептида также должен быть продлен.

Консервативные замещения аминокислоты представляют собой замещения, выполняются в группах аминокислот с аналогичными характеристиками, например (1) малые аминокислоты, (2) кислые аминокислоты, (3) полярные аминокислоты, (4) основные аминокислоты, (5) гидрофобные аминокислоты и (6) ароматические аминокислоты. Примеры таких консервативных замещений приведены в табл.2.

Еще одной целью изобретения является способ увеличения устойчивости витамин К-независимого полипептида, включая модификацию его активационного пептида. Другой целью изобретения является способ увеличения функциональной полужизни или периода полужизни в плазме витамин К-зависимого полипептида, включающий модификацию его активационного пептида. Эти способы могут содержать те же самые стадии, что и описанный выше способ производства модифицированного витамин К-зависимого полипептида.

Изобретение дополнительно относится к витамин К-зависимому модифицированному полипептиду, полученному по процессу изобретения. Модифицированный витамин К-зависимый полипептид может содержать модифицированный активационный пептид, в котором модифицированный витамин К-зависимый полипептид имеет увеличенный период полужизни по сравнению с витамин К-зависимым полипептидом, в котором активационный пептид не был модифицирован.

Другой целью изобретения является модифицированный витамин К-зависимый полипептид, содержащий модифицированный активационный пептид, причем указанный модифицированный активационный пептид содержит, по меньшей мере, часть активационного пептида другого витамин К-зависимого полипептида. Альтернативно модифицированный витамин К-зависимый полипептид может содержать аналог или вариант активационного пептида другого витамин К-зависимого полипептида. Аналоги и варианты представляют собой молекулы, как определено выше.

Предпочтительно витамин К-зависимый полипептид - первый витамин К-зависимый полипептид, как определено выше. "Другой витамин К-зависимый полипептид" является вторым витамин К-зависимым полипептидом, как определено выше. Предпочтительные варианты модифицированного витамин К-зависимого полипептида по настоящему изобретению соответствуют описанным выше предпочтительным вариантам способа изобретения.

В еще одном варианте модифицированный витамин К-зависимый полипептид по настоящему изобретению демонстрирует увеличенное функциональное время полужизни по сравнению с немодифицированной формой или с формой витамин К-зависимого полипептида дикого типа. Функциональное время полужизни может быть определено в лабораторных условиях, как описано Линдли и др. (Фармокинетика и фармакодинамика рекомбинантного фактора VIIa, Clin. Pharmacol, Ther., 1994, 55:638-648).

Функциональное время полужизни обычно увеличивается, по меньшей мере, на 50%, предпочтительно, по меньшей мере, на 100%, более предпочтительно, по меньшей мере, на 200% и наиболее предпочтительно, по меньшей мере, на 500% по сравнению с немодифицированной формой и/или с формой витамин К-зависимого полипептида дикого типа.

Функциональное время полужизни формы дикого типа человеческого фактора VII равно приблизительно 4 часам. Функциональное время полужизни модифицированной молекулы фактора VII по настоящему изобретению обычно, по меньшей мере, приблизительно 6 часов, предпочтительно, по меньшей мере, приблизительно 10 часов, более предпочтительно, по меньшей мере, приблизительно 15 часов, наиболее предпочтительно, по меньшей мере, приблизительно 24 часа.

Функциональное время полужизни формы дикого типа человеческого фактора VIIa приблизительно 2 часа. Функциональное время полужизни модифицированной молекулы фактора VIIa по настоящему изобретению обычно, по меньшей мере, приблизительно 3 часа, предпочтительно, по меньшей мере, приблизительно 5 часов, более предпочтительно, по меньшей мере, приблизительно 8 часов, наиболее предпочтительно, по меньшей мере, приблизительно 12 часов.

В основном модифицированный витамин К-зависимый полипептид имеет повышенную устойчивость, по сравнению с немодифицированной формой и/или по сравнению с формой витамин К-зависимого полипептида дикого типа. Увеличение устойчивости модифицированной молекулы фактора VII может, например, быть измерено, как описано выше, при анализе биопробы.

Модифицированный витамин К-зависимый полипептид по настоящему изобретению имеет, в основном, ту же самую активность, что и соответствующая форма дикого типа и/или немодифицированная форма витамин К-зависимого полипептида. Выражение "в основном, та же самая" активность означает наличие, по меньшей мере, приблизительно 10%, предпочтительно приблизительно 50%, более предпочтительно, по меньшей мере, приблизительно 75%, наиболее предпочтительно, по меньшей мере, приблизительно 100% активности соответствующей формы дикого типа и/или немодифицированной формы витамин К-зависимого полипептида. Активность фактора VII/VIIa состоит в его способности преобразовать фактор Х субстрата в активный фактор Ха. Активность полипептида фактора VII/VIIa может быть измерена способом пробирного анализа, описанного Шоу и др., 1998, PNAS, Vol.95, стр.4229-4234 либо как описано Габриэлем и др., 2004, Sem. Hematol. Vol 41, Suppl.1, стр.20-24.

Изобретение далее относится к полинуклеотидному кодированию модифицированного витамин К-зависимого полипептида, как описано в настоящей заявке. Термин "полинуклеотид(ы)" в основном, относится к любому полирибонуклеотиду или полидеоксирибонуклеотиду, который может быть немодифицированной рибонуклеиновой кислотой РНК или ДНК или модифицированной рибонуклеиновой кислотой РНК или ДНК. Полинуклеотид может быть одноцепочной ДНК или двухцепочечной ДНК, одноцепочной или двухцепочечной РНК. Термин "полинуклеотид(ы)", как он используется здесь, также включает кислоты ДНК или РНК, которые содержат одно или несколько модифицированных оснований и/или необычных оснований типа инозина. Следует отметить, что различные модификации могут быть применены к ДНК и РНК, которые служат полезным целям, известным специалистам в данной области. Термин "полинуклеотид(ы)", как он используется здесь, охватывает химически, энзиматически или метаболически модифицировавшие формы полинуклеотидов, также как химические формы ДНК и характеристики РНК вирусов и клеток, включая, например, простые и сложные клетки.

Специалисты в данной области понимают, что из-за дегенерации генетического кода конкретный полипептид может кодироваться различными полинуклеотидами. Эти "варианты" также охватываются настоящим изобретением.

Предпочтительно полинуклеотид по настоящему изобретению - изолированный полинуклеотид. Термин "изолированный" полинуклеотид относится к полинуклеотиду, который, в основном, является свободным от других последовательностей нуклеиновой кислоты и не ограничен другими хромосомным и внехромосомными ДНК и РНК. Изолированные полинуклеотиды могут быть выделены из клетки хозяина. Обычные способы очистки нуклеиновой кислоты, известные квалифицированным специалистам, могут быть использованы для получения изолированных полинуклеотидов. Этот термин также включает рекомбинантные полинуклеотиды и химически синтезируемые полинуклеотиды.

Еще одним направлением изобретения является плазмида или вектор, содержащий полинуклеотид согласно настоящему изобретению. Предпочтительно плазмида или вектор представляет собой вектор экспрессии. В конкретном варианте этот вектор представляет собой вектор передачи для использования в терапии гена человека.

Еще одним направлением настоящего изобретения является клетка-хозяин, содержащая полинуклеотид, или плазмиду, или вектор согласно изобретению.

Клетки хозяина по настоящему изобретению могут быть использованы в способе производства модифицированного витамин К-зависимого полипептида, который является частью этого настоящего изобретения. Способ содержит следующие стадии:

(а) Выращивание клетки-хозяина по настоящему изобретению при таких условиях, в результате которых выполняется экспрессия модифицированного витамин К-зависимого полипептида, и

(б) произвольное извлечение модифицированного витамин К-зависимого полипептида из клеток хозяина или из культуральной среды.

Экспрессия в предложенных вариантах

Производство рекомбинантных белков на высоком уровне в подходящих клетках хозяина требует сборки вышеупомянутых модифицированных комплиментарных ДНК в эффективные единицы транскрипции вместе с соответствующими регуляторными элементами в рекомбинантном векторе экспрессии, который может проникать в различные экспрессионные системы по способам, известным специалистам в данной области. Эффективные регуляторные элементы транскрипции могут быть получены из вирусов, имеющих животные клетки в виде их естественного хозяина или из хромосомных ДНК животных клеток. Предпочтительно могут быть использованы комбинации промотор-энхансеров, полученные из обезьяньего вируса 40, аденовируса, вируса полиомы, человеческого вируса цитомегаловируса или длинного концевого репликатора вируса саркомы Роуса, или комбинаций промотор-энхансера, включающих конститутивно транскрибирующих генов в животных клетках подобных бета-актину или GRP78. Чтобы достичь устойчивых высоких уровней информационных РНК (мЗНЛ) транскрибированных из комплиментарных ДНК, единица транскрипции должна содержать в своей 3'-проксимальной части домен ДНК кодирования транскрипциональной терминационно-полиаденилированной последовательности. Предпочтительно эта последовательность получена из обезьяньего вируса 40 раннего домена транскрипции, гена кролика или активатора плазмогена человеческой ткани,

Комплиментарные ДНК затем объединяются в геном подходящей линии клетки-хозяина для экспрессии гибрида, модифицированного протеина домена Gla, предпочтительно FIX, FX, Протеин С, наиболее предпочтительно протеина фактора VII. Предпочтительно эта клеточная линия должна быть клеточной линией позвоночного животного, чтобы гарантировать нужное свертывание, синтез Gla-домене, формирование дисульфидной связи, глюкозирование аспарагин-связи, глюкозирование с O-связью и другие посттрансляционные модификации, а также секрецию в среду культивирования. Примеры других посттрансляционных модификаций включают O-сульфатирование тирозина, гидроксилирование и протеолитическую обработку полученной полипептидной цепи. Примерами клеточных линий, которые могут быть использованы, являются обезьяньи клетки COS-типа, мышиные L-клетки, мышиные клетки типа С 127, клетки хомяка ВНК-21, человеческие эмбриональные почечные клетки 293 и предпочтительно клетки яичника китайского хомячка.

При кодировании рекомбинантного вектора экспрессии соответствующие комплиментарные ДНК могут быть вставлены в клеточную линию животного несколькими различными способами. Например, рекомбинантные векторы экспрессии могут быть выделены из векторов, основанных на различных животных вирусах. Их примеры включают векторы, основанные на бакуловирусе, вирусе коровьей оспы, аденовирусе и предпочтительно на телячьем вирусе папилломы.

При кодировании единиц транскрипции соответствующие ДНК могут также быть введены в животные клетки вместе с другим рекомбинантным геном, который может функционировать, как доминирующий выборочный маркер в этих клетках, чтобы облегчить изоляцию конкретных клонов, клеток которые интегрировали рекомбинант ДНК в свой геном. Примерами этого типа доминирующих выбранных маркерных генов могут быть Tn5 амино-гликозид фосфотрансфераза, придающая устойчивость гентизину (G418), гигромицин фосфотрансфераза, придающая устойчивость гигромицину, и пуромицин ацетил трансферазы, придающая устойчивость пуромицину. При кодировании рекомбинантного вектора экспрессии такой выбираемый маркер может находится либо на том же самом векторе как одно кодирование кДНК желательного белка, либо он может кодироваться на отдельном векторе, который одновременно вводится и объединяется с геномом клетки-хозяина, часто приводящим к прочной физической связи между различными единицами транскрипции.

Другие типы выбираемых маркеров генов, которые могут использоваться вместе с кДНК желательного белка, основаны на различном кодировании единиц транскрипции диоргидрофолат-редуктазы (dhfr). Ввод этого типа гена в клетки, испытывающие недостаток эндогенной dhfr-активности, предпочтительно клетки яичника китайского хомячка (DUKX-B11, DG-44), позволит им расти в средах, испытывающих недостаток нуклеозидов. Примером такой среды может быть продукт F12 без гипоксантина, тимидин и глицин. Эти dhfr-гены могут быть введены вместе с единицами транскрипции кДНК фактора свертывания крови китайского хомячка вышеупомянутого типа или связаны на том же самом векторе или на различных векторах, создавая, таким образом, dhfr-положительные клеточные линии, производящие рекомбинантный белок.

Если вышеупомянутые клеточные линии выращиваются в присутствии цитотоксического ингибитора диоргидрофолат-редуктазы (dhfr) метотрексата, появляются новые клеточные линии, стойкие к метотрексату. Эти клеточные линии могут производить рекомбинантный белок с увеличенной скоростью из-за увеличенного числа сцепленных dhfr и единиц транскрипции желательного белка. При размножении этих клеточных линий при высоких концентрациях метотрексата (1-10000 нм) могут быть получены новые клеточные линии, которые производят желательный белок с очень высокой скоростью.

Вышеупомянутые клеточные линии, производящие желательный белок, можно вырастить в больших объемах, либо в суспензионной культуре, либо на различных твердых подложках. Примерами этих подложек могут быть микроносители, основанные на декстране, или коллагеновые матрицы, или твердые подложки в виде полых волокон или различных керамических материалов. Когда рост проходит в суспензионной клеточной культуре или на микроносителях, культура вышеупомянутых клеточных линий может быть приготовлена либо как ванная культура, либо как культура перфузии с непрерывным производством кондиционированной среды в течение длительного периода времени. Таким образом, согласно настоящему изобретению вышеупомянутые клеточные линии хорошо подходят для разработки промышленного процесса производства желательных рекомбинантных белков.

Рекомбинантный белок, который накапливается в среде выделяющихся клеток вышеупомянутых типов, может быть сконцентрирован и очищен различными биохимическими и хроматографическими способами, включая способы использования различий в размере, заряде, гидрофобности, растворимости, удельного сродства и т.д. между желательным белком и другими веществами в среде культивирования клетки.

Примером такой очистки является адсорбция рекомбинантного белка до моноклонального антитела, которое иммобилизировано на твердой подложке. После десорбции белок может быть дополнительно очищен различными хроматографическими методами, основанными на вышеупомянутых свойствах.

Предпочтительно обеспечить очистку модифицированного витамин К-зависимого полипептида по настоящему изобретению до чистоты 80%, более предпочтительно до чистоты 95% и, в частности, предпочтительно получить фармацевтически чистое вещество с чистотой, превышающей 99,9% в отношению к макромолекуле загрязнителя, в особенности, по отношению к другим белкам и нуклеиновым кислотам, и свободное от инфекционных и пирогенных агентов. Предпочтительно, чтобы изолированный или очищенный модифицированный витамин К-зависимый полипептид по настоящему изобретению, в основном, был бы свободен от других полипептидов.

Рекомбинантные белки, описанные в настоящем изобретении, могут быть использованы как фармацевтические терапевтические препараты. Очищенные белки могут быть растворены в обычных физиологически совместимых водных буферных растворах, к которым могут быть произвольно добавлены фармацевтические наполнители, чтобы получить конечные фармацевтические препараты.

Различные продукты по настоящему изобретению полезны как медикаменты. Соответственно изобретение относится к фармацевтическому составу, содержащему модифицированный витамин К-зависимый полипептид, как описано здесь, полинуклеотид, или плазмиды, или вектор по настоящему изобретению.

Модифицированные ДНК по настоящему изобретению могут также быть интегрированы в вектор передачи для использования в терапии человеческого гена.

Еще одной целью настоящего изобретения является использование описанного здесь модифицированного витамин К-зависимого полипептида, полинуклеотида, плазмиды или вектора по настоящему изобретению, или клетки-хозяина по настоящему изобретению для производства медикамента для лечения или предотвращения нарушения свертывания крови. Нарушения свертывания крови включают, но не ограничены, гемофилией А. Предпочтительно лечение включает терапию человеческого гена.

Изобретение также относится к способу лечения отдельных заболеваний, связанных с нарушением свертывания крови типа гемофилии А. Способ включает введение пациенту эффективного количества описанного здесь модифицированного витамин К-зависимого полипептида. В другом варианте способ включает введение пациенту эффективного количества полинуклеотида по настоящему изобретению или плазмиды или вектора по настоящему изобретению. Альтернативно способ может включать введение пациенту эффективного количества клеток хозяина по настоящему изобретению.

Описание чертежей

Фиг.1: Сравнение гомологии фактора FVII, протеина С, FIX и FX человеческого происхождения и других биологических видов.

Фиг.2: Фармакогенетика вариантов фактора FVII со вставленными активационными пептидами от долгоживущих витамин К-зависимых полипептидов.

Примеры

Настоящее изобретение будет далее описано более подробно на следующих примерах изобретения. Это описание конкретных вариантов по настоящему изобретению будет сделано со ссылками на приложенные чертежи,

Пример 1: Вставка фактора IX последовательности активационного пептида в кодирующую последовательность фактора VII

В этом примере большинство активационных пептидов FIX вставляется в соответствующее местоположение в FVII кДНК при сохранении FVII сайта активации.

Сначала фактор FVII комплиментарной ДНК, вставленный в клонирующий вектор pIRESpuro3 (Becton Dickinson; плазмида, обозначенная pFVII-538wt) подготовлена к вставке посторонних последовательностей активационного пептида путем ввода сайтов рестрикции, Nhel, между аминокислотами Ala146 и Ser147 (нумерация относится к последовательности SEQ ID NO: 3). Направленный мутагенез был выполнен, используя коммерчески доступный набор мутагенов (например, Stratagene QuickChange SiteDirected Mutagenesis Kit) no инструкциям производителя. Присадки, используемые для мутагенеза, приведены ниже; мутагенные основания обозначены заглавными буквами:

прямая присадка 5'CCTATTCTAGAAAAAAGAAATGCTAGCAAACCCCAAGGCCG3'

(SEQ ID NO: 21)

обратная присадка 5'CGGCCTTGGGGTTTGCTAGCATTTCTTTTTTCTAGAATAGG3'

(SEQ ID NO: 22)

Полученная плазмида была обозначена как pFVII-NheI186.

Далее аминокислоты активационного пептида от 165 до 194 FIX (нумерация относится к последовательности SEQ ID NO: 9) были усилены на структуре FIX кДНК полимеразной цепной реакции, используя следующие присадки:

прямая присадка

5'GTGGCTAGCGCTGAGACTGTTTTTCCTG3'

(SEQ ID NO: 23)

обратная присадка

5'CACGCTAGCTTGGGTGCTTTGAGTGATG3'

(SEQ ID NO: 24)

Обе присадки добавляли к сайту рестрикции NheI (подчеркнуто). Продукт амплификации был усвоен NheI и клонирован в NheI, чтобы получить pFVII-NheI186, как описано выше.

После проверки правильности ориентации секвенированием ДНК были выполнены две стадии мутагенеза для мутирования к первоначальному виду сайтов NheI в естественные последовательности FVII/FIX. Мутагенные присадки приведены ниже:

Присадки для мутирования к первоначальному виду сайта NheI на 5'-конце FIX:

прямая присадка

5'CTAGAAAAAAGAAATGCTCGTGCTGAGACTGTTTTTCCTGATGTGG3'

(SEQ ID NO: 25)

обратная присадка

5'CCACATCAGGAAAAACAGTCTCAGCACGAGCATTTCTTTTTTCTAG5'

(SEQ ID NO: 26)

Присадки для мутирования к первоначальному виду сайта NheI на 3'-конце вставки FIX:

прямая присадка

5'CATCACTCAAAGCACCCAATCAAGCAAACCCCAAGGCCGAATTG3'

(SEQ ID NO: 27)

обратная присадка

5'CAATTCGGCCTTGGGGTTTGCTTGATTGGGTGCTTTGAGTGATG3'

(SEQ ID NO: 28)

Полученная экспрессионная плазмида была обозначена как pFVII-552. Полученная зрелая FVII/FIX последовательность рекомбинантного белка (SEQ ID NO: 29) дается ниже, при этом последовательность активационного пептида вставленного FIX подчеркнута:

В зависимости от того, какие последовательности кДНК будут использованы для клонирования, рекомбинантный белок может также содержать полиморфизмы FVII и FIX подобно FIX активационному пептиду при полиморфизме

RAEAVFPDVDYVNSTEAETILDNITQSTQS (SEQ ID NO: 30).

Основанная на плазмиде pFVII-552 другая экспрессионная плазмида была построена с различными последовательностями перехода между FVII кДНК и последовательностями FIX активационного пептида. Для этого две стадии мутагенеза были применены к pFVII-552, как описано выше. Первая стадия заключалась в перемещении аминокислот от 145 до 147 последовательности SEQ ID NO:29, и использовались следующие присадки:

прямая присадка

5'CTATTCTAGAAAAAAGAGCTGAGACTGTTTTTCCTGATG3'

(SEQ ID NO: 42)

обратная присадка

5'CATCAGGAAAAACAGTCTCAGCTCTTTTTTCTAGAATAG3'

(SEQ ID NO: 43)

Вторая стадия мутагенеза заключалась во вставке четырех аминокислот между аминокислотами 176 и 177 последовательности SEQ ID NO: 29, и использовались следующие присадки:

прямая присадка

5'CAAAGCACCCAATCAAAGCGGAATGCTAGCAAACCCCAAGG3'

(SEQ ID NO: 44)

обратная присадка

5'CCTTGGGGTTTGCTAGCATTCCGCTTTGATTGGGTGCTTTG3'

(SEQ ID NO: 45)

Полученная плазмида была названа как pFVII-681. Полученная зрелая FVII/FIX последовательность рекомбинантного белка (SEQ ID NO: 46) дается ниже, вставленные последовательность FIX активационного пептида подчеркнуты.

Пример 2: Вставка фактора Х последовательности активационного пептида в фактор VII кодирующей последовательности

Активационный пептид FX был усилен PCR на клонированном FX кДНК, используя следующие присадки, прикрепленные к NheI сайгу рестрикции (подчеркнуты):

прямая присадка

5'GTGGCTAGCCAGGCCACCAGCAGCAG3'

(SEQ ID NO: 47)

обратная присадка

5'GCGGCTAGCATTCCGCTTCTCAGGCTGCGTCTGGTTG3'

(SEQ ID NO: 48)

Фрагмент PCR, содержащий активационный пептид FX, был затем усвоен NheI и лигирован в обработанную NheI плазмиду pFVII-NheI186 (пример 1). На двух последующих стадиях был осуществлен сайт-направленный мутагенез, как описано выше, и переход между последовательностью FVII кДНК и активационным пептидом FX был скорректирован.

Сначала стадия мутагенеза была выполнена со следующими олигонуклеотидами:

прямая присадка

5'CCTATTCTAGAAAAAAGAAATGCCCAGGCCACCAGCAGCAGCGG3'

(SEQ ID NO: 49)

обратная присадка

5'CCGCTGCTGCTGGTGGCCTGGGCATTTCTTTTTTCTAGAATAGG3'

(SEQ ID NO: 50)

Вторая стадия мутагенеза была выполнена со следующими олигонуклеотидами:

прямая присадка

5'CCTATTCTAGAAAAAAGCGTGGCCCAGGCCACCAGCAGCAGCGGGG3'

(SEQ ID NO: 51)

обратная присадка

5'CCCCGCTGCTGCTGGTGGCCTGGGCCACGCTTTTTTCTAGAATAGG3'

(SEQ ID NO: 52)

Полученная плазмида была названа pFVII-611. Полученная зрелая последовательность FVII/FX рекомбинантного белка (SEQ ID NO:53) дается ниже, причем вставленная последовательность активационного пептида FX подчеркнута:

Пример 3: Вставка последовательности активационного пептида фактора Х в кодирующую последовательность фактора IX

В этом примере активационный пептид FX вставлен в соответствующее местоположение в FIX кДНК с сохранением сайта активации FIX.

Сначала подготавливается FIX кДНК в клонирующем векторе pIRESpuro3 (Becton Dickinson) для вставки посторонних последовательностей активационного пептида путем введения двух сайтов рестрикции: сайт XbaI между аминокислотами Ser161 и Lys162 и сайт PinAI между Thr192 и Gln193 (нумерация относится к последовательности SEQ ID NO: 9). Направленный на сайт мутагенез осуществлялся, используя коммерчески имеющийся набор мутагенеза (например, Stratagene QuickChange SiteDirected набор мутагенеза) по инструкциям производителя. Присадки, используемые для мутагенеза, приведены ниже; мутагенные основания обозначены заглавными буквами.

Мутагенные присадки для ввода сайга XbaI:

прямая присадка

5'GAAGAGTTTCTGTTTCACAAACTTCTAGACTCACCCGTGCTGAGAC3'

(SEQ ID NO: 31)

обратная присадка

5'GTCTCAGCACGGGTGAGTCTAGAAGTTTGTGAAACAGAAACTCTTC3'

(SEQ ID NO: 32)

Мутагенные присадки для ввода сайта PinAI:

прямая присадка

5'GGATAACATCACTCAAAGCACCGGTTCATTTAATGACTTCACTCGGGTTG3'

(SEQ ID NO: 33)

обратная присадка

5'CAACCCGAGTGAAGTCATTAAATGAACCGGTGCTTTGAGTGATGTTATCC3'

(SEQ ID NO: 34)

Далее аминокислоты 159-213 активационного пептида FX (нумерация относится к последовательности SEQ ID NO:12) были усилены полимеразной цепной реакцией, используя следующие присадки для добавления сайта 5'-конца Xbal и 3'-конца (подчеркнуто):

прямая присадка

5'GTGTCTAGAAGGAAGAGGTCAGTGGCCC3'

(SEQ ID NO: 35)

обратная присадка

5'CACACCGGTGAGGTTGTTGTCGCCC3'

(SEQ ID NO: 36)

Продукт амплификации было усвоен с XbaI и PinAI и клонирован в Xbal, и PinAI FIX с усвоенной кДНК был модифицирован, как описано выше. Затем были выполнены стадии мутагенеза для мутирования к первоначальному виду сайтов Xbal и PinAI в естественной последовательности FIX и FX. Мутагенные присадки приведены ниже:

Присадки для мутирования к первоначальному виду сайта Xbal во вставке 5'-конца FX:

прямая присадка

5'GASTTTCTGTTTCACAAACTTCTCTCGCAGGAAGAGGTCAGTGG3'

(SEQ ID NO: 37)

обратная присадка

5'CCACTGACCTCTTCCTGCGAGAAGTTTGTGAAACAGAAACTC3'

(SEQ ID NO: 38)

Присадки для мутирования к первоначальному виду сайта XbaI во вставке 3'-конца FX:

прямая присадка

5'GCGACAACAACCTCACCCAATCATTTAATGACTTCACTCGGGTTG3'

(SEQ ID NO: 39)

обратная присадка

5'CAACCCGAGTGAAGTCATTAAATGATTGGGTGAGGTTGTTGTCGC3'

(SEQ ID NO: 40)

Полученная зрелая последовательность рекомбинантного белка FIX/FX (SEQ ID NO: 41) дается ниже, при этом вставленная последовательность активационного пептида FX подчеркнута.

Пример 4: Трансфекция и экспрессия модифицированных белков FVII и FIX Экспрессионные плазмиды были выращены в E.coli TOP10 (инвитроген) и рафинированы, используя стандартные протоколы (Qiagen). 293 клетки НЕК (инвитроген) были перенесены, используя реактив липофектрамин 2000 (инвитроген), и выращены в бессывороточной среде (специальный инвитроген 293) в присутствии 50 нг/мл витамина К3 и 4 мкг/мл пуромицина. Перенесенные популяции клеток были помещены в Т-колбы роллер-флакона, из которых кондиционированная среда была собрана для очистки.

Пример 5: Очистка модифицированных белков FVII

Белки FVII были рафинированы, как описано в патенте ЕР 0770625. В этом процессе растворимый фактор ткани (FT) был ковалентно связан с гранулами сефарозы цианида брома. Фактор FVII, содержащий культуры клетки кондиционированной среды, был загружен в 10-мМ буфер кальция. Несвязанные белки были промыты тем же самым буфером. Элюция связанных белков FVII была выполнена в 100-мМ буфере цитрата натрия.

Пример 6: Определение активности FVII и антигена

Антиген FVII был определен с помощью иммуноферментного анализа, выполнение которого известно специалистам в данной области. В процессе анализа микрочашки были культивированы 120 мкл на чашку иммобилизованного антитела (иммуноген FVII IgG, седарин CL20030AP, растворенные в буфере А 1:1000 [Sigma C3041]) и выдерживались в течение ночи при температуре окружающей среды. После промывки чашек три раза буфером В (Sigma P3563), каждая из них была культивирована 200 мкл буфера С (Sigma P3688) в течение одного часа при температуре окружающей среды. После трех стадий промывки буфером В серийные разбавленные растворы контрольного образца в буфере В, также как серийные разбавленные растворы обычной человеческой плазмы (Dade Behring; 50-0,5 mU/ml) в буфере В (в объеме на чашку, равную 100 мкл), были культивированы в течение двух часов при температуре окружающей среды. После трех стадий промывки буфером В 100 мкл разбавленного раствора (1:5000) в буфере В обнаруженные антитела (иммуноген FVII IgG, Cedarlane CL20030K, меченой пероксидазы) были добавлены в каждую чашку и культивированы в течение еще двух часов при температуре среды. После трех стадий промывки буфером В 100 мкл раствора субстрата (ТМВ, Dade Behring, OUVF) были добавлены в каждую чашку и культивированы в течение 30 минут при температуре среды в темноте. Добавление 100 мкл неразбавленного стоп-раствора (Dade Behring, OSFA) подготовило образцы для отсчета показания соответствующего устройства считывания микрочастиц на длине волны 450 нм. Затем были рассчитаны концентрации испытательных образцов, используя калибровочную кривую со стандартной человеческой плазмой в виде эталона.

Пример 7: Фармокинетика модифицированных белков FVII

Белки дикого типа и модифицированные белки FVII вводятся внутривенно наркотизированным крысам Льюиса (6 крыс на вещество) с дозой 100 мкг/кг веса тела. Пробы крови были отобраны из сонной артерии трех крыс через 5,30, 60, 120 и 480 минут, а у других трех крыс через 15, 45, 90 и 240 минут. Содержание антигена FVII было впоследствии количественно определено иммунноферментным анализом, специфичным для человеческого фактора VII (см. выше). Средние концентрации антигена FVII для каждой группы показаны на фиг.2. Табл.5 суммирует расчетное время полужизни для альфа-фазы и бета-фазы элиминации, благодаря чему альфа-фаза была определена в пределах 5-30 минут и бета-фаза - в пределах 30 минут от последней временной точки с концентрациями выше предела обнаружения антигена иммунноферментным анализом. Вычисления были сделаны по формуле T1/2=ln2/k, где k - наклон линии регрессии:

Таблица 5
Структура Время полужизни альфа-фазы Время полужизни бета-фазы Бета-фаза вычислялась по времени Увеличение времени жизни (бета-фаза) по сравнению с CVII дикого типа
pVVII-538wt 10 29 30-90 мин в 4,4 раза
pVVII-552 20 128 30-480 мин в 4,4 раза
pVVII-611 19 102 30-240 мин в 3,5 раза
pVVII-681 22 178 30-480 мин в 6,1 раза

Эти данные ясно показывают, что замена естественного активационного пептида FVII активационным пептидом от более долгоживущих факторов протромбина в лабораторных условиях значительно продлевает время полужизни белков по сравнению с белком FVII дикого типа.

1. Способ получения модифицированного витамин К-зависимого полипептида, включающий модификацию активационного пептида,
а. в котором модифицированный активационный пептид включает, по меньшей мере, часть последовательности аминокислот второго витамин К-зависимого полипептида и
b. в котором указанная часть последовательности аминокислот второго витамин К-зависимого полипептида представляет собой
i. по меньшей мере, 3 смежных аминокислоты активационного пептида FVII,
ii. по меньшей мере, 5 смежных аминокислот активационного пептида FX, или
iii. по меньшей мере, 5 смежных аминокислот активационного пептида FIX с условием, что пептид QSFNDFTR исключен, или
iv. по меньшей мере, 8 смежных аминокислот активационного пептида протромбина, или
v. по меньшей мере, удлинение на смежные аминокислоты активационного пептида второго витамин К-зависимого полипептида, которое имеет длину, по меньшей мере, равную 15% полной длины последовательности аминокислот активационного пептида второго витамин К-зависимого полипептида, в котором второй витамин К-зависимый полипептид, выбран из группы, состоящей из протеина Z, GAS6 и протеина S,
и где второй витамин К-зависимый полипептид имеет увеличенное время полужизни в плазме.

2. Способ по п.1, где второй витамин К-зависимый полипептида выбран из группы, состоящей из фактора IX, фактора Х и протромбина.

3. Способ по п.2, где второй витамин К-зависимый полипептид выбран из группы, состоящей из человеческого фактора IX, человеческого фактора Х и человеческого протромбина.

4. Способ по п.1, где второй витамин К-зависимый полипептид содержит последовательность аминокислот, выбранную из группы, состоящей из SEQ ID NO 9, 12 и 15.

5. Способ по п.1, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой, по меньшей мере, 8 смежных аминокислот.

6. Способ по п.1, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой, по меньшей мере, 12 смежных аминокислот.

7. Способ по п.1, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой, по меньшей мере, 15 смежных аминокислот.

8. Способ по п.1, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой центральную часть активационного пептида.

9. Способ по п.1, где модифицированный витамин К-зависимого полипептид содержит полный активационный пептид второго витамин К-зависимого полипептида.

10. Способ по п.1, где модифицированный витамин К-зависимый полипептид представляет собой человеческий фактор VII или VIIa.

11. Способ по п.1, где модифицированный витамин К-зависимый полипептид представляет собой человеческий протеин С.

12. Способ по п.п.1, 11, где аминокислотная последовательность активационного пептида второго витамин К-зависимого полипептида выбрана из группы, состоящей из SEQ ID NO 18 и 19.

13. Способ по п.1, где модифицированный витамин К-зависимый полипептид представляет собой человеческий фактор IX, и активационный пептид второго витамин К-зависимого полипептида имеет последовательность аминокислот SEQ ID NO. 19.

14. Способ по любому из пп.1-13, в котором указанная модификация, по существу, не изменяет специфику активации модифицированного витамин К-зависимого полипептида.

15. Способ по п.1, где активированная форма модифицированного витамин К-зависимого полипептида имеет увеличенное время полужизни в плазме по сравнению с активизированной формой не модифицированного витамин К-зависимого полипептида.

16. Способ по п.1, где зимогенная форма модифицированного витамин К-зависимого полипептида имеет увеличенное время полужизни в плазме по сравнению с зимогенной формой не модифицированного витамин К-зависимого полипептида, и где модифицированный активационный пептид модифицированного витамин К-зависимого полипептида освобождается при активации модифицированного витамин К-зависимого полипептида.

17. Способ по п.1, где активированная форма модифицированного витамин К-зависимого полипептида имеет увеличенное время полужизни в плазме по сравнению с активизированной формой не модифицированного витамин К-зависимого полипептида, и где модифицированный активационный пептид модифицированного витамин К-зависимого полипептида остается ковалентно прикрепленным либо к легкой, либо к тяжелой цепи модифицированного витамин К-зависимого полипептида.

18. Способ по п.1, где зимогенная форма модифицированного витамин К-зависимого полипептида имеет увеличенное время полужизни в плазме по сравнению с зимогенной формой не модифицированного витамин К-зависимого полипептида, и где модифицированный активационный пептид модифицированного витамин К-зависимого полипептида при активации модифицированного витамин К-зависимого полипептида остается ковалентно прикрепленным либо к легкой, либо к тяжелой цепи модифицированного витамин К-зависимого полипептида.

19. Способ по п.1, где активированная форма модифицированного витамин К-зависимого полипептида имеет увеличенное время полужизни в плазме по сравнению с активизированной формой не модифицированного витамин К-зависимого полипептида, и где модифицированный активационный пептид модифицированного витамин К-зависимого полипептида освобождается при активации модифицированного витамин К-зависимого полипептида.

20. Модифицированный витамин К-зависимый полипептид, полученный способом по п.1, обладающий коагуляционной активностью.

21. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, у которого время полужизни увеличено, по меньшей мере, на 50% по сравнению с соответствующим витамин К-зависимым полипептидом, в котором активационный пептид не был модифицирован.

22. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где второй витамин К-зависимый полипептид выбран из группы, состоящей из фактора IX, фактора Х и протромбина.

23. Модифицированный витамин К-зависимый полипептид, полученный способом по п.17, где второй витамин К-зависимый полипептид выбран из группы, состоящей из человеческого фактора IX, человеческого фактора Х и человеческого протромбина.

24. Модифицированный витамин К-зависимый полипептид, полученный способом по п.18, где второй витамин К-зависимый полипептид содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO 9, 12 и 15.

25. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой, по меньшей мере, 8 смежных аминокислот.

26. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой, по меньшей мере, 12 смежных аминокислот.

27. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой, по меньшей мере, 15 смежных аминокислот.

28. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где часть активационного пептида второго витамин К-зависимого полипептида представляет собой центральную часть активационного пептида.

29. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где модифицированный витамин К-зависимый полипептид содержит полный активационный пептид второго витамин К-зависимого полипептида.

30. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где модифицированный витамин К-зависимый полипептид представляет собой человеческий фактор VII или VIIa.

31. Модифицированный витамин К-зависимый полипептид, полученный способом по пп.15-19, где аминокислотная последовательность активационного пептида второго витамин К-зависимого полипептида выбрана из группы, состоящей из SEQ ID NO: 18 и 19.

32. Модифицированный витамин К-зависимый полипептид, полученный способом по п.15, где модифицированный витамин К-зависимый полипептид представляет собой человеческий фактор IX, и активационный пептид второго витамин К-зависимого полипептида имеет последовательность аминокислот SEQ ID NO: 19.

33. Модифицированный витамин К-зависимый полипептид, полученный способом по любому из пп.15-19, в котором указанная модификация не изменяет специфику активации модифицированного витамин К-зависимого полипептида.

34. Полинуклеотид, кодирующий модифицированный витамин К-зависимый полипептид по любому из пп.20-33.

35. Вектор экспрессии, содержащий полинуклеотид по п.34.

36. Плазмида, экспрессирующая полинуклеотид по п.34.

37. Клетка-хозяин, содержащая полинуклеотид по п.35 или вектор по одному из пп.35 или 36, предназначенная для экспрессии.

38. Способ получения модифицированного витамин К-зависимого полипептида, включающий:
выращивание клеток-хозяев по п.37 в условиях, подходящих для экспрессии;
выделение модифицированного витамин К-зависимого полипептида из клеток-хозяев или культуральной среды.

39. Применение модифицированного витамин К-зависимого полипептида по любому из пп.20-33, или вектора по п.35, или плазмиды по п.36 для производства лекарственного средства для лечения или профилактики нарушения свертывания крови.

40. Применение по п.39, где нарушение свертывания крови представляет собой гемофилию А.



 

Похожие патенты:

Изобретение относится к биотехнологии и касается фермента транс-сиалидазы. .

Изобретение относится к области биотехнологии, в частности к способу получения варианта фермента гликолипидацилтрансферазы, предусматривающему: (а) выбор исходного фермента, представляющего собой фермент гликолипидацилтрансферазу, причем фермент содержит аминокислотный мотив GDSX, где Х представляет собой один или несколько из следующих аминокислотных остатков L, А, V, I, F, Y, H, Q, Т, N, М или S; (b) модификацию одной или нескольких аминокислот с получением варианта гликолипидацилтрансферазы; (с) тестирование варианта гликолипидацилтрансферазы на трансферазную активность, необязательно, гидролитическую активность в отношении галактолипидного субстрата и, необязательно, фосфолипидного субстрата и/или, необязательно, триглицеридного субстрата; (d) отбор варианта фермента с повышенной активностью в отношении галактолипидов по сравнению с исходным ферментом; и, необязательно, (е) получение большого количества варианта фермента.

Изобретение относится к области биотехнологии и может быть использовано для получения сложных эфиров таких соединений, как углеводы, белки, белковые субъединицы и гидроксикислот.

Изобретение относится к биотехнологии и представляет собой способ детоксикации микотоксинов, согласно которому микотоксин подвергают взаимодействию с глюкозилтрансферазой в присутствии активированной глюкозы.

Изобретение относится к биотехнологии и касается варианта сфингозинкиназы, обладающего сниженной способностью к фосфорилированию сфингозина до сфингозин-1-фосфата.

Изобретение относится к биотехнологии и касается нового штамма бактерий, продуцирующего циклодекстринглюканотрансферазу (ЦГТазу К.Ф.2.4.1.19), с повышенной специфичностью в отношении образования бета-циклодектрина.

Изобретение относится к генной инженерии растений и пищевой промышленности. .

Изобретение относится к области биотехнологии и представляет собой ген металлопротеиназы 1 с последовательностью нуклеотидов, приведенной на фиг.1. .

Изобретение относится к биотехнологии и представляет собой ген металлопротеиназы 8 с последовательностью нуклеотидов, приведенной на чертеже. .

Изобретение относится к области биотехнологии и может быть использовано в фармакологии и медицине. .

Изобретение относится к области биотехнологии и может быть использовано в легкой промышленности. .

Изобретение относится к биологии, научно-практической фармакологии, биохимии и касается выделенного фрагмента ДНК с указанной последовательностью нуклеотидов, кодирующего белок, обладающий свойством внутримембранной эндопротеазы (IMPAS), а также способа получения указанного белка.

Изобретение относится к области энзимологии и белковой инженерии и может быть использовано в различных отраслях народного хозяйства, которые производят продукцию, содержащую добавки фермента с протеолитической активностью.

Изобретение относится к области генной и белковой инженерии и может быть использовано при создании новых моющих средств и очищающих составов. .
Изобретение относится к области медицины и касается способов лечения трахеального, бронхиального или альвеолярного кровотечения или кровохарканья. .

Изобретение относится к биотехнологии

Наверх