Новый пептид, участвующий в энергетическом гомеостазе



Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе
Новый пептид, участвующий в энергетическом гомеостазе

 


Владельцы патента RU 2409590:

БОРД ОФ СЬЮПЕРВАЙЗОРЗ ОФ ЛУИЗИАНА СТЭЙТ ЮНИВЕРСИТИ ЭНД ЭГРИКАЛЧУРАЛ ЭНД МЕКЭНИКАЛ КОЛЛЕДЖ (US)

Изобретение относится к биотехнологии. Описана фармацевтическая композиция, содержащая пептид Enho 1 или его функциональный фрагмент, функциональный гомолог или функциональный структурный аналог с консервативными аминокислотными заменами, и фармацевтически приемлемый носитель для лечения и профилактики патофизиологического состояния, связанного с повышенной массой тела. Предложены способы лечения и профилактики патофизиологического состояния, относящегося к гомеостазу массы тела, включающие введение индивидууму терапевтически эффективного количества описанной фармацевтической композиции. Представлены способы улучшения или снижения резистентности к инсулину у индивидуума, облегчения или лечения симптомов диабета у индивидуума, предотвращения или задержки начала ожирения у индивидуума, включающие введение индивидууму терапевтически эффективного количества пептида Enho l или его функционального фрагмента, функционального гомолога или функционального структурного аналога с консервативными аминокислотными заменами. Изобретение можно использовать в качестве терапевтических или диагностических средств при гиперхолестеринемии, гипертриглицеридемии, резистентности к инсулину, ожирении, диабете и/или нарушениях энергетического баланса. 7 н. и 4 з.п. ф-лы, 23 ил., 5 табл.

 

В соответствии с договорами и соглашениями во всех странах по настоящей заявке испрашивается приоритет предварительной патентной заявки США № 60/705940, дата подачи 5 августа 2005 года. В США испрашивается приоритет предварительной патентной заявки США № 60/705940, дата подачи 5 августа 2005 года в соответствии со статьей 35 U.S.C. §119(e).

ОБЛАСТЬ ТЕХНИКИ

Настоящее изобретение относится к новому гену и образующемуся в результате белку, называемому "ассоциированный с энергетическим гомеостазом 1" (Enho1), который, как было обнаружено, связан с резистентностью к инсулину и липидемией при ожирении и с изменениями в энергетическом гомеостазе.

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Ожирение представляет собой все больше распространяющееся глобальное заболевание, достигшее размахов эпидемии. В настоящий момент оценки указывают, что по меньшей мере 50% западной популяции либо имеют избыточный вес, либо страдают ожирением. Ожирение, особенно ожирение по абдоминальному типу, в сочетании с другими состояниями, такими как резистентность к инсулину, дислипидемия, жировой гепатоз и гипертензия, называется метаболический синдром или синдром резистентности к инсулину. Основными патофизиологическими признаками дислипидемии, связанной с резистентностью к инсулину и диабетом типа 2, являются повышение уровня триглицеридов (TG) плазмы во фракции липопротеинов очень низкой плотности (VLDL) и пониженный холестерин липопротеинов высокой плотности (HDL). Как правило, повышенные количества циркулирующего TG гидролизуются в свободные жирные кислоты (FFA) и захватываются периферическими тканями, включая печень, что может приводить к жировому гепатозу или неалкогольному ожирению печени. Исследования на нескольких моделях ожирения и метаболических расстройств мутантных мышей позволили предположить о сложной связи между резистентностью к инсулину и нарушением регуляции TG и вовлеченности периферических и центральных факторов.

Резистентность к инсулину относится к пониженному поглощению глюкозы в скелетной мускулатуре и жировой ткани, стимулируемому инсулином, и пониженному подавлению выхода глюкозы из печени [2]. Гипергликемия и гиперлипидемия являются побочными эффектами и причинными факторами в патофизиологическом состоянии диабета типа 2. Глюкотоксичность и липотоксичность дополнительно способствуют развитию резистентности к инсулину и диабета типа 2 за счет подавления действия инсулина и его секреции из β-клеток. Сначала гиперинсулинемия успешно подавляет выход глюкозы из печени, кроме того, вредные воздействия повышенного уровня инсулина нейтрализуют благоприятный эффект поддержания нормальных уровней глюкозы в крови [2]. Предполагают, что гиперинсулинемия является фактором в группе метаболических нарушений, включая гипертензию, неалкогольное ожирение печени (NAFLD) и коронарное заболевание сердца [2]. Заболевание NAFLD часто связано с резистентностью к инсулину, и для него необходимы два фактора транскрипции: белок, связывающий регулируемый стеролами элемент, 1c (SREBP1c), и рецептор пролифератора пероксисом γ (PPARγ) (3-6). Отсутствие передачи сигнала SREBP1c или PPARγ в печени ингибирует развитие жирового гепатоза, возникающего у тучных мышей с резистентностью к инсулину [5-7].

Определение общего механизма, объясняющего резистентность к инсулину, было затруднено вследствие сложной системы передачи сигнала рецептора инсулина (IR) и понимания того, что существует не один, а множество факторов, вносящих вклад в развитие заболевания. Фосфорилирование тирозина двух адаптерных белков, IRS1 и IRS2, является важной ранней стадией стимуляции захвата глюкозы под действием инсулина [8-11]. IRS1 и IRS2 не обладают собственной ферментативной активностью и, как полагают, функционируют как часть молекулярного каркаса, облегчающего формирование комплексов белков с киназной, фосфатазной или убиквитинлигазной функцией [12]. Стимуляция фосфоинозитид-3'-киназы (PI3K) посредством ассоциации с IRS является важной стадией захвата глюкозы, стимулированного инсулином. Активация каталитической субъединицы PI3K p110 активирует липидкиназный домен, который фосфорилирует фосфатидилинозит-4,5-бисфосфат. Для полной стимуляции захвата глюкозы под действием инсулина обязательна активация PI3K, хотя также могут быть вовлечены другие пути [12].

Полагают, что метаболическое состояние, ведущее к развитию резистентности к инсулину, является результатом дисбаланса между потреблением калорий и окислительным метаболизмом [13, 14]. Исследования позволяют предположить, что пониженная функция митохондрий в мышцах является фактором развития резистентности к инсулину, связанной с ожирением [14, 15]. Стимуляция потребления энергии и подавление аппетита приводят к улучшению метаболизма глюкозы на моделях ожирения и диабета типа 2 мышей. Хорошо изученным примером является адипоцитокин лептин. Лептин действует в гипоталамусе и заднем мозге, подавляя аппетит, и посредством стимуляции вегетативной нервной системы увеличивает окислительный метаболизм в скелетной мускулатуре [16-20]. Кроме того, независимо от указанного действия на потребление пищи или массу тела лептин также может улучшать чувствительность печени к инсулину [17].

Инфузия жирных кислот (FA) связана с быстрым снижением чувствительности к инсулину в мышцах в пределах 4-6 час [21-23]. Точный механизм, посредством которого FA снижают стимулированный инсулином захват глюкозы, остается предметом дискуссий. Последние данные указывают на то, что FA влияет на сигнальный путь IR, стимулирующий захват глюкозы [21, 22, 24]. Одна из гипотез состоит в том, что повышение внутриклеточной концентрации FA и диацилглицерина ведет к активации серинкиназы, протеинкизазы C θ (PKCθ) [25]. Фосфорилирование IRS1 по Ser307 посредством PKCθ ингибирует фосфорилирование IRS-1 посредством IR, что приводит к пониженной активации PI3K и снижению стимуляции захвата глюкозы под действием инсулина.

Патологическая активность секретируемых полипептидов как связь между ожирением и резистентностью к инсулину. Определение механизмов, связывающих ожирение с резистентностью к инсулину, является важным для разработки новых способов лечения снижения глюкозы. Недавние исследования по изучению резистентности к инсулину были сфокусированы на адипоцитах. Ожирение связано с нарушенной регуляцией и функционированием регуляторной сети полипептидов, секретируемых адипоцитами (адипоцитокинами). Адипоцитокины, такие как лептин, адипонектин и резистин, регулируют продукцию глюкозы в печени, потребление глюкозы в мышцах и пролиферацию адипоцитов и накопление в них липидов [26]. Лептин регулирует энергетический гомеостаз путем воздействия на нейроны, расположенные в гипоталамусе и заднем мозге, которые регулируют пищевое поведение, активность вегетативной нервной системы и нейроэндокринной системы, регулирующих метаболизм (щитовидная железа, надпочечники) [16]. Резистентность к лептину или пониженный сывороточный адипонектин, связанные с ожирением, являются факторами, делающими вклад в развитие резистентности к инсулину, за счет понижения активирующей инсулин активности и за счет увеличения риска развития ожирения (внутриклеточное накопление жирных кислот) [27, 28]. Нежировые ткани также секретируют пептиды, которые влияют на энергетический метаболизм и чувствительность к инсулину, такие как масклин мышц [29] и родственный ангиопоэтину ростовой фактор печени [30]. Эти факторы также могут быть мишенями для лечения метаболического синдрома.

Нокаут рецепторов меланокортина для исследования связи между ожирением и резистентностью к инсулину: В энергетический гомеостаз вовлечены два рецептора меланокортина, экспрессируемых в областях центральной нервной системы. Направленная делеция гена нейронального рецептора меланокортина-4 (MC4R) у мышей (мыши Mc4r-/- или Mc4rKO) вызывает ожирение и гиперинсулинемию, а также связана с увеличенной экспрессией генов липогенеза в печени и жировым гепатозом. У мышей с дефицитом другого нейронального рецептора меланокортина (мыши Mc3r-/- или Mc3rKO) при диете с высоким потреблением жиров развивается степень ожирения, сходная со степенью ожирения мышей Mc4r-/-, но резистентность к инсулину, гиперлипидемия и увеличенный жировой гепатоз имеют отличный уровень. Исследования с использованием линий Mc3rKO и Mc4rKO показали, что в обеих линиях происходит развитие патологического ожирения, вызванное диетой, однако ухудшение чувствительности к инсулину у Mc4rKO происходит быстрее и тяжелее [31, 32]. На фиг.1A-1E проиллюстрированы некоторые из известных различий у мышей дикого типа (C57BL/6J) и двух мышей с нокаутом в единицах массы тела как функция в зависимости от диеты с низким содержанием жира или диеты с высоким содержанием жира [31, 32]. Тяжелая резистентность к инсулину у мышей и людей связана с гепатомегалией и ожирением с увеличенным липогенезом в печени [33]. У Mc4rKO ожирение сопровождается печеночной резистентностью к инсулину и гепатомегалией, а при диете с высоким содержанием жира (HFD) у Mc4rKO отмечается заметное ухудшение гомеостаза глюкозы, связанное с тяжелой непереносимостью глюкозы и инсулина. На фиг.2A-2E показаны различия гепатомегалии и ожирения у двух линий мышей, а также различия экспрессии генов, вовлеченных в метаболизм липидов [4, 17, 57]. С другой стороны, у Mc3rKO, соответствующих Mc4rKO по жировой массе (FM), отмечают крайне незначительное ухудшение гомеостаза глюкозы.

Последовательности кДНК, сходные с Enho1. Последовательность и предполагаемая открытая рамка считывания кДНК, кодирующие соответствующие белковые гомологи ENHO1, опубликованы ранее несколькими группами, принимающими участие в широкомасштабном секвенировании кДНК. См. R.L. Stausberg et al., "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences," Proc. Natl. Acad. Sci. U.S.A., vol. 99, pp. 16899-16903 (2002) (инвентарный номер Genbank: BC021944, кДНК с полной кодирующей последовательностью); и H.F. Clark et al. "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment," Genome Res., vol. 13, pp. 2265-2270 (инвентарный номер Genbank: NM_198573, кДНК с полной кодирующей последовательностью). Идентифицирован белок с высокой гомологией с первыми 37 аминокислотными остатками SEQ ID NO: 2. Кроме того, нуклеотидная и аминокислотная последовательность описанного белка может быть неправильной вследствие однонуклеотидных ошибок при секвенировании кДНК. Данные о функции описанного в настоящем документе белка ранее опубликованы не были.

ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Авторы обнаружили новый секретируемый пептид (ENHO1) при исследовании с использованием двух моделей ожирения на трансгенных мышах. Используя анализ экспрессии генов на микрочипах и проверки посредством количественной ПЦР с детекцией в реальном времени, было обнаружено, что экспрессия мРНК (инвентарный номер Genbank: AK009710), кодирующей предполагаемый секретируемый белок с 76 аминокислотами, в 10 раз снижена у мышей Mc4rKO с тяжелой резистентностью к инсулину и непереносимостью глюкозы и у мышей с дефицитом без лептина (Lepob/Lepob). Напротив, у мышей Mc3rKO с ожирением и умеренной непереносимостью глюкозы, но демонстрирующих нормальный ответ на инсулин, наблюдали невысокое 30-40% снижение экспрессии белка Enho1. У мышей C57BL/6J выявлена отрицательная корреляция экспрессии мРНК Enho1 в печени с уровнями глюкозы при голодании. Экспрессия Enho1 в гипоталамусе при ожирении и резистентности к инсулину также снижалась. Авторы также подтвердили, что мРНК кодировала секретируемый белок. На основе отрицательного воздействия индуцированного диетой ожирения и резистентности к инсулину на экспрессию мРНК Enho1 в печени и головном мозге ген, кодирующий белок, назвали "Enho1" ("ассоциированный с энергетическим гомеостазом 1"). Для увеличения экспрессии Enho1 в моделях ожирения на мышах использовали рекомбинантный аденовирус. Сверхэкспрессия Enho1 путем инъекции аденовируса значительно и воспроизводимо снижала уровни инсулинового голодания, триглицеридов и холестерина. Кроме того, у мышей Lepob/Lepob при обработке аденовирусом с Enho 1 снижались уровни экспрессии ключевого гена, вовлеченного в липогенез (синтазы жирных кислот), и белка FAS.

С использованием ДНК Enho1 (SEQ ID NO: 1) под контролем промотора β-актина человека, который экспрессируется во всех тканях, получена линия трансгенных мышей FVB/NJ, сверхэкспрессирующих белок Enho1. Самки мышей FVB/NJ, сверхэкспрессирующих Enho1, обладали значимо пониженной массой жира и повышенным уровнем метаболизма, определяемого посредством измерения потребления кислорода (VO2) с применением непрямой калориметрии (Oxymax, Columbus Instruments, Columbus, Ohio). Наблюдаемое у трансгенных мышей повышение уровня метаболизма было спрогнозировано на основе результатов экспериментов с использованием мышей с инъекцией рекомбинантного аденовируса, экспрессирующего Enho1. Мыши, инфицированные рекомбинантным аденовирусом, экспрессирующим Enho1, теряли больше массы при ночном голодании, что означает ухудшенную способность снижать уровень метаболизма для компенсации голодания. У трансгенных по Enho1 мышей FVB/NJ наблюдалась сходная увеличенная потеря массы при голодании, связанная с повышенным уровнем метаболизма. Таким образом, составляющая часть антидиабетического действия Enho1 может вовлекать стимуляцию путей, вовлеченных в окислительный метаболизм. Т.е. Enho1 может улучшать метаболический профиль устойчивых к инсулину индивидуумов с ожирением частично посредством нормализации баланса потребления калорий и расхода калорий (кДж) посредством воздействия на психическую активность, базальный уровень метаболизма или их сочетание.

Полноразмерный пептид Enho1 или фрагменты, производные, гомологи, аналоги пептида или их миметики, вводимые путем перорального приема, инъекции, подкожного пластыря или интраназального введения, можно использовать в качестве терапевтических или диагностических средств при гиперхолестеринемии, гипертриглицеридемии, резистентности к инсулину, ожирении, диабете и/или нарушениях энергетического баланса.

К пептидным фрагментам, получаемым на основе открытой рамки считывания, предположенной для BC021944 и показанной на фиг.5, индуцированы антитела (AB1 (SEQ ID NO: 8) и AB2 (SEQ ID NO: 9)). Эти антитела использовали для подтверждения наличия иммунологической реактивности к Enho1 в сыворотке человека и головном мозге крысы, убедительно подтверждая заключение, что открытая рамка считывания, предположенная для BC021944, кодирует небольшой секретируемый пептид. Иммунологическая реактивность к Enho1 выявлена в плазме человека (данные не показаны). В головном мозге крыс нейроны с иммунологической реактивностью к Enho1 выявлены в дугообразном ядре гипоталамуса. Значение этого открытия состоит в том, что нейроны в дугообразном ядре гипоталамуса вовлечены в регуляцию потребления энергии посредством воздействия на условные термогенез и физическую активность и на гомеостаз глюкозы [Cone RD. Anatomy and regulation of the central melanocortin system. Nat. Neurosci. 2005 May; 8(5): 571-8; Coppari R., Ichinose M., Lee C.E., Pullen A.E., Kenny C.D., McGovern R.A., Tang V., Liu S.M., Ludwig T., Chua S.C. Jr., Lowell B.B., Elmquist J.K. The hypothalamic arcuate nucleus: a key site for mediating leptin's effects on glucose homeostasis and locomotor activity. Cell Metab. 2005 Jan.; 1(1): 63-72]. Таким образом, повышенное потребление энергии и физическая активность трансгенных по Enho1 мышей FVB/NJ может включать в себя действие в центральной нервной системе, а более конкретно, посредством действия на основе регуляторной активности нейронов в дугообразном ядре гипоталамуса.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фиг.1A показано различие массы тела у 6-месячных самок мышей после 12 недель на диете с низким содержанием жира (LF) или на диете с высоким содержанием жира (HF) в трех различных линиях, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). (Достоверный эффект диеты обозначен посредством "*" (р<0,001) или "#" (р<0,05); достоверные эффекты в пределах диеты обозначены буквами, со значимо отличными группами (р<0,05), определенными различными буквами; достоверность на основе 2-стороннего ANOVA).

На фиг.1B показано различие массы тела, приведенное как процент от исходной массы у 6-месячных самок мышей после 12 недель на диете с низким содержанием жира (LF) или на диете с высоким содержанием жира (HF) в трех различных линиях, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). (Достоверный эффект диеты обозначен посредством "*" (р<0,001) или "#" (р<0,05); достоверные эффекты в пределах диеты обозначены буквами, со значимо отличными группами (р<0,05), определенными различными буквами; достоверность на основе 2-стороннего ANOVA).

На фиг.1C показано различие процента телесного жира у 6-месячных самок мышей после 12 недель на диете с низким содержанием жира (LF) или на диете с высоким содержанием жира (HF) в трех различных линиях, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). (Достоверный эффект диеты обозначен посредством "*" (р<0,001) или "#" (р<0,05); достоверные эффекты в пределах диеты обозначены буквами, со значимо отличными группами (р<0,05), определенными различными буквами; достоверность на основе 2-стороннего ANOVA).

На фиг.1D показано различие массы жира у 6-месячных самок мышей после 12 недель на диете с низким содержанием жира (LF) или на диете с высоким содержанием жира (HF) в трех различных линиях, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). (Достоверный эффект диеты обозначен посредством "*" (р<0,001) или "#" (р<0,05); достоверные эффекты в пределах диеты обозначены буквами, со значимо отличными группами (р<0,05), определенными различными буквами; достоверность на основе 2-стороннего ANOVA).

На фиг.1E показано различие массы без жира у 6-месячных самок мышей после 12 недель на диете с низким содержанием жира (LF) или на диете с высоким содержанием жира (HF) в трех различных линиях, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). (Достоверный эффект диеты обозначен посредством "*" (р<0,001) или "#" (р<0,05); достоверные эффекты в пределах диеты обозначены буквами, со значимо отличными группами (р<0,05), определенными различными буквами; достоверность на основе 2-стороннего ANOVA).

На фиг.2A показано сравнение гистологии печени, поперечные сечения печени, окрашенные гематоксилином и эозином, у самок мышей на диете с высоким содержанием жира в трех линиях мышей, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO).

На фиг.2B показано различие массы печени как функции тучности (процента телесного жира) у мышей на диетах с низким и высоким содержанием жира в трех линиях мышей, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO).

На фиг.2C показано различие средней массы печени (n=5-6/группа) самцов и самок мышей на диете с умеренно высоким содержанием жира в трех линиях мышей, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). ("*" означает р<0,05 относительно мышей WT и Mc3rKO).

На фиг.2D показано различие экспрессии стеароил-КоА-десатуразы 1 (SCD1) в печени мышей на диете с высоким содержанием жира в трех линиях мышей, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). Данные выражены в виде относительных единиц (о.е.). ("*" означает р<0,05 относительно мышей WT и Mc3rKO).

На фиг.2E показано различие экспрессии аполипопротеина A4 (ApoA4) в печени мышей на диете с высоким содержанием жира в трех линиях мышей, дикого типа (WT), мыши с дефицитом Mc3r -/- (Mc3rKO) и мыши с дефицитом Mc4r -/- (Mc4rKO). ("*" означает р<0,05 относительно мышей WT и Mc3rKO; "#" означает р<0,05 относительно мышей WT, в пределах пола).

На фиг.3A показан уровень экспрессии мРНК AK009710 в печени (приведенный как процент от экспрессии WT) у мышей дикого типа (WT) и у мышей с дефицитом Mc3r -/- с ожирением (Mc3rKO).

На фиг.3B показан уровень экспрессии мРНК AK009710 в печени (приведенный как процент от экспрессии WT) у мышей дикого типа (WT), мышей с дефицитом Mc4r -/- (Mc4rKO) и мышей с дефицитом лептина Lepob/Lepob (две модели ожирения).

На фиг.3C показан уровень экспрессии мРНК AK009710 в печени (приведенный как процент экспрессии с физиологическим раствором) у мышей с дефицитом лептина Lepob/Lepob, 4 раза в течение 2 суток инъецированных или физиологическим раствором, или лептином (0,5 мг/г).

На фиг.4 показана последовательность мРНК гена Enho1 (BC021944; SEQ ID NO: 1) с подчеркнутой открытой рамкой считывания, кодирующей белок Enho1, и демонстрируя предполагаемый продукт трансляции в аминокислоты Enho1 (SEQ ID NO: 2).

На фиг.5 показано выравнивание предполагаемых белковых последовательностей Enho1 для мыши (SEQ ID NO: 2), человека (SEQ ID NO: 14), крысы (SEQ ID NO: 12), собаки (SEQ ID NO: 15), свиньи (SEQ ID NO: 16), коровы (SEQ ID NO: 17), овцы (SEQ ID NO: 18) и шимпанзе (SEQ ID NO: 13), демонстрирующее области предполагаемого секретируемого полипептида, используемые для получения поликлональных антител (pAB1 (SEQ ID NO: 8) и pAB2 (SEQ ID NO: 9)).

На фиг.6A показаны результаты анализа нозерн-блот с использованием радиоактивно меченной части последовательности ДНК AK009710, кодирующей белок Enho1, в образцах ткани человека (дорожки 1-8 представляют РНК из сердца, головного мозга, плаценты, легкого, печени, скелетных мышц, почки и поджелудочной железы соответственно).

На фиг.6B показана относительная интенсивность полос мРНК Enho1 из анализа нозерн-блот с применением зонда полноразмерной ДНК AK009710 мыши на образцах ткани мышей.

На фиг.6C показаны результаты анализа вестерн-блот на иммунологическую реактивность на FLAG в средах (M) и клеточных лизатах (Pel) из полученных из клеток почки человека HEK293, трансфицированных pCMV-Enho1:FLAG, pCMV-GFP, или в средах от клеток HEK293, инфицированных аденовирусным вектором, экспрессирующим слитый белок Enho1:Flag [отсутствие трансфицированной ДНК (дорожки 1, 2); трансфицированные конструкцией pCMV-Enho1:FLAG (дорожки 3, 4); трансфицированные pCMV-Enho1 (дорожки 5, 6) или трансфицированные pCMV-GFP (дорожки 7, 8); инфицированные Ad5Enho1:FLAG (дорожка 9); инфицированные Ad5Enho1 (дорожка 10) или инфицированные Ad5GFP (дорожка 11)]. Для визуализации белка Enho1 получен слитый белок с C-концевой эпитопной меткой FLAG.

На фиг.6D показаны результаты анализа вестерн-блот на белок Enho1 в различных тканях (печень, мышцы и головной мозг) от мышей Mc4r-/-, с инъекцией Ad5-Enho1:FLAG за 4 суток до анализа, вместе с контролями, положительным (клетки HEK293, инфицированные Ad5-Enho1:FLAG) и отрицательным (печень от неинъецированных мышей Mc4r-/-).

На фиг.7A показаны результаты анализа вестерн-блот с использованием лизата из клеток HEK293, инфицированных рекомбинантным Ad5Enho1 (природный белок) или Ad5Enho1:FLAG (меченный C-концевым FLAG слитый белок) после инкубации с поликлональным антителом (pAB1) к N-концу Enho1 (как показано на фиг.5).

На фиг.7B показаны результаты анализа вестерн-блот, используя лизат клеток HEK293, инфицированных рекомбинантным Ad5Enho1 (нативный белок) или Ad5Enho1:FLAG (меченный C-концевым FLAG слитый белок) после инкубации с поликлональным антителом (pAB2, SEQ ID NO: 9) к C-концу Enho1 (как показано на фиг.5).

На фиг.7C показан протокол обработки, используемый для введения Ad5Enho1 или Ad5-GFP в хвостовую вену различных линий мышей для тестирования действия обработки Enho1 на метаболизм мышей (результаты представлены в таблице 1).

На фиг.8A показан уровень экспрессии мРНК синтазы жирных кислот (Fasn) в печени мышей с дефицитом лептина (Lepob/Lepob) с ожирением через восемь суток после инъекции Ad5-Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU, о.е.) (n=6-8/группа; "*" р<0,05).

На фиг.8B показан уровень экспрессии белка стеароил-КоА-десатуразы (Scd1) в печени мышей с дефицитом лептина (Lepob/Lepob) с ожирением через восемь суток после инъекции Ad5-Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU) (n=6-8/группа; "*" р<0,05).

На фиг.8C показан уровень экспрессии мРНК ацетил-КоА-карбоксилазы (Acс) в печени мышей с дефицитом лептина (Lepob/Lepob) с ожирением через восемь суток после инъекции Ad5- Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU) (n=6-8/группа; "*" р<0,05).

На фиг.8D показан уровень экспрессии гена, вовлеченного в резистентность к инсулину (супрессор цитокиновой передачи сигнала), в печени мышей с дефицитом лептина (Lepob/Lepob) с ожирением через восемь суток после инъекции Ad5-Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU) (n=6-8/группа; "*" р<0,05).

На фиг.9A показана конструкция трансгена (BAP-Enho1), используемая для получения линий трансгенных мышей, сверхэкспрессирующих Enho1.

На фиг.9B показан уровень экспрессии Enho1 в печени трансгенных мышат (полученных с применением трансгена с фиг.9A) от основателей FVB/NJ на 5 неделе.

На фиг.9C показан уровень триглицеридов (TG) при голодании из сыворотки трансгенных мышат (полученных с применением трансгена с фиг.9A) от основателей FVB/NJ на 9 неделе.

На фиг.9D показан состав тканей тела, как измеряют, в виде процента телесного жира (% телесного жира; левая диаграмма) и массы жира (демонстрируя массу свободного жира (FFM) и массу жира (FM); правая диаграмма) у трансгенных мышат (полученных с применением трансгена с фиг.9A) от основателей FVB/NJ на 5 и 9 неделях по сравнению с контролем.

На фиг.9E показано изменение массы жира (демонстрируя массу свободного жира (FFM) и массу жира (FM)) трансгенных мышат (полученных с применением трансгена с фиг.9A) от основателей FVB/NJ через 7 суток на диете с уровнем содержания жира 60%.

На фиг.10 показаны результаты скрининга ПЦР на интеграцию BAP-Enho1 в геном детенышей C57BL/6J (после инъекции BAP-Enho1 в ооциты C57BL/6J), демонстрирующие шесть детенышей из 23 с интеграцией трансгена в геном.

На фиг.11A показано увеличение фосфорилирования Erk в адипоцитах 3T3-L1 через 15 минут после применения секретируемой части белка Enho1 (Enho134-76; SEQ ID NO: 10).

На фиг.11B показано увеличение фосфорилирования Erk в гепатоцитах HepG2 через 15 минут после применения секретируемой части белка Enho1 (Enho134-76; SEQ ID NO: 10).

На фиг.12A показана связь между экспрессией мРНК Enho1 в гипоталамусе и массой тела у шестимесячных мышей трех линий (C57BL/6J (WT), Mc3rKO (Mc3r) или Mc4rKO (Mc4r), в течение трех месяцев содержавшихся на двух диетах (LF=10% кДж/жир; HF=60% кДж/жир).

На фиг.12B показана связь между экспрессией мРНК Enho1 в гипоталамусе и HOMA-IR [(инсулин × глюкоза при голодании)/22,5] у шестимесячных мышей трех линий (C57BL/6J(WT), Mc3rKO (Mc3r) или Mc4rKO (Mc4r), в течение трех месяцев содержавшихся на двух диетах (LF=10% кДж/жир; HF=60% кДж/жир).

На фиг.12C показана связь между HOMA-IR [(инсулин × глюкоза при голодании)/22,5] и экспрессией мРНК Socs3 (супрессор цитокиновой передачи сигнала 3) в гипоталамусе у шестимесячных мышей трех линий (C57BL/6J(WT), Mc3rKO (Mc3r) и Mc4rKO (Mc4r), в течение трех месяцев содержавшихся на двух диетах (LF=10% кДж/жир; HF=60% кДж/жир).

На фиг.13A показана физическая активность (измеренная в перекрытиях луча/10 мин) у мышей дикого типа (WT) и трансгенных мышей BAP-Enho1 (FVB.Tg) в течение 3 суток.

На фиг.13B показана физическая активность (измеренная в перекрытиях луча/10 мин в течение периода) в светлые и темные периоды у мышей дикого типа (WT) и трансгенных мышей BAP-Enho1 (FVB.Tg) в течение периода 24 часа.

На фиг.13C показано полное окисление телесного жира (RER) в темные и светлые периоды у мышей дикого типа (WT) и трансгенных мышей BAP-Enho1 (FVB.Tg) в течение периода 24 часа.

На фиг.13D показан уровень метаболизма (измеренный как VO2 (мл/час × 103)) в темные и светлые периоды у мышей дикого типа (WT) и трансгенных мышей BAP-Enho1 (FVB.Tg) в течение периода 24 часа.

На фиг.13E показан уровень метаболизма как функция от массы свободного жира (измеренный как VO2 (мл/час/гFFM×103)) в темные и светлые периоды у мышей дикого типа (WT) и трансгенных мышей BAP-Enho1 (FVB.Tg) в течение периода 24 часа.

На фиг.13F показан уровень метаболизма как функция от массы тела (измеренный как VO2 (мл/час/гМТ × 103)) в темные и светлые периоды у мышей дикого типа (WT) и трансгенных мышей BAP-Enho1 (FVB.Tg) в течение периода 24 часа.

СПОСОБЫ ОСУЩЕСТВЛЕНИЯ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к новому секретируемому белку (Enho1) и идентифицирует некоторые из его функций. Обнаружено, что последовательность указанного белка высококонсервативна у различных видов млекопитающих, и последовательности приведены в SEQ ID NO: 2 и 12-18. Кроме того, нуклеиновые кислоты, кодирующие этот белок, использовали для получения мышей, сверхэкспрессирующих белок Enho1, либо посредством инфекции рекомбинантным аденовирусом, экспрессирующим Enho1, либо посредством получения трансгенной линии с использованием ДНК Enho1 под контролем промотора актина.

В одном из вариантов осуществления белок, фрагмент, производное или аналоги Enho1 терапевтически используют для предотвращения патофизиологического состояния, связанного с повышенной массой тела, например, ожирения, гипергликемии, гиперинсулинемии, резистентности к инсулину, гиперлипидемии и инсулиннезависимого сахарного диабета типа 2.

В другом варианте осуществления очищенные белок, фрагмент, производное или аналоги Enho1 выделяют из различных млекопитающих или получают синтетически, или получают с применением клеточных культур, экспрессирующих белок, фрагменты, производные или аналоги, с применением нуклеиновых кислот, кодирующих по меньшей мере двадцать аминокислот из открытой рамки считывания в SEQ ID NO: 1 и как показано на фиг.4.

В другом варианте осуществления получают антитела к белку Enho1, его фрагментам, производным или аналогам. Эти антитела можно использовать в наборе для идентификации белка Enho1 в различных образцах, включая жидкости организма.

В другом варианте осуществления получают трансгенных животных, сверхэкспрессирующих белок Enho1, посредством связывания последовательности Enho1 и активным промотором, например, с промотором актина.

В другом варианте осуществления получают трансформирующий вектор, содержащий по меньшей мере открытую рамку считывания SEQ ID NO: 1 (часть, подчеркнутую на фиг.4).

ПРИМЕР 1

Открытие белка Enho1 и его функции

Проводили анализ экспрессии генов в печени на микрочипах у худых мышей и мышей с ожирением Mc3rKO с применением чипов, напечатанных из библиотек 16463-18400 70-членных олигонуклеотидов (Mouse Array-Ready Oligo Set Version 2,0, Qiagen Operon, Alameda, CA) (34-36). Данные микрочипов указывали на повышенную экспрессию генов, вовлеченных в метаболизм липидов (аполипопротеины) и окислительный стресс, дополнительно к ожирению. Представляет интерес, что в печени мышей Mc3rKO независимо от возраста, пола и степени ожирения была снижена экспрессия только трех генов. Два из генов кодировали белки с известной функцией: нейраминидазу 3 (neu3), кодирующую фермент, отщепляющий сиаловую кислоту от гликопротеинов и гликолипидов, и представитель семейства растворенных носителей 21 (slc21al), кодирующий транспортер органических анионов. Третий ген (AK009710) являлся новым и не имел установленной функции в базах данных.

Количественная ПЦР с детекцией в реальном времени подтвердила данные микрочипов, демонстрируя тенденцию к умеренному снижению экспрессии AK009710 в печени Mc3rKO (фиг.3A). Представляет интерес, что более сильное снижение экспрессии AK009710 наблюдали в печени у мышей Mc4rKO с сильной устойчивостью к инсулину и у мышей с дефицитом лептина (Lepob/Lepob) (фиг.3B). Кроме того, кратковременная обработка лептином (4 инъекции 0,5 мг/г лептина в течение 2 суток) значимо увеличивала Enho1 в печени мышей Lepob/Lepob (Фиг.3C). Экспрессия AK009710 у 6-месячных худых Mc4rKO находится в норме (данные не показаны), указывая на то, что снижение экспрессии в печени Mc4rKO является вторичным относительно связанного с возрастом начала ожирения, резистентности к инсулину и жирового гепатоза [32]. Кроме того, экспрессия AK009710 отрицательно коррелировала с уровнем глюкозы при голодании у мышей с индуцированным диетой ожирением C57BL/6J (n=13, R2=0,67, P<0,001) (данные не показаны).

Все вместе, эти результаты означают идентификацию небольшого секретируемого белка, экспрессия которого в печени снижается с чувствительностью к инсулину и жировым гепатозом. На основе наблюдения того, что снижение экспрессии AK009710 в печени коррелирует с тяжестью жирового гепатоза и резистентности к инсулину и того, что это снижение обращается посредством активатора инсулина, было выбрано название "ассоциированный с энергетическим гомеостазом 1" (Enho1).

Олигонуклеотидные праймеры к мРНК AK009710 использовали для измерения экспрессии гена AK009710 в кДНК печени различных моделей ожирения и резистентности к инсулину на мышах. Последовательности праймеров представляли собой: смысловой 5'-cctgagggtgctgtctgtcatg-3' (SEQ ID NO: 3), антисмысловой 5'-cagtagcagcaagaagcctacg-3' (SEQ ID NO: 4), зонд 5'-6FAM- ctctcatcgccatcgtctgca-BHQ-3' (SEQ ID NO: 5). В соответствии с исходным результатом на микрочипах экспрессия мРНК AK009710 была снижена в печени мышей Mc3r-/- по сравнению с мышами WT (на 55%, р<0,05; фиг.3A). Затем исследовали экспрессию мРНК AK009710 в печени в двух моделях ожирения: мыши Mc4r-/- и мыши с дефицитом лептина Lepob/Lepob. По сравнению с мышами дикого типа (WT) мРНК AK009710 в обеих моделях экспрессировалась на уровнях приблизительно в 10 раз меньших (фиг.3B). Когда всех животных группировали вместе, наблюдали отрицательные связи между экспрессией мРНК AK009710 и уровнями глюкозы и инсулина (данные не показаны). Экспрессия гена AK009710 была не изменена в печени получавших в достатке пищу молодых и взрослых мышей WT, голодавших 16 часов или голодавших 24 часа, и снова получавших пищу в течение 4 часов (данные не показаны). Полагают, что AK009710 не изменяется в зависимости от состояния питания.

Для определения того, может ли уровень мРНК AK009710 регулироваться вторично, относительно развития резистентности к инсулину, мРНК AK009710 измеряли в печени молодых, нормоинсулинемических, и более взрослых, гиперинсулинемических, мышей Mc4r-/-. Наблюдали, что уровень мРНК AK009710 у молодых мышей Mc4r-/- (средний возраст ~7 недель) был сходен с уровнем у мышей дикого типа, тогда как он значимо снижался у более взрослых (~16 недель) мышей Mc4r-/- (данные не показаны). Кроме того, уровень мРНК AK009710 также измеряли в небольшом количестве (n=4) полученных от человека гепатоцитов от индивидуумов с диабетом и без. Хотя в образцах с диабетом экспрессия имела тенденцию к снижению, различия были статистически недостоверными (данные не показаны).

Таким образом, хотя ожирение у мышей Mc3r-/- и Mc4r-/- сходно, известно, что у мышей Mc4r-/- резистентность к инсулину и повышенные уровни липидов в сыворотке (триглицериды, холестерин) являются более сильными. У мышей Mc4r-/- снижение экспрессии гена AK009710 в печени коррелирует с известной тяжестью резистентности к инсулину и гиперлипидемии.

ПРИМЕР 2

Анализ последовательности и биоинформационный анализ

AK009710 представляет собой клон кДНК языка мыши 1247 п.н. в длину и принадлежит кластеру Unigene Mm.34074, 2310040A07Rik: RIKEN кДНК гена 2310040A07. Гипотетически он может кодировать белок из 534 аминокислот непосредственно от 5'-конца последовательности. Учитывая, что этот предполагаемый белок не начинается с остатка метионина, он был зарегистрирован как укороченный продукт. Анализ BLAST AK009710 на гомологичные последовательности EST или кДНК по базе данных NCBI выявил значительное соответствие с NM198573, транскриптом человека, открытым с помощью широкомасштабного проекта по открытию секретируемых белков, кодирующим гипотетический белок из 87 а.к. (UNQ470/GAAI470) (37). Совпадение с последовательностью человека, NM_198573, составляло 85% идентичности на протяжении 392 нуклеотидов, p=5e-83. Последовательность человека кодировала белок из 87 аминокислот в одном экзоне. Трансляция AK009710 в шесть рамок выявила открытую рамку считывания, кодирующую белок из 76 аминокислот (SEQ ID NO: 2). Выравнивание этого предполагаемого белка мыши и белка человека, кодируемого NM_198573 (GAAI470 или UNQ470), выявило сильную гомологию на протяжении первых 37 остатков. UNQ470/GAAI470 картируется на хромосоме 9p13.2 и расположен рядом с геном рецептора цилиарного нейротрофического фактора (CNTFR).

Последовательность AK009710 подтверждали с использованием кДНК, выделенной из печени мышей. Кроме того, с данными секвенирования авторов согласуется кДНК длиной 868 п.н., клонированная из печени мышей в National Institutes of Health Mammalian Gene Collection (MGC) Program, с инвентарным номером BC021944, недавно помещенная в базу данных NCBI (фиг.4, SEQ ID NO: 1). Анализ BLAST выявил, что предсказанная последовательность из 76 а.к. для мыши (SEQ ID NO: 2) является высококонсервативной у различных видов млекопитающих (фиг.5; SEQ ID NO: 12 (крыса), SEQ ID NO: 13 (шимпанзе); SEQ ID NO: 14 (человек); SEQ ID NO: 15 (собака); SEQ ID NO: 16 (свинья); SEQ ID NO: 17 (корова); SEQ ID NO: 18 (овца)). На фиг.5, pAB1 (SEQ ID NO: 8) и pAB2 (SEQ ID NO: 9) относятся к областям предполагаемого секретируемого полипептида, используемым для получения поликлональных антител. Предсказанная сигнальная последовательность подчеркнута. Кроме того, были синтезированы пептиды, соответствующие аминокислотам с 34 до 76 (Enho134-76; SEQ ID NO: 10) и аминокислотам с 39 по 76 (Enho139-76; SEQ ID NO: 11) SEQ ID NO: 2, белка мыши.

Дополнительный анализ предполагаемой последовательности мыши на основе последовательностей AK009710 и человека GAAI470 выявил однонуклеотидный пропуск в последовательности человека в GenBank. Таким образом, продукт ПЦР AK009710 мыши был клонирован и секвенирован в обоих направлениях для подтверждения того, какая последовательность, мыши или человека, является корректной. Клон мыши AK009710 с верифицированной последовательностью позволил выявить продукт трансляции длиной 76 аминокислот (SEQ ID NO: 2) (фиг.4). Был проанализирован общедоступный клон Origene GAAI470 человека, и показано, что он не содержит пропуск нуклеотида, что указывает на ошибку секвенирования в последовательности NM_198573 GenBank. Выравнивание последовательности AK009710 из различных видов, включая человека, выявило 100% гомологию последовательностей крысы, человека, мыши и шимпанзе на уровне белка (фиг.5).

Биоинформационный анализ выявил, что этот белок с высокой вероятностью является секретируемым пептидом (вероятность 87%, SignalP 3.0) с наиболее вероятным участком расщепления между положениями 33 и 34. Последовательность человека содержит 1 возможный сериновый и 1 возможный треониновый участки фосфорилирование, все расположенные с 3'-конца предсказанного участка расщепления, а также 6 возможных участков гликозилирования, также все с 3'-конца участка расщепления.

ПРИМЕР 3

Распределение Enho1 в тканях

Для исследования распределения мРНК AK009710 в тканях проводили "нозерн-блот" с использованием последовательности длиной 210 нуклеотидов, содержащей белок из 76 аминокислот Enho1, и набор Multiple Tissue Northern blot для человека (BD Biosciences, Palo Alto, California). Как можно видеть на фиг.6A, у людей только в головном мозге и печени выявлена одиночная полоса длиной ~1,35 т.п.н., с наибольшими уровнями, выявленными в печени. Кроме того, как видно на фиг.6B, Enho1 у мышей был обнаружен в печени, головном мозге и мышцах.

ПРИМЕР 4

Подтверждение того,

что Enho1 представляет собой секретируемый полипептид

Биоинформационный анализ предсказал наличие предполагаемой сигнальной последовательности, что позволило предположить, что AK009710 является секретируемым пептидом. Для тестирования этого кодирующую последовательность белка из 76 аминокислот амплифицировали с печеночной кДНК мыши посредством ПЦР с использованием праймеров с присоединенными участками для ферментов рестрикции Not1 (5'-ggggcggccgcaccatgggggcagccatctcccaa-3' (SEQ ID NO: 6)) и Xho1 (5'-gggctcgagggccagagcccttcagggctgcag-3' (SEQ ID NO: 7)). Продукт лигировали в вектор pCMV-Tag1 с эпитопом FLAG на C-конце (pCMV-Enho1:FLAG), затем транзиторно трансфицировали в полученные из почки человека клетки HEK. Этот продукт также применяли для получения аденовирусных конструкций - одну со Enho1, присоединенным к эпитопу FLAG (Ad-Enho1:FLAG), а другую без эпитопа FLAG (Ad-Enho1).

Клетки HEK293 трансфицировали pCMV-Enho1 или pCMV-Enho1:FLAG. Через 16 часов собирали среды, иммунопреципитировали, а затем запускали на 20% полиакриламидном геле для визуализации антителом к FLAG. Эти эксперименты повторяли с использованием рекомбинантного аденовируса (Ad5), экспрессирующего природный или меченный FLAG Enho1.

Когда клетки HEK293 были нетрансфицированными (дорожки 1, 2) или трансфицированными пустым вектором (дорожки 5, 6) или вектором, содержащим GFP (дорожки 7, 8), иммунореактивные к FLAG полосы не визуализировались (фиг.6C). Кроме того, когда в клетки HEK293 трансфицировали конструкцию pCMV-Enho1:FLAG (дорожки 3, 4), в средах и клеточном осадке выявляли положительную на FLAG иммунологическую реактивность, что указывало на то, что по меньшей мере некоторая часть из трансфицированного продукта Enho1 активно секретировалась клетками в среды. Сходные результаты наблюдали в средах клеток HEK293, инфицированных Ad-Enho1:FLAG (фиг.8, дорожка 9). На дорожках 10 и 11 нет иммунологической реактивности к FLAG в средах клеток, инфицированных аденовирусом, содержащим Enho1 без эпитопа FLAG или с GFP соответственно. Таким образом, наличие иммунологической реактивности к FLAG в культивируемых средах клеток HEK-293, трансфицированных экспрессирующим вектором, экспрессирующим меченный эпитопом слитый белок (pCMV-Enho1FLAG), подтверждало, что секретировалась неопределенная часть белка из 76 а.к.

Большинство аденовирусов, инъецированных в хвостовую вену, инфицируют печень [38]. Для тестирования того, приводит ли инъекция аденовируса в хвостовую вену к увеличенной экспрессии мРНК Enho1 в печени, а также других тканях, трем мышам Mc4r-/- инъецировали аденовирус Ad5-Enho1:FLAG и через четверо суток получали ткани. Анализ "вестерн-блот" выявил наличие иммунологической реактивности к FLAG в тканях печени, мышц и головного мозга, указывая на присутствие Enho1 в этих тканях (фиг.6D). Распределение иммунологической реактивности к Enho1FLAG в тканях мышей, инфицированных Ad5-Enho1FLAG, соответствует полипептиду, секретируемому из печени в систему кровообращения. Оба этих теста показывают, что Enho1 является секретируемым белком.

ПРИМЕР 5

Обработка тучных мышей с резистентностью к инсулину Ad5 - Enho1: Mc4rKO

Для исследования регуляции метаболизма и чувствительности к инсулину печени использовали опосредованную рекомбинантным вирусом экспрессию [39-41]. Сконструировали три рекомбинантных аденовирусных вектора, экспрессирующих белок из 76 а.к. (Ad5-Enho1), меченный C-концевым FLAG слитый белок (Ad5-Enho1:FLAG) или зеленый флуоресцентный белок для отрицательного контроля (Ad5-GFP). Экспрессию белка после инъекции в хвостовую вену подтверждали с применением антитела к FLAG (фиг.6D и данные не показаны). Синтез Enho1 в клетках HEK293, трансфицированных Ad5- Enho1, подтверждали с применением поликлональных антител (pAB1 (SEQ ID NO: 8) или pAB2 (SEQ ID NO: 9) на фиг.5) к N- и C-концевым областям предполагаемого секретируемого белка (фиг.7A, B).

Для исследования того, вовлечен ли Enho1 в метаболизм глюкозы, в хвостовую вену самцам и самкам Mc4r-/- в возрасте 20 недель (n=3 каждого пола на группу) инъецировали Ad5-Enho1 или Ad5-GFP (5·108 БОЕ). Обе группы животных до инъекций Ad5-Enho1 или Ad5-GFP подбирали по массе тела, уровням глюкозы и толерантности к глюкозе. За неделю до инъекции Ad5-Enho1 или Ad5-GFP проводили тест интраперитонеальной толерантности к глюкозе (IPGTT) и наблюдали, что все мыши не переносили глюкозу. IPGTT проводили у мышей после ночного голодания посредством одной интраперитонеальной инъекции 1 г/кг глюкозы и глюкозу в крови измеряли кровяным глюкометром и тестовыми полосками (Glucometer Elite, Bayer Corp., Elkhart, Indiana) в крови хвоста животных с несколькими интервалами, как описано у W. Fan et al., "The Central Melanocortin System Can Directly Regulate Serum Insulin Levels," Endocrinology, vol. 141, pp. 9 3072-3079 (2000).

Мышам инъецировали 5·108 БОЕ Ad5-Enho1 или Ad5-GFP в 100 мкл разбавителя (DMEM) в хвостовую вену. Животных наблюдали и взвешивали ежедневно на всем протяжении 4 суток эксперимента. На сутки 4 животным снова вводили IPGTT (0,4 мг глюкозы/г массы тела).

Через четверо суток после инъекции Ad5-Enho1 мыши демонстрировали улучшенную толерантность к глюкозе, измеренную с применением IPGTT (данные не показаны). На всем протяжении эксперимента не наблюдали изменений массы тела, уровня глюкозы или холестерина в крови. Существовала тенденция для снижения уровней инсулина и сывороточных триглицеридов (таблица 1).

Таблица 1
Характеристики мышей Mc4r-/- через 4 суток после введения аденовируса
Группа Масса тела (г) Глюкоза (мг/дл) Инсулин (нг/мл) Холестерин (мг/дл) Триглицериды (нг/мл)
Ad5-Enho1 50,4±1,8 184±10 5,9±1,5 91±7 26±4
Ad5-GFP 49,5±2,2 169±16 10,4±2,0 82±6 38±6

ПРИМЕР 6

Обработка тучных мышей с резистентностью к инсулину Ad5-Enho1: B6 Ay/a

Проводили второй эксперимент с аденовирусами, в котором Ad5-Enho1 или Ad5-GFP инъецировали в хвостовую вену самцов мышей C57BL6 Ay/a (n=9 на группу), которых держали на диете с очень высоким содержанием жира приблизительно в течение 3 месяцев. Мышам давали 1 неделю на восстановление от инъекций, а затем проводили IPGTT. Затем мышам предоставляли еще одну неделю на восстановление и проводили тест толерантности к инсулину (ITT).

На 20 сутки после инъекции различий в массе тела (40,3±1,3 г для мышей с Ad5-Enho1; 41,4±1,2 г для мышей с Ad5-GFP), уровнях инсулина при голодании (0,97±0,2 нг/мл для мышей с Ad5-Enho1; 1,13±0,2 нг/мл для мышей с Ad5-GFP) или уровнях глюкозы при голодании (126±7 мг/дл для мышей с Ad5-Enho1; 139±8 мг/дл для мышей с Ad5-GFP) не наблюдали. IPGTT через 7 суток после инъекции выявил очень незначительное увеличение толерантности к глюкозе в группе Ad5-Enho1 во временных точках на 30 минуте (p=0,06) и 45 минуте (p=0,15). Изменения уровней глюкозы в крови через 14 суток после инъекции значимо отличались между группами, являясь значимо пониженными в группе Ad5-Enho1 (данные не показаны). ITT через 14 суток после инфекции не выявил значимого различия в чувствительности к инсулину ни в какой момент времени; кроме того, Ki (рассчитанная как глюкоза на 30 минуте после инъекции инсулина, вычтенная из исходного уровня глюкозы, деленная на 30) была значимо отличной.

Пониженные уровни глюкозы в крови при голодании, наблюдаемые у этих мышей через 14 суток после инфекции, были невидимы на 21 сутки после инфекции. В согласии с первым экспериментом с аденовирусами на мышах Mc4r-/- существовала тенденция для снижения сывороточных триглицеридов в группе с Ad5-Enho1 (таблица 2).

Таблица 2
Инфекция Ad5-Enho1 связана с признаками улучшенного метаболического профиля
в моделях ожирения и резистентности к инсулину на мышах
*P<0,05 по сравнению с обработанными Ad5-GFP контролями (в пределах линии), n=5-8/группа.
Линия Обработка МТ перед инъекцией МТ после инъекции Масса печени (г) Масса печени как % от МТ Содержание липидов
в печени (мг/г)
Общий уровень липидов
в печени (мг)
Уровень сывороточных TG (мг/дл) Уровень сывороточных TC (мг/дл) HOMA-IR
OBOB GFP 64,0±1,9 64,8±2,0 4,7±0,2 7,4±0,3 142±8 654±25 63±6 173±6 308±114
Enho1 65,0±2,2 64,6±2,0 4,3±0,2 6,7±0,3 128±7 552±50 38±4* 146±8* 157±18
KK-Ay GFP 48,0±1,9 46,7±1,7 2,1±0,2 4,7±0,3 57±10 117±24 435±53 214±13 98±19
Enho1 46,6±1,2 45,3±0,8 1,8±0,1 4,3±0,1 33±2* 58±5* 315±16* 172±9 62±11
Ay/a GFP 45,2±2,5 44,6±2,1 2,2±0,2 5,1±0,2 119±11 282±39 71±18 79±3 40±6
Enho1 44,8±1,4 44,5±1,1 1,8±0,2 4,2±0,3* 81±20 145±41* 53±4 72±2 28±4

ПРИМЕР 7

Обработка тучных мышей с резистентностью к инсулину Ad5-Enho1: мыши Agouti (KK-A y ) (генетически тучные и гиперлипидемичные мыши)

Для более конкретной адресации действия ведения аденовируса на уровни липидов в крови аденовирусные конструкции дополнительно очищали для удаления любых загрязняющих вирусных частиц и клеточного дебриса. Затем проводили другой эксперимент с аденовирусами, где Ad5-Enho1 или Ad5-GFP инъецировали в хвостовую вену генетически тучных и гиперлипидемичных мышей KK-Ay (n=6 самок на группу). Затем через 5 суток после инъекции вируса у мышей проводили IPGTT, а затем умерщвляли через 2 суток после ночного голодания.

IPGTT выявил, что толерантность к глюкозе была незначимо улучшена посредством обработки Ad5-ENHO1 по сравнению с обработкой Ad5-GFP. Наблюдали статистически значимые снижения в уровнях циркулирующих триглицеридов (на 28%, p=0,04) и холестерина (на 20%, p=0,02) у группы Ad5-ENHO1 по сравнению с контролями Ad5-GFP (таблица 1). Масса печени мышей сAd5-Enho1 имела тенденцию быть ниже, чем масса печени контролей Ad5-GFP (таблица 2). Масса тела и уровни глюкозы и инсулина в сыворотке у Ad5-Enho1 и контролей Ad5-GFP незначимо отличались (таблица 2).

Таблица 3
Характеристики мышей KK-A y , обработанных Ad5-Enho1 или Ad5-GFP в течение 8 суток
Обработка Масса тела (г) Масса печени (г) Печень как % от массы тела Глюкоза (мг/дл) Инсулин (нг/мл)
Ad5-ENHO1 41,9±0,9 1,8±0,1 4,3±0,1 239±19 4,3±0,7
Ad5-GFP 44,1±1,5 2,1±0,2 4,6±0,2 246±41 5,1±0,9

мРНК Enho1 в печени обработанных Ad5-Enho1 мышей KK-Ay по сравнению с обработанными Ad5-GFP мышами была приблизительно в 4 раза выше (данные не показаны).

ПРИМЕР 8

Обработка тучных мышей с резистентностью к инсулину Ad5-Enho1: Мыши Lep ob /Lep ob

Для подтверждения снижающего уровень липидов действия опосредованной аденовирусами сверхэкспрессии Enho1 проводили другой эксперимент, в котором в хвостовую вену мышей Lepob/Lepob (OBOB) (n=7-8 самцов на группу) инъецировали Ad5-Enho1 или Ad5-GFP, другая модель гиперлипидемии, ожирения и резистентности к инсулину на мышах. Мышам с инъекцией не проводили IPGTT, но у них контролировали изменения массы тела и их умерщвляли через 7 суток после инъекции после ночного голодания.

Обработанным Ad5-GFP мышам прибавляли приблизительно 1 г массы тела в течение периода 7 суток. Кроме того, обработка Ad5-Enho1 блокировала прирост массы у этих мышей Lepob/Lepob с ожирением (данные не показаны). Средняя масса тела между группами статистически не отличалась, а потребление пищи не измеряли. Также наблюдали фенотипические изменения, сходные с фенотипическими изменениями у мышей KK-Ay (см. пример 7 выше). В группе Ad5-Enho1 уровень сывороточных триглицеридов снижался на 40% (Ad5-GFP 63±6 мг/дл (Ad5-GFP); 38±4 мг/дл (Ad5-Enho1), p=0,006; таблица 2). Также наблюдали 15% снижение уровней сывороточного холестерина (173±6 мг/дл (Ad5-GFP); 146±8 мг/дл (Ad5-Enho1), p=0,02; таблица 2). Наблюдали тенденцию уменьшения массы печени, которая не была достоверной при экспрессии в виде процента от массы тела (p=0,12). Тенденции снижения уровней глюкозы и инсулина в крови при голодании в группе Ad5-Enho1 не достигали статистической достоверности.

Очистка аденовирусных конструкций и применение групп большего объема в экспериментах с мышами KK-Ay и мышами Lepob/Lepob (OBOB) демонстрировали, что сверхэкспрессия Enho1 в течение 7-8 суток приводила к пониженным циркулирующим уровням триглицеридов и холестерина по сравнению с контрольными мышами (таблица 2). Тенденции для этих эффектов наблюдали в предыдущих экспериментах с применением неочищенного аденовируса, с наблюдениями в более поздних временных точках. Экспрессия гена Enho1 в печени в группе, обработанной Ad5-Enho1, в этих экспериментах была повышенной, тогда как увеличения в предшествующих экспериментах в более поздние моменты времени не детектировали. Без желания быть связанным этой теорией, полагают, что увеличенная экспрессия гена Enho1 приводит к увеличению циркулирующих уровней белка Enho1.

ПРИМЕР 9

Обобщение результатов обработки тучных мышей

с резистентностью к инсулину Ad5-Enho1

Таким образом, 5·109 БОЕ Ad5-Enho1 или Ad5-GFP вводили в хвостовую вену мышей KK-Ay, B6 Ay/a или OBOB, приобретенных в Jackson Laboratory (Bar Harbor, Maine). Протокол обработки, представленный на фиг.7C, основан на предварительных экспериментах, демонстрирующих пиковую экспрессию Ad5-Enho1:FLAG в течение этого периода (данные не показаны). Массу животного и пищи записывали ежедневно. Линии мышей, используемые для экспериментов, хорошо переносили инфекцию Ad5-Enho1. Заметных различий массы (таблица 2) тела мышей, инфицированных Ad5-Enho1, по сравнению с контролями, инфицированными Ad5-GFP, в течение периода обработки не было. У мышей, инфицированных Ad5-Enho1, по сравнению с обработанными Ad5-GFP контролями наблюдали 4-5-кратное увеличение мРНК Enho1 (данные не показаны).

Масса печени и содержание липидов согласованно уменьшались у мышей, инфицированных Ad5-Enho1. У мышей KK-Ay и OBOB наблюдали значимые снижения (≈40%) триглицеридов при голодании и общего холестерина. У мышей Ay/a наблюдали меньшее снижение. Метаанализ данных из различных экспериментов с использованием мышей OBOB, KK-Ay и Ay/a с ожирением выявил 40% снижение HOMA-IR [(инсулин × глюкоза при голодании)/22,5] у мышей OBOB, KK-Ay и Ay/a (таблица 4) у мышей Ay/a уровни инсулина при голодании были значимо снижены при Ad5-Enho1 (2,6±0,4 относительно 3,9±0,3 нг/мл, P<0,05) с отсутствием различия в глюкозе крови (175±12 относительно 162±11 мг/дл).

Таблица 4
Метаанализ HOMA-IR, рассчитанный посредством мультиплицирования уровней инсулина и глюкозы при голодании от мышей OBOB, KK-A y и Ay/a,
инфицированных Ad5-GFP или Ad5-Enho1
Данные выражены как %±SEM контрольной группы
Ad5-GFP Ad5-Enho1 t-критерий Стьюдента
100±12% 62±4% P<0,005

ПРИМЕР 10

Воздействие сверхэкспрессии Enho1 на гены,

вовлеченные в биосинтез липидов

Обращение жирового гепатоза посредством адипоцитокинов по меньшей мере частично связано с супрессией липогенеза в печени и со стимуляцией окисления жирных кислот [42, 43]. Для исследования механизма, посредством которого Enho1 снижает содержание липидов в печени, посредством количественной ПЦР-РВ измеряли экспрессию генов, вовлеченных в липогенез (фиг.8A-8D). Происходило согласованное 40-50% снижение экспрессии нескольких генов, вовлеченных в липогенез в печени у мышей OBOB и KK-Ay, инфицированных Ad5-Enho1. Таким образом, Enho1 может снижать содержание липидов в печени по меньшей мере частично посредством ингибирования липогенеза в печени.

В обработанной Ad5-Enho1 группе по сравнению с контролями Ad5-GFP наблюдали значимое снижение мРНК синтазы жирных кислот (Fasn) (фиг.8A, p=0,02), а также снижение уровней белков (данные не показаны). Уровни мРНК и белка Fasn измеряли с использованием количественной ПЦР с детекцией в реальном времени и "вестерн-блота", как описано в D.C. Albarado et al, "Impaired Coordination of Nutrient Intake and Substrate Oxidation in Melanocortin-4 Receptor Knockout Mice", Endocrinology, vol. 145, pp. 243-252 (2004). Также в группе Ad5-Enho1 была значимо увеличена экспрессия гена транслоказы жирных кислот CD36 (p=0,02, не показано). На фиг.8A показан уровень экспрессии мРНК синтазы жирных кислот (Fasn) в печени мышей с дефицитом лептина (Lepob/Lepob) с ожирением, через восемь суток после инъекции Ad5-Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU) (n=6-8/группа; "*"р<0,05). Сверхэкспрессия Enho1 вызывала снижение Fasn. На фиг.8B показан уровень экспрессии белка стеароил-КоА-десатуразы (Scd1) в печени мышей с дефицитом лептина (Lepob/Lepob) с ожирением, через восемь суток после инъекции Ad5-Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU) (n=6-8/группа; "*"р<0,05). Снова сверхэкспрессия Enho1 вызывала снижение Scd1. На фиг.8C показан уровень экспрессии мРНК ацетил-КоА-карбоксилазы (Acс) в печени мышей с дефицитом лептина (Lepob/Lepob) с ожирением, через восемь суток после инъекции Ad5-Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU) (n=6-8/группа; "*"р<0,05). Снова мыши с Enho1 демонстрировали пониженные уровни печеночной Acс. На фиг.8D показан уровень экспрессии гена, вовлеченного в резистентность к инсулину (супрессор цитокиновой передачи сигнала 3 или Socs3) в печени от мышей с дефицитом лептина (Lepob/Lepob ) с ожирением, через восемь суток после инъекции Ad5-Enho1 или Ad5-GFP. Данные выражены в относительных единицах (AU) (n=6- 8/группа; "*"р<0,05). Присутствие Enho1 снова снижало экспрессию гена Socs3.

ПРИМЕР 11

Трансгенная сверхэкспрессия Enho1 (BAP-Enho1)

С использованием конструкции (BAP-Enho1), несущей промотор β-актина человека, синтетический экзон 1 и интрон и открытую рамку считывания, кодирующую белок Enho1 длиной 76 а.к., получали трансгенные линии, сверхэкспрессирующие Enho1 (фиг.9A; см. фиг.4, открытая рамка считывания подчеркнута). Получили восемь основателей (2 FVB/NJ, 6 C57BL/6J). Одна из линий FVB [FVB/NJ.Tg-(BAP-Enho1)AAB20], далее в настоящем документе обозначаемая как FVB.Tg, демонстрировала увеличение экспрессии Enho1 в печени в возрасте 5-6 недель (фиг.9B). На фиг.10 показаны результаты скрининга ПЦР детенышей в первом поколении инъекции BAP-Enho1 в ооциты C57BL/6J, демонстрирующие шесть детенышей [6, 8, 14, 19, 21 и 22] с интеграцией трансгена в геном.

В возрасте 5-6 недель у FVB.Tg уже было очевидно снижение уровней сывороточных TG и TC (таблица 5, фиг.9C). Масса тела (таблица 5) и FM (фиг.9D) трансгенных FVB.Tg относительно детенышей WT снижалась. Также уменьшался прирост массы мышей FVB.Tg на HFD (60% кДж/жир), указывая на защиту от индуцированного диетой ожирения (фиг.9E). Через 1 месяц на HFD все еще наблюдали уменьшенную массу тела и содержание жира, связанные с тенденцией к пониженным уровням инсулина при голодании у трансгенных BAP-Enho1 по сравнению с контролями WT (180±60 относительно 310±40 пг/мл, 2-сторонний критерий Стьюдента P=0,085).

Таблица 5
Данные первых 3 поколений мышей FVB.Tg.
Все мыши представляют собой самок
в возрасте приблизительно 4,5 недель, n=3-5 на группу
*P<0,05 по сравнению с контрольной группой.
Масса тела (г) Масса печени (г) Печень как %
от массы тела
Глюкоза (мг/дл) Триглицериды (мг/дл) Холестерин (мг/дл)
FVB WT 20,5±1,1 0,88±0,01 4,3±0,4 151±14 105±3 219±7
FVB.Tg 17,8±0,1* 0,69±0,01* 3,9±0,2 105±6* 82±6* 198±4*

Как показано выше, наблюдали, что сверхэкспрессия Enho1 снижала метаболическую адаптацию к голоданию, возможно указывая на увеличенное потребление энергии. Для определения того, увеличивает ли Enho1 потребление энергии, с применением непрямой калориметрии измеряли VO2 и RER (15, 46, 50). В исследовательском центре Pennington Biomedical Research Center есть 16-камерная универсальная система контроля за лабораторными животными (CLAMS), содержащимися в инкубаторе с контролем температуры. CLAMS одновременно измеряет потребление кислорода (VO2), дыхательный коэффициент (RER, индикатор окисления субстратов у животного в целом), физическую активность по осям X и Z и потребление пищи. Мышей помещали в систему CLAMS и указанные параметры записывали в течение 72 часов. Мышей достаточно кормили в течение 48 часов с голоданием в последние 24 часа. Результаты для FVB.Tg показаны на фиг.13A-13F. После ночного голодания наблюдали усиленную потерю массы у мышей KK-Ay с ожирением, B6 Ay/a с ожирением, экспрессирующих Ad5Enho1 (% потери массы после ночного голодания для Ad5-Enho1 относительно Ad5-GFP: 5,5±0,4% относительно 3,5±0,4%, P<0,01) и у 9-недельных худых FVB.Tg (13,6±1,1% относительно 10,0±0,7%, P<0,05). После 1 месяца кормления с высоким содержанием жиров измерение энергетического метаболизма у трансгенных мышей посредством непрямой калориметрии показало значимо увеличенное потребление кислорода (VO2 в мл/час: BAP-Enho1 Tg 4551±240, WT FVB 3807±145, P<0,05) и физическую активность при выключенном свете (перекрытий луча по X в час: BAP-Enho1 Tg 1431±181; WT FVB 2678±327, P<0,01) по сравнению с контролями. Таким образом, увеличенное потребление энергии может являться фактором, облегчающим индуцированное диетой ожирение и резистентность к инсулину посредством Enho1.

ПРИМЕР 12

Действие Enho1 на адипоциты

Проводили эксперимент для тестирования использования рекомбинантной или синтетической формы короткого секретируемого полипептида Enho134-76 (SEQ ID NO: 10). Ответ адипоцитов и гепатоцитов (двух потенциальных участков действия Enho1) на синтетический Enho134-76 анализировали на изменения во внеклеточно регулируемой киназе (ERK). ERK1/2 и p38α важны для регуляции липолиза и термогенеза в адипоцитах.

Применение 1 мкг/мл Enho134-76 было связано с быстрым увеличением фосфорилирования Erkl в полностью дифференцированных адипоцитах 3T3-L1 (фиг.11A) и в клетках HepG2 (фиг.11B). Эти результаты показывают, что функциональные рецепторы для Enho134-76 активны в адипоцитах и гепатоцитах и что синтетический пептид является биологически активным. Кроме того, синтезировали более короткий второй пептид с использованием аминокислот с 39 по 76 SEQ ID NO: 2, и назвали "Enho139-76" (SEQ ID NO: 11). С этим пептидом получали сходные результаты с использованием адипоцитов и гепатоцитов. Потеря четырех аминокислот, по-видимому, не сказывалась на функции Enho1.

ПРИМЕР 13

Функция Enho1 в гипоталамусе

Гипоталамический Enho1 может быть вовлечен в регуляцию энергетического гомеостаза. Предварительный анализ с использованием pAB1 (SEQ ID NO: 8) показал наличие иммунологической реактивности к Enho1 в нейронах, расположенных в дугообразном ядре гипоталамуса (данные не показаны). Предсказано, что может существовать отрицательная корреляция между экспрессией гипоталамического Enho1 и ожирением и резистентностью к инсулину. Другими словами, пониженный синтез Enho1 в печени и гипоталамусе в случаях ожирения может являться фактором, вносящим вклад в ожирение и резистентность к инсулину.

Экспрессию мРНК Enho1 измеряли посредством количественной ПЦР-РВ в медиобазальных участках гипоталамуса у контроля (диета с низким содержанием жира) и при индуцированном диетой ожирении у мышей C57BL/6J, Mc3rKO и Mc4rKO (фиг.12A-12B). Как и предсказано, концентрация мРНК Enho1 в гипоталамусе в состоянии ожирения была снижена (фиг.12A). Экспрессия Enho1 также была низкой у мышей с повышенными значениями HOMA-IR, индикатора резистентности к инсулину (фиг.12B).

Напротив, экспрессия мРНК Socs3 в случаях ожирения и резистентность к инсулину были повышенными (фиг.11C). Эти данные показывают, что пониженный синтез Enho1 в случаях ожирения не ограничен печенью. Пониженная активность Enho1 в гипоталамусе также может вносить вклад в развитие ожирения и резистентности к инсулину.

Таким образом, сконструирован экспрессирующий вектор с использованием частичной последовательности кДНК, кодирующей предсказанные 76 остатков Enho1 (между нуклеотидами 207 и 437 BC021944; SEQ ID NO: 2), с эпитопной меткой, вставленной на карбоксильном конце для обеспечения визуализации белка на "вестерн-блоте" с применением коммерчески доступного антитела к метке. С применением этой конструкции подтверждено, что указанные последовательности кодируют секретируемый белок. Затем этот экспрессирующий вектор и экспрессирующий вектор, кодирующий природный белок без эпитопной метки, использовали для конструирования рекомбинантного аденовируса (Ad5-Enho1) для применения в исследованиях на мышах. Инъекции 5·108 БОЕ аденовируса в хвостовую вену в основном приводили к инфекции печени и, в меньшей степени, селезенки. С применением аденовируса, экспрессирующего эпитопно меченного Enho1, показано, что через 5 суток после инъекции вируса происходит широкое распространение белка Enho1 в печени, головном мозге и скелетных мышцах. Используя этот аденовирус, экспрессирующий природную форму Enho1, показана новая функция (снижение сывороточных триглицеридов и холестерина при голодании) для секретируемого белка. Снижение экспрессии мРНК Enho1 в печени наблюдали у мышей с ожирением с гиперлипидемией, с величиной снижения, коррелирующей с увеличением общего холестерина и триглицеридов. Используя аденовирус, экспрессирующий природную форму Enho1, показано, что увеличение экспрессии мРНК, кодирующей белок Enho1, в моделях ожирения на мышах с высоким холестерином и триглицеридами эффективно для снижения холестерина и триглицеридов к нормальным уровням. Воздействия инфекции Ad5-Enho1 на снижение триглицеридов и общего холестерина были воспроизводимы, будучи наблюдаемыми в трех различных линиях мышей (Lepob/Lepob, KK-Ay и C57BL/6J). У некоторых мышей наблюдали улучшение чувствительности к инсулину в направлении снижения инсулина и глюкозы при голодании и улучшение результатов тестирования толерантности к глюкозе. Последние наблюдения указывают на то, что Enho1 может быть эффективным при улучшении чувствительности к инсулину у устойчивого к инсулину пациента с ожирением.

Данные убедительно свидетельствуют, что полноразмерный пептид Enho1 (SEQ ID NO: 2) или производные, гомологи, аналоги пептида или их миметики с доставкой посредством перорального приема, инъекцией, подкожного пластыря или интраназального введения можно использовать в качестве терапевтических или диагностических средств при гиперхолестеринемии, гипертриглицеридемии, резистентности к инсулину, ожирении, диабете и/или нарушениях энергетического баланса. Известными в данной области способами можно осуществлять замены в природной кодирующей последовательности с получением производных Enho1 с увеличенной стабильностью и/или биологической эффективностью. Кроме того, пептид Enho1 можно использовать для идентификации его клеточного рецептора, который затем можно использовать в качестве еще неидентифицированного рецептора(ов) для Enho1, являющегося (являющихся) потенциальной мишенью(ями) для лекарственных средств для разработки способов лечения, нацеленных на снижение уровней общего холестерина, триглицеридов, резистентности к инсулину, ожирения, диабета и/или энергетического дисбаланса.

Новый секретируемый белок, Enho1, который является важным фактором в этиологии резистентности к инсулину и жирового гепатоза, в состоянии ожирения идентифицирован анализом экспрессии генов на микрочипах в моделях "диожирения" в степени от умеренной до тяжелой на мышах. Enho1 значимо снижает HOMA-IR, индекс инсулина и глюкозы при голодании и уровень сывороточных липидов в моделях диабета типа 2 на мышах и значительно снижает уровень липидов в печени, свидетельствуя об обращении жирового гепатоза. Трансгенная сверхэкспрессия Enho1 связана с худым фенотипом. Enho1 может действовать сходным с лептином и адипонектином образом, улучшая метаболический профиль в состоянии инсулинового ожирения, стимулируя потребление энергии и увеличивая окислительный метаболизм.

ПРИМЕР 14

Обработка Enho1 обращает резистентность к инсулину в печени

Предварительные данные от трансгенных по Ad5-Enho1 и BAP-Enho1 индивидуумов (показанные выше) свидетельствуют об улучшении действия инсулина и метаболизма липидов. У мышей FVB.Tg увеличенный окислительный метаболизм, вероятно, является фактором, объясняющим эти эффекты. Может быть возможным отделить антидиабетическое действие Enho1 от указанного вторичного действия для снижения FM. Предварительные данные с использованием рекомбинантного аденовируса указывают на то, что Enho1 снижает гиперинсулинемию и гиперлипидемию независимо от эффектов на ожирение. Таким образом, дальнейшие эксперименты с применением рекомбинантного аденовируса и синтетического пептида могут предоставить важную информацию относительно "прямых" эффектов Enho1 на метаболизм и чувствительность к инсулину в печени.

Можно проводить эксперименты для определения того, связано ли обращение жирового гепатоза при обработке Ad-Enho1 с улучшенной чувствительностью к инсулину в печени и скелетных мышцах посредством измерения передачи сигнала инсулиновым рецептором. Они включают анализ фосфорилирования субстратов 1 и 2 инсулинового рецептора, которое дистально относительно тирозинкиназы инсулинового рецептора. Так же, как индикатор активации инсулинового рецептора, можно измерять активность протеинкиназы B (PKB)/Akt, серин/треониновой киназы, вовлеченной в регуляцию транспорта глюкозы, которая расположена ниже фосфатидил-3'-киназы [44, 45]. Предварительные данные, демонстрирующие значимо большую потерю массы мышей, инфицированных Ad5-Enho1, свидетельствуют об повышенном базальном уровне метаболизма. Увеличивает ли Ad5-Enho1 уровень метаболизма всего организма в состоянии после еды или в голодном состоянии, следует определять с применением непрямой калориметрии. Также необходимо определять окислительный метаболизм в лизатах тканей печени, скелетных мышц и бурой жировой ткани.

Основной протокол обработки аденовирусом показан на фиг.7C. В кратком изложении, всем мышам в хвостовую вену инъецировали 5·109 БОЕ Ad5-ENHO1 или Ad5-GFP (n=12/группа, 24 всего). Мышам следует позволить 4 суток восстановления до проведения следующих экспериментов. Образец печени, взятый по окончании, используют для оценки инфекции посредством измерения мРНК Enho1 посредством ПЦР с детекцией в реальном времени и анализа "нозерн-блот". В предварительных экспериментах через 4-7 суток после инфицирования наблюдали 4-кратное увеличение мРНК Enho1. Белок Enho1 также следует изменять или посредством "вестерн-блота", или посредством использования анализов (RIA/ELISA), находящихся в настоящее время в разработке. Мышей следует взвесить в сутки инфицирования аденовирусом и перед и после голодания. Если возможно, необходимо определить композицию тела с применением ядерного магнитного резонанса (ЯМР) [15, 32, 46]. Мышей следует акклиматизировать к содержанию в проволочных клетках, позволяющих измерять потребление и потери пищи, как описано ранее [15].

Если воспроизводим и наблюдается в трансгенных по BAP-Enho1 особях на основе C57BL/6J половой диморфный фенотип FVB.Tg, эксперименты с Ad5 следует модифицировать для исследования ответа самок и самцов. В большинстве экспериментов, исследующих ответ тучных мышей с резистентностью к инсулину на обработку Ad5-Enho1, использовали самцов; может быть, что самки демонстрируют другой ответ, возможно в дополнение к улучшенной чувствительности к инсулину демонстрируя потерю массы. Это не было бы беспрецедентным, например, половой диморфизм наблюдали при ответе самцов и самок крыс на анорексигенное действие инсулина и лептин [47, 48].

Определение того, связано ли обращение жирового гепатоза с увеличенной чувствительностью к инсулину. Этот эксперимент включает мышей KK-Ay и Ay/a, в двух группах по двенадцать особей на генотип (Ad5-Enho1, контроли Ad5-GFP) (24 KK-Ay, 24 Ay/a). На сутки 5 после ночного голодания шести из групп с Ad5-ENHO1 и Ad5-GFP следует однократно интраперитонеально ввести инсулин (1 Ед/кг), введя остальным шести физиологический раствор. Мышей следует умертвить через 10 или 20 минут (n=3/группа) после инъекции, отобрать образцы тканей (печень, четырехглавые мышцы) и быстро заморозить в жидком азоте. Фосфорилирование IRS, активность PKB и фосфорилирование FoxO1 следует измерять, как описано ранее [15, 49]. Этот эксперимент следует повторить два или более раз только с 8 мышами на группу для проведения тестов толерантности к инсулину и глюкозе.

Спрогнозировано, что эффект Ad5-Enho1 против ожирения увеличивает стимулированную инсулином активность каскада тирозинкиназы инсулинового рецептора в печени. Ad5-Enho1 также может улучшать передачу сигнала инсулина в мышцах и/или жировой ткани. Исходные исследования, изучающие клиренс глюкозы, приводили к смешанным результатам (данные не показаны), возможно, вследствие недостаточно оптимального планирования эксперимента [т.е. малое количество мышей (n=4-5); проведение в различное время (до двух недель) после инъекции аденовируса]. Спрогнозировано, что Ad5-Enho1 улучшает клиренс глюкозы в ответ на инъекции глюкозы/инсулина.

Определение того, увеличивает ли Enho1 потребление энергии и окислительный метаболизм всего организма. Для определения того, увеличивает ли экспрессия Enho1 в печени, следует измерять потребление энергии, VO2 и RER тучных мышей Ay/a и худых мышей и мышей с индуцированным диетой ожирением C57BL/6J, инфицированных Ad5-Enho1 или Ad5-GFP (n=8/группа), с использованием непрямой калориметрии (15, 46, 50). В исследовательском центре Pennington Biomedical Research Center есть 16-камерная универсальная система контроля за лабораторными животными (CLAMS), содержащимися в инкубаторе с контролем температуры. CLAMS одновременно измеряет потребление кислорода (VO2), дыхательный коэффициент (RER, индикатор окисления субстратов у животного в целом), физическую активность по осям X и Z и потребление пищи. Мышей следует поместить в систему CLAMS через 96 часов после инъекции аденовируса, и параметры записывают в течение 72 часов. Мышам следует обеспечить достаточное питание в течение 48 часов с голоданием в последние 24 часа. В отдельных экспериментах измеряют окисление жирных кислот (C14-пальмитат) и функционирование митохондриальных ферментов (активность цитратсинтазы, цитохром-c-оксидазы) в печени, икроножной мышце и бурой жировой ткани, полученных от мышей Ay/a и C57BL/6J, инфицированных Ad5-Enho1 или Ad5-GFP (n=8/группа). Часть печени следует собрать и быстро заморозить для измерения экспрессии мРНК и белка факторов транскрипции (т.е. SREBP1c, PPARγ) и ферментов, вовлеченных в липогенез [32].

Усиленная потеря массы мышей, инфицированных Ad5-Enho1, указывает на увеличенный базальный уровень метаболизма, находя подтверждение в потере массы при голодании и данных непрямой калориметрии трансгенных по BAP-Enho1 особей. (См. фиг.13A-F). Полагают, что инфицирование Ad5-Enho1 увеличивает VO2, хотя это может быть выражено только в течение фазы голодания. Увеличение активности митохондриальных окислительных ферментов в печени согласуется с действием Enho1 только в качестве аутокринного/паракринного фактора. Увеличенная активность митохондриальных окислительных ферментов в скелетных мышцах и бурой жировой ткани может свидетельствовать об эндокринной функции или действуя посредством вегетативной нервной системы или через рецепторы, экспрессируемые в мышцах и/или бурой жировой ткани. Если Ad5-Enho1 заметно увеличивает потребление энергии (как наблюдали для FVB.Tg), но не затрагивает массу тела, тогда можно предсказать компенсаторное увеличение потребления пищи. Также предсказано снижение экспрессии генов, вовлеченных в липогенез, как наблюдали у мышей OBOB, обработанных Ad5-Enho1 (фиг.8A-8D).

ПРИМЕР 15

Трансгенная экспрессия Enho1 предотвращает ожирение

и резистентность к инсулину

Трансгенные мыши, сверхэкспрессирующие лептин [51, 52] и адипонектин [53, 54], продемонстрировали антидиабетическое действие этих белков. Ожидают, что сверхэкспрессия Enho1 будет иметь результаты, сопоставимые с результатами, наблюдаемыми при сверхэкспрессии адипонектина и лептина; т.е. улучшенные чувствительность к инсулину и толерантность к глюкозе и пониженные уровни липидов при голодании в случаях индуцированного диетой и генетически ожирения. Также ожидают, что Enho1 увеличит потребление энергии посредством увеличения окислительного метаболизма в печени, скелетных мышцах и/или бурой жировой ткани. Исчерпывающий анализ физиологического действия Enho1 важен для дальнейших экспериментов, фокусирующихся на механизме(ах), посредством которых этот полипептид регулирует энергетический метаболизм и передачу сигнала инсулина.

Трансгены: Последовательность, кодирующую белок из 16 а.к., лигировали в синтетический трансген под контролем промотора β-актина человека (BAP) (фиг.9A). Enho1 представляет собой секретируемый полипептид (фиг.4), и таким образом тканеспецифичность для этих трансгенных исследований не важна. Когда эндогенный ген экспрессируется в большом количестве, тканеспецифичные промоторы не используют, так как супрессия эндогенного гена может лимитировать эффективность сверхэкспрессии [53, 54]. Следует провести тщательный анализ экспрессии мРНК с применением количественной ПЦР-РВ (кПЦР-РВ), как описано ранее [31, 32, 46], и анализа "нозерн-блот". Уровни белка следует измерять посредством "вестерн-блота" с использованием двух поликлональных антител к N- и C-концам Enho134-76 (pAB1 (SEQ ID NO: 8), pAB2 (SEQ ID NO: 9)) (фиг.5). Это может потребовать использования иммунопреципитации для детекции белка. Альтернативно, если антитела в наличии или в разработке пригодны для проведения чувствительных и количественных анализов, следует использовать их. Количество копий трансгена следует определять анализом "саузерн-блот". Таким образом, дополнительной целью этого эксперимента является более полный анализ экспрессии мРНК Enho1 в тканях мышей (печень, гипоталамус, передний мозг, задний мозг, скелетные и сердечная мышцы, забрюшинные и паховые жировые депо, желудок, кишечник, поджелудочная железа, почка). Основные органы (сердце, почку, кишечник, печень) следует взвесить и исследовать гистологически на значительные морфологические изменения.

Авторы показали, что Enho1 представляет собой один из небольшой группы секретируемых полипептидов (лептин, адипонектин), которые при сверхэкспрессии улучшают метаболический профиль (т.е. увеличивают чувствительность к инсулину, снижают липогенез в печени) в моделях ожирения на мышах и резистентность к инсулину. Сверхэкспрессия Enho1 обладает лептиноподобным действием на энергетический метаболизм, защищая от индуцированного диетой ожирения и резистентности к инсулину. Введение Enho1 может обратить резистентность к инсулину и дислипидемию, связанные с индуцированным диетой или генетически ожирением, и может предотвратить или задержать начало диабета типа 2.

Разное

Используемый в настоящем документе и в формуле изобретения термин "Enho1" относится к белку Enho1 (SEQ ID NO: 2), его функциональным пептидам (например, Enho134-76), производным и аналогам. Термины "производные" и "аналоги" следует понимать как белки, которые сходны по структуре со Enho1 и которые демонстрируют количественно сходный с немодифицированным Enho1 эффект. Термин "функциональный пептид" относится к части белка Enho1, которая еще связывает рецептор Enho1 или способна активировать изменения в клетках организма, например, адипоцитах или гепатоцитах.

Введение Enho1, его функциональных пептидов, его аналогов и производных в соответствии с настоящим изобретением можно использовать для обращения резистентности к инсулину и дислипидемии и для предотвращения или задержки начала ожирения. Эти соединения также можно использовать в качестве терапевтических или диагностических средств при гиперхолестеринемии, гипертриглицеридемии, резистентности к инсулину, ожирении и диабете.

Как применяют в настоящем документе, термин "терапевтически эффективное количество" относится к количеству белка Enho1, фрагмента или производного или аналога, достаточному или для увеличения потребления энергии организмом, снижения сывороточных триглицеридов, снижения сывороточного холестерина, снижения гиперлипидемии, снижения резистентности к инсулину или для задержки или устранения начала диабета типа 2 у пациентов с устойчивостью к инсулину в статистически значимой степени (р<0,05). Интервалы доз для введения белка Enho1 представляют собой интервалы доз, обеспечивающие желательный эффект. Как правило, доза варьирует в зависимости от возраста, массы, состояния и пола пациента. Специалист в данной области, при наличии указаний настоящей спецификации может легко определить подходящие диапазоны доз. В случае любых противопоказаний дозу может отрегулировать конкретный лечащий врач. В любом случае эффективность лечения можно определять, контролируя метаболизм организма, массу тела или уровни сывороточных глюкозы, триглицеридов или холестерина способами, хорошо известными в этой области. Кроме того, Enho1 можно применять в фармацевтически приемлемых носителях, известных в данной области.

Этот способ лечения можно использовать у млекопитающих, как правило включая человека, и не являющихся человеком млекопитающих. Пептиды по настоящему изобретению можно вводить пациенту любыми подходящими способами, включая пероральное, внутривенное, парентеральное, подкожное, внутрилегочное и интраназальное введение.

Парентеральные введения включают в себя внутримышечное, внутривенное, внутриартериальное или интраперитонеальное введения. Пептиды также можно вводить трансдермально, например в форме подкожного имплантата с замедленным высвобождением, или перорально в форме капсул, порошков или гранул. Его также можно вводить посредством ингаляции.

Препараты фармацевтически приемлемых носителей для парентерального введения включают стерильные водные или неводные растворители, суспензии и эмульсии. Примеры неводных растворителей представляют собой пропиленгликоль, полиэтиленгликоль, растительные масла, такие как оливковое масло, и инъецируемые сложные органические эфиры, такие как этилолеат. Водные носители включают воду, спиртовые/водные растворы, эмульсии или суспензии, включая физиологический раствор и забуференные среды. Парентеральные носители включают раствор хлорида натрия, декстрозу Рингера, декстрозу и хлорид натрия, лактат Рингера или жирные масла. Пептиды можно смешивать с эксципиентами, которые являются фармацевтически приемлемыми и совместимыми с активным ингредиентом. Подходящие эксципиенты включают воду, физиологический раствор, декстрозу, глицерин и этанол или их сочетания. Внутривенные носители включают жидкие и питательные наполнители, электролитные наполнители, такие как наполнители на основе декстрозы Рингера и т.п. Также могут присутствовать консерванты и другие добавки, такие как, например, противомикробные средства, антиоксиданты, хелаторы, инертные газы и т.п.

Форма может варьировать в зависимости от способа введения. Например, композиции для инъекций можно предоставлять в форме ампулы, где каждая ампула содержит количество однократной дозы, или в форме контейнера, содержащего несколько доз.

Соединение можно составлять в терапевтические композиции в качестве фармацевтически приемлемых солей. Эти соли включают кислотно-аддитивные соли, формируемые с неорганическими кислотами, например соляной или фосфорной кислотой, или органическими кислотами, такими как уксусная, щавелевая или винная кислота и т.п. Соли также включают соли, сформированные из неорганических оснований, таких как, например, гидроксиды натрия, калия, аммония, кальция или железа, и органических оснований, таких как изопропиламин, триметиламин, гистидин, прокаин и т.п. Композиции можно вводить внутривенно, подкожно или внутримышечно.

Контролируемой доставки можно достигать посредством смешивания пептида с подходящими макромолекулами, например, сложными полиэфирами, полиаминокислотами, поливинилпирролидоном, этиленвинилацетатом, метилцеллюлозой, карбоксиметилцеллюлозой, проламинсульфатом или сополимерами молочной/гликолевой кислот. Скорость высвобождения активного соединения можно контролировать, изменяя концентрацию макромолекулы.

Другой способ контроля длительности действия включает введение пептидов в частицы из полимерного вещества, такого как полиэстер, пептид, гидрогель, сополимер полимолочной/гликолевой кислот или сополимеры этиленвинилацетата. Альтернативно пептид можно инкапсулировать в микрокапсулы, полученные, например, способами коацервации или посредством интерфазной полимеризации, например, посредством применения гидроксиметилцеллюлозы или желатиновых микрокапсул или поли(метилметакрилатных) микрокапсул соответственно или в коллоидную систему доставки лекарственного средства. Коллоидные дисперсные системы включают макромолекулярные комплексы, нанокапсулы, микросферы, гранулы и основанные на липидах системы, включающие эмульсии "масло-в-воде", мицеллы, смешанные мицеллы и липосомы.

Кроме того, всю или части последовательности нуклеиновой кислоты (SEQ ID NO: 1) (например, открытую рамку считывания, подчеркнутую на фиг.4) можно использовать для получения плазмид или векторов для включения гена Enho1 в организмы для увеличения продукции белка Enho1. Специалисты в данной области поймут, что последовательность нуклеиновой кислоты SEQ ID NO: 1 не является исключительной последовательностью, которую можно использовать для получения белка Enho1. Также включены последовательности нуклеиновой кислоты, кодирующие идентичные белки, но которые вследствие вырожденности генетического кода обладают другими нуклеотидными последовательностями. Генетический код можно найти в многочисленных ссылках, относящихся к генетике или биологии, включая, например, фиг.9.1 на странице 214 в B. Lewin, Genes VI (Oxford University Press, New York, 1997). На фиг.9.3 на странице 216 в Lewin непосредственно проиллюстрирована вырожденность генетического кода. Например, кодон для аспарагина может представлять собой AAT или AAC.

Изобретение также относится к нуклеотидным последовательностям, кодирующим белки Enho1 с одним или несколькими молчащими изменениями аминокислот в частях молекулы, не участвующих в связывании с рецептором или секреции белка. Например, включены изменения нуклеотидной последовательности, приводящие к получению в данном участке химически эквивалентной аминокислоты; таким образом, кодон для аминокислоты аланина, гидрофобной аминокислоты, можно заменить кодоном, кодирующим другой гидрофобный остаток, такой как глицин, или можно заместить более гидрофобным остатком, таким как валин, лейцин или изолейцин. Подобным образом, также ожидают, что к биологически эквивалентному продукту приведут изменения, которые приводят к замене одного отрицательно заряженного остатка на другой, такого как аспарагиновая кислота вместо глутаминовой кислоты, или одного положительно заряженного остатка на другой, такого как лизин вместо аргинина. См., например, фиг.1.8 на странице 10 Lewin (1997), демонстрирующую природу боковых цепей "стандартных" 20 аминокислот, кодируемых генетическим кодом. (Также следует отметить типографскую ошибку в опубликованной фигуре, а именно то, что сокращение для глутамина должно быть "Gln").

Примеры 16-25 проводили с использованием Enho1 человека, пептида длиной 76 аминокислот с последовательностью:

CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP

Статистический анализ результатов проводили с использованием инструментария анализа ANOVA с последующими тестами. Данные представлены как среднее ± стандартная ошибка (SE).

Специалистам в данной области будет понятно, что для определения эффекта Enho1 на различные параметры метаболизма, такие как потеря массы, жировой гепатоз, уровни липидов и триглицеридов, глюкозы, инсулина и т.п., можно выполнить эксперименты, подобные экспериментам, описываемым в настоящем документе. Например, можно варьировать длительность времени обработки, может отличаться организация генома линий мышей или крыс, могут применяться другие режимы диеты и т.д. Эти эксперименты никаким образом не предназначены для того, чтобы являться ограничивающими, и являются репрезентативными для примеров, которые пригодны для изучения эффектов пептидов, таких как Enho1, у млекопитающих.

ПРИМЕР 16

Эффект Enho1 на потерю массы (кратковременная обработка)

Эффект Enho1 на потерю массы тестировали в течение 3 суток с использованием мышей KK-Ay. Мышей кормили Breeder Chow (Purina 5015), и в начале эксперимента они находились в возрасте приблизительно 12-14 недель. Шесть контрольных мышей получали только носитель, тогда как каждая из шести тестируемых мышей получала дозы 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 интраперитонеальных (ip) инъекций в 06.00, 14.00 и 20.00 часов в сутки 1 и 2; в течение периода 3 суток всего мыши получили 7 инъекций. Всех животных гуманным образом умертвили через 5 часов после последней инъекции, введенной утром третьих суток. После последней инъекции пищу удаляли.

Шесть контрольных мышей обладали массой перед обработкой 35,3 г (SE±1,2 г) и массой после обработки 33,6 г (SE±1,0). Различие -1,7 г (SE±0,3) представляет собой -4,8% (SE±0,6) снижения массы.

Шесть тестируемых мышей, которые получали 900 нмоль/кг/сутки Enho1, обладали массой перед обработкой 35,3 г (SE±1,1) и массой после обработки 33,0 г (SE±1,0). Различие -2,3 г (SE±0,2) представляет собой -6,5% (SE±0,6) снижения массы.

Шесть тестируемых мышей, которые получали 9000 нмоль/кг/сутки Enho1, обладали средней массой перед обработкой 35,6 г (SE±0,6) и средней массой после обработки 33,1 г (SE±0,4). Различие -2,6 г (SE±0,3) представляет собой -7,1% (SE±0,8) снижения массы.

Эти результаты представлены на фиг.14.

ПРИМЕР 17

Эффект Enho1 на уровни инсулина и глюкозы

Эффект Enho1 на инсулин и глюкозу тестировали в течение 3 суток с использованием мышей KK-Ay. Мышей кормили Breeder Chow (Purina 5015), и в начале эксперимента они находились в возрасте приблизительно 12-14 недель. Шесть контрольных мышей получали только носитель, тогда как каждая из пяти или шести тестируемых мышей получала дозы 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки соответственно. Инъекции проводили в виде 3 ip инъекций в 06.00, 14.00 и 20.00 часов на сутки 1 и 2; в течение периода 3 суток всего мыши получили 7 инъекций. Всех животных гуманным образом умертвили через 5 часов после последней инъекции, введенной утром третьих суток. После последней инъекции пищу удаляли. HOMA-IR для каждой обработки рассчитывали с применением следующей формулы:

((глюкоза мг/дл·18)×(инсулин нг/мл×25,05))·22,5.

Шесть контрольных мышей демонстрировали после тестов средний уровень глюкозы в крови 524 мг/дл (SE±48) и уровень инсулина 7,4 нг/мл (SE±0,6); значение HOMA-IR для контрольной группы определено как 234 (SE±16).

Пять тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 474 мг/дл (SE±29) и уровень инсулина 5,7 нг/мл (SE±0,5); значение HOMA-IR для этой группы определено как 167 (SE±18), представляя собой снижение на 29% по сравнению с контрольной группой. Уровни глюкозы в крови снижались приблизительно на 10%, тогда как уровни инсулина снижались приблизительно на 22%.

Шесть тестируемых мышей, получавших 9000 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 480 мг/дл (SE±38) и уровень инсулина 7,0 нг/мл (SE±0,8); значение HOMA-IR для этой группы определено как 213 (SE±37), представляя собой снижение на 9% по сравнению с контрольной группой.

Эти результаты представлены на фиг.15.

ПРИМЕР 18

Эффект Enho1 на жировой гепатоз

Эффект Enho1 на массу печени, содержание липидов в печени и TG печени тестировали в течение 3 суток с использованием мышей KK-Ay. Мышей кормили Breeder Chow (Purina 5015), и в начале эксперимента они находились в возрасте приблизительно 12-14 недель. Шесть контрольных мышей получали только носитель, тогда как каждая из пяти или шести тестируемых мышей получала дозы 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки соответственно. Инъекции проводили в виде 3 ip инъекций в 06.00, 14.00 и 20.00 часов на сутки 1 и 2; в течение периода 3 суток всего мыши получили 7 инъекций. Всех животных гуманным образом умертвили через 5 часов после последней инъекции, введенной утром третьих суток. После последней инъекции пищу удаляли.

Шесть контрольных мышей продемонстрировали среднюю массу печени 1,6 г (SE±0,1), представляющую собой 4,6% (SE±0,2) от общей массы тела. Средний уровень липидов в печени для контрольной группы составлял 94 мг/г (SE±6), с общим измерением липидов 147 мг/г (SE±14). TG печени для контрольной группы определены как 59 мг/г (SE±5; P<0,05), тогда как общие TG печени определены как 92 мг/г (SE±10; p=0,062).

Пять тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, демонстрировали после теста среднюю массу печени 1,6 г (SE±0,1), представляющую собой 5,0% (SE±0,2) от массы тела. Средний уровень липидов в печени для этой группы определен как 82 мг/г (SE±9), с общим измерением липидов 137 мг/г (SE±18). TG печени для этой группы определены как 40 мг/г (SE±8; P<0,05), тогда как общие TG печени определены как 66 мг/г (SE±13; p=0,062).

Шесть тестируемых мышей, получавших 9000 нмоль/кг/сутки Enho1, демонстрировали после теста среднюю массу печени 1,6 г (SE±0,1), представляющую собой 4,9% (SE±0,3) от массы тела. Средний уровень липидов в печени для этой группы определен как 87 мг/г (SE±6), с общим измерением липидов 143 мг/г (SE±17). TG печени для этой группы определены как 32 мг/г (SE±5; P<0,05), тогда как общие TG печени определены как 53 мг/г (SE±11; p=0,062).

Эти данные демонстрируют, что Enho1 способен к индукции зависимого от дозы обращения жирового гепатоза. У мышей, получавших дозировки 900 нмоль/кг/сутки и 9000 нмоль/кг/сутки, печень и TG по сравнению с контрольной группой снизились на 32% и 46% соответственно.

Эти результаты представлены на фиг.16.

ПРИМЕР 19

Эффект Enho1 на потерю массы (кратковременную)

у мышей с ожирением

Эффект Enho1 на потерю массы тестировали в течение периода 3 суток с использованием мышей C57BL/6J (Jackson Laboratories, Bar Harbor, Maine) с индуцированным диетой ожирением (DIO). Мышей кормили Research Diets 12492 (60% кДж/жир) в течение 12 недель, что приводило к ожирению и умеренной гипергликемии у животных. В начале эксперимента мыши находились в возрасте приблизительно 20-22 недель, и их масса составляла 30-50 г. Уровень глюкозы в крови при голодании определен приблизительно как 170-220 мг/дл. Шесть контрольных мышей получали только носитель, тогда как каждая из шести тестируемых мышей получала дозы 90 нмоль/кг/сутки, 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 ip инъекций в 06.00, 14.00 и 20.00 часов на сутки 1 и 2; в течение периода 3 суток всего мыши получили 7 инъекций. Всех животных гуманным образом умертвили через 5 часов после последней инъекции, введенной утром третьих суток. После последней инъекции пищу удаляли.

Шесть контрольных мышей продемонстрировали средние массы до и после обработки 42,7 г (SE±2,4 г) и 41,7 г (SE±2,3) соответственно, что представляет 2,4% (SE±0,5) снижения общей массы тела.

Шесть тестируемых мышей, получавших 90 нмоль/кг/сутки Enho1, продемонстрировали средние массы до и после обработки 42,9 г (SE±1,2) и 41,7 г (SE±0,9) соответственно, что представляет 2,9% (SE±0,6) снижения общей массы тела.

Шесть тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, продемонстрировали средние массы до и после обработки 42,8 г (SE±2,9) и 41,3 г (SE±2,7) соответственно, что представляет 3,5% (SE±0,7) снижения общей массы тела.

Шесть тестируемых мышей, получавших 9000 нмоль/кг/сутки Enho1, продемонстрировали средние массы до и после обработки 42,7 г (SE±1,6) и 40,9 г (SE±1,6) соответственно, что представляет 4,1% (SE±0,6) снижения общей массы тела.

Эти результаты представлены на фиг.17.

ПРИМЕР 20

Эффект Enho1 на уровни инсулина и глюкозы

Эффект Enho1 на инсулин и глюкозу тестировали в течение периода 3 суток с использованием мышей C57BL/6J (Jackson Laboratories, Bar Harbor, Maine) с индуцированным диетой ожирением (DIO). Мышей кормили Research Diets 12492 (60% кДж/жир) в течение 12 недель, что приводило к ожирению и умеренной гипергликемии у животных. В начале эксперимента мыши находились в возрасте приблизительно 20-22 недель, и их масса составляла 30-50 г. Уровень глюкозы в крови при голодании определен приблизительно как 170-220 мг/дл. Шесть контрольных мышей получали только носитель, тогда как каждая из шести тестируемых мышей получала дозы 90 нмоль/кг/сутки, 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 ip инъекций в 06.00, 14.00 и 20.00 часов на сутки 1 и 2; в течение периода 3 суток всего мыши получили 7 инъекций. Всех животных гуманным образом умертвили через 5 часов после последней инъекции, введенной утром третьих суток. После последней инъекции пищу удаляли.

HOMA-IR для каждой обработки рассчитывали с применением следующей формулы:

((глюкоза мг/дл·18)×(инсулин нг/мл×25,05))·22,5.

Шесть контрольных мышей демонстрировали после теста средний уровень глюкозы в крови 196 мг/дл (SE±7) и уровень инсулина 4,8 нг/мл (SE±0,2); значение HOMA-IR для контрольной группы определено как 59 (SE±3; p=0,065).

Шесть тестируемых мышей, получавших 90 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 204 мг/дл (SE±7) и уровень инсулина 3,8 нг/мл (SE±0,4); значение HOMA-IR для этой группы определено как 50 (SE±5), представляя снижение 15% по сравнению с контрольной группой.

Шесть тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 166 мг/дл (SE±13; P>0,05) и уровень инсулина 4,2 нг/мл (SE±0,5); значение HOMA-IR для этой группы определено как 42 (SE±3), представляя снижение 29% (p<0,02) по сравнению с контрольной группой. Уровни глюкозы в крови снижались приблизительно на 15%, тогда как уровни инсулина снижались приблизительно на 14%.

Шесть тестируемых мышей, получавших 9000 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 198 мг/дл (SE±9) и уровень инсулина 4,2 нг/мл (SE±0,3); значение HOMA-IR для этой группы определено как 52 (SE±4), представляя снижение 12% по сравнению с контрольной группой.

Эти результаты представлены на фиг.18.

ПРИМЕР 21

Эффект Enho1 на жировой гепатоз

Эффект Enho1 на массу печени, содержание липидов в печени и TG печени тестировали в течение периода 3 суток с использованием мышей C57BL/6J (Jackson Laboratories, Bar Harbor, Maine) с индуцированным диетой ожирением (DIO). Мышей кормили Research Diets 12492 (60% кДж/жир) в течение 12 недель, что приводило к ожирению и умеренной гипергликемии у животных. В начале эксперимента мыши находились в возрасте приблизительно 20-22 недель, и их масса составляла 30-50 г. Уровень глюкозы в крови при голодании определен приблизительно как 170-220 мг/дл. Шесть контрольных мышей получали только носитель, тогда как каждая из шести тестируемых мышей получала дозы 90 нмоль/кг/сутки, 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 ip инъекций в 06.00, 14.00 и 20.00 часов на сутки 1 и 2; в течение периода 3 суток всего мыши получили 7 инъекций. Всех животных гуманным образом умертвили через 5 часов после последней инъекции, введенной утром третьих суток. После последней инъекции пищу удаляли.

Шесть контрольных мышей продемонстрировали среднюю массу печени 1,6 г (SE±0,2), представляющую 3,7% (SE±0,2) от общей массы тела. Средний уровень липидов в печени для контрольной группы составлял 155 мг/г (SE±39), с общим измерением липидов 272 мг/г (SE±89). TG печени для контрольной группы определены как 58 мг/г (SE±11), тогда как общие TG печени определены как 87 мг/г (SE±15).

Шесть тестируемых мышей, получавших 90 нмоль/кг/сутки Enho1, демонстрировали после теста среднюю массу печени 1,5 г (SE±0,0), представляющую 3,6% (SE±0,1) от массы тела. Средний уровень липидов в печени для этой группы определен как 126 мг/г (SE±9), с общим измерением липидов 188 мг/г (SE±13). TG печени для этой группы определены как 57 мг/г (SE±8), тогда как общие TG печени определены как 86 мг/г (SE±14).

Шесть тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, демонстрировали после теста среднюю массу печени 1,5 г (SE±0,2), представляющую 3,5% (SE±0,2) от массы тела. Средний уровень липидов в печени для этой группы определен как 137 мг/г (SE±34), с общим измерением липидов 226 мг/г (SE±77). TG печени для этой группы определены как 48 мг/г (SE±12), тогда как общие TG печени определены как 66 мг/г (SE±14).

Шесть тестируемых мышей, получавших 9000 нмоль/кг/сутки Enho1, демонстрировали после теста среднюю массу печени 1,4 г (SE±0,2), представляющую 3,4% (SE±0,3) от массы тела. Средний уровень липидов в печени для этой группы определен как 139 мг/г (SE±42), с общим измерением липидов 230 мг/г (SE±96). TG печени для этой группы определены как 47 мг/г (SE±9), тогда как общие TG печени определены как 63 мг/г (SE±10).

Эти данные демонстрируют, что Enho1 способен к индукции зависимого от дозы обращения жирового гепатоза. У мышей, получавших дозировки 9000 нмоль/кг/сутки, печень и TG печени по сравнению с контрольной группой снизились на 18-19%, тогда как сывороточные TG снизились на 20% (p<0,05; 1-сторонний t-тест) по сравнению с контрольной группой.

Эти результаты представлены на фиг.19.

ПРИМЕР 22

Эффект Enho1 на сывороточные липиды

Эффект Enho1 на содержание печеночных сывороточных липидов тестировали на протяжении 8 суток с использованием тучных (ob/ob) мышей. Мышей кормили Research Diets 12450, и в начале эксперимента они находились в возрасте приблизительно 9-10 недель. Контрольные мыши получали только носитель, тогда как каждая из тестируемых мышей получала дозы 90 нмоль/кг/сутки, 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 ip инъекций в 08.00, 12.00 и 16.00 час в течение 7 суток. На сутки 8 мышам вводили инъекцию в 08.00 час и умерщвляли через 1-3 часа, забирая в это время образцы крови.

Уровни глюкозы в крови измеряли с применением глюкометра Accu-Chek. Уровни инсулина измеряли посредством ELISA (Mercodia Mouse Insulin ELISA, ALPCO), а триглицериды измеряли с применением набора Triglyceride L-Type TG H (Wako Diagnostics).

Восемь контрольных мышей продемонстрировали средний уровень триглицеридов в крови 29,6 мг/дл (SE±5,9).

Восемь тестируемых мышей, получавших 90 нмоль/кг/сутки Enho1, продемонстрировали после теста уровень TG в крови 19,4 мг/дл (SE±2,2), снижение 34% по сравнению с контролем.

Семь тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, продемонстрировали после теста уровень TG в крови 18,4 мг/дл (SE±2,3), снижение 38%

относительно контроля.

Последняя группа из семи мышей, получавших 9000 нмоль/кг/сутки Enho1, продемонстрировала после теста уровень TG в крови 22,0 мг/дл (SE±2,2), снижение 26%

относительно контроля.

Эти результаты представлены на фиг.20.

ПРИМЕР 23

Эффект Enho1 на потерю массы

Эффект Enho1 на потерю массы тестировали на протяжении 7 суток с использованием мышей C57BL/6J (Charles River Laboratories) с DIO. Мышей содержали на высокожировой диете (Research Diets 12492) в течение 10 недель до начала эксперимента, который начался, когда мыши достигли возраста 15-16 недель. Контрольные мыши получали только носитель, тогда как каждая из тестируемых мышей получала дозы 90 нмоль/кг/сутки, 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 ip инъекций в 08.00, 12.00 и 16.00 час в течение 7 суток. На сутки 8 мышам вводили инъекцию в 08.00 час и умерщвляли через 1-3 часа.

Восемь контрольных мышей продемонстрировали средние массы до и после обработки 34,2 г (SE±1,5 г) и 32,6 г (SE±1,0) соответственно, представляющие 4,5% (SE±1,5) снижения общей массы тела.

Восемь тестируемых мышей, получавших 90 нмоль/кг/сутки Enho1, продемонстрировали средние массы до и после обработки 36,5 г (SE±1,3) и 34,0 г (SE±0,9) соответственно, представляющие 6,6% (SE±1,1) снижения общей массы тела.

Семь тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, продемонстрировали средние массы до и после обработки 37,9 г (SE±1,4) и 36,0 г (SE±1,2), соответственно, представляющие 7,1% (SE±1,2) снижения общей массы тела.

В заключение семь тестируемых мышей, получавших 9000 нмоль/кг/сутки Enho1, продемонстрировали средние массы до и после обработки 33,8 г (SE±10,8) и 31,6 г (SE±0,7) соответственно, представляющие 6,7% (SE±1,3) снижения общей массы тела.

Эти результаты представлены на фиг.21.

ПРИМЕР 24

Эффект Enho1 на инсулин и глюкозу

Эффект Enho1 на инсулин и глюкозу тестировали на протяжении 7 суток с использованием мышей C57BL/6J (Charles River Laboratories) с DIO. Мышей содержали на высокожировой диете (Research Diets 12492) в течение 10 недель до начала эксперимента, который начался, когда мыши достигли возраста 15-16 недель. Контрольные мыши получали только носитель, тогда как каждая из тестируемых мышей получала дозы 90 нмоль/кг/сутки, 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 ip инъекций в 08.00, 12.00 и 16.00 час в течение 7 суток. На сутки 8 мышам вводили инъекцию в 08.00 час и умерщвляли через 1-3 часа, собирая в это время образцы крови и определяя уровни инсулина и глюкозы.

HOMA-IR для каждой обработки рассчитывали с применением следующей формулы:

((глюкоза мг/дл·18)×(инсулин нг/мл×25,05))·22,5.

Восемь контрольных мышей демонстрировали после теста средний уровень глюкозы в крови 191 мг/дл (SE±10) и уровень инсулина 1,9 нг/мл (SE±0,3); значение HOMA-IR для контрольной группы определено как 22 (SE±4).

Восемь тестируемых мышей, получавших 90 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 182 мг/дл (SE±17) и уровень инсулина 1,3 нг/мл (SE±0,1); значение HOMA-IR для этой группы определено как 15 (SE±2), представляя снижение 15% по сравнению с контрольной группой.

Семь тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 212 мг/дл (SE±11) и уровень инсулина 2,2 нг/мл (SE±0,3); значение HOMA-IR для этой группы определено как 29 (SE±4), представляя снижение 29% (p<0,02) по сравнению с контрольной группой.

Семь тестируемых мышей, получавших 9000 нмоль/кг/сутки Enho1, демонстрировали после теста средний уровень глюкозы в крови 190 мг/дл (SE±16) и уровень инсулина 1,3 нг/мл (SE±0,2); значение HOMA-IR для этой группы определено как 16 (SE±4), представляя снижение 27 по сравнению с контрольной группой.

Эти результаты представлены на фиг.22.

ПРИМЕР 25

Эффект Enho1 на липиды крови

Эффект Enho1 на уровни липидов в крови тестировали на протяжении 7 суток с использованием мышей C57BL/6J (Charles River Laboratories) с DIO. Мышей содержали на высокожировой диете (Research Diets 12492) в течение 10 недель до начала эксперимента, который начался, когда мыши достигли возраста 15-16 недель. Контрольные мыши получали только носитель, тогда как каждая из тестируемых мышей получала дозы 90 нмоль/кг/сутки, 900 нмоль/кг/сутки или 9000 нмоль/кг/сутки. Инъекции проводили в виде 3 ip инъекций в 08.00, 12.00 и 16.00 час в течение 7 суток. На сутки 8 мышам вводили инъекцию в 08.00 час и умерщвляли через 1-3 часа, собирая в это время образцы крови и определяя уровни триглицеридов. Триглицериды измеряли с применением набора Triglyceride L-Type TG H (Wako Diagnostics).

Восемь контрольных мышей продемонстрировали средний уровень триглицеридов в крови 22,9 мг/дл (SE±2,8).

Восемь тестируемых мышей, получавших 90 нмоль/кг/сутки Enho1, продемонстрировали после теста уровень TG в крови 22,5 мг/дл (SE±6,0).

Семь тестируемых мышей, получавших 900 нмоль/кг/сутки Enho1, продемонстрировали после теста уровень TG в крови 38,0 мг/дл (SE±12,5).

Последняя группа из семи мышей, получавших 9000 нмоль/кг/сутки Enho1, продемонстрировала после теста уровень TG в крови 18,5 мг/дл (SE±1,7), снижение 19% относительно контроля.

Эти результаты представлены на фиг.23.

Источники информации

1. Gunning, P., Leavitt, J., Muscat, G., Ng, S.Y. & Kedes, L. (1987) A human beta-actin expression vector system directs high-level accumulation of antisense transcripts. Proc. Natl. Acad. Sci. USA 84: 4831-4835.

2. Reaven, G.M. (1995) Pathophysiology of insulin resistance in human disease. Physiol. Rev. 75: 473-486.

3. Horton, J.D., Goldstein, J.L. & Brown, M.S. (2002) SREBPs: activators of the complete program of cholesterol and fatty acid synthesis in the liver. J. Clin. Invest. 109: 1125-1131.

4. Shimomura, I., Matsuda, M., Hammer, R.E., Bashmakov, Y., Brown, M.S. & Goldstein, J.L. (2000) Decreased IRS-2 and increased SREBP-lc lead to mixed insulin resistance and sensitivity in livers of lipodystrophic and ob/ob mice. Mol. Cell 6: 77-86.

5. Gavrilova, O., Haluzik, M., Matsusue, K., Cutson, J.J., Johnson, L., Dietz, K.R., Nicol, C., Vinson, C., Gonzalez, F. & Reitman, M.L. (2003) Liver PPARgamma contributes to hepatic steatosis, triglyceride clearance, and regulation of body fat mass. J. Biol. Chem.

6. Matsusue, K., Haluzik, M., Lambert, G., Yim, S.H., Gavrilova, O., Ward, J.M., Brewer, В., Jr., Reitman, M.L. & Gonzalez, F.J. (2003) Liver-specific disruption of PPARgamma in leptin-deficient mice improves fatty liver but aggravates diabetic phenotypes. J. Clin. Invest. 111: 737-747.

7. Yahagi, N., Shimano, H., Hasty, A.H., Matsuzaka, Т., Ide, Т., Yoshikawa, Т., Amemiya-Kudo, M., Tomita, S., Okazaki, H. et al. (2002) Absence of sterol regulatory element-binding protein-1 (SREBP-1) ameliorates fatty livers but not obesity or insulin resistance in Lep(ob)/Lep(ob) mice. J. Biol. Chem. 277: 19353-19357.

8. Araki, E., Lipes, M.A., Patti, M.E., Bruning, J.C., Haag, В., 3rd, Johnson, R.S. & Kahn, С.R. (1994) Alternative pathway of insulin signalling in mice with targeted disruption of the IRS-1 gene. Nature 372: 186-190.

9. Withers, D.J., Gutierrez, J.S., Towery, H., Burks, D.J., Ren, J.M., Previs, S., Zhang, Y., Bernal, D., Pons, S. et al. (1998) Disruption of IRS-2 causes type 2 diabetes in mice. Nature 391: 900-904.

10. Kido, Y., Burks, D.J., Withers, D., Bruning, J.C, Kahn, С.R., White, M.F. & Accili, D. (2000) Tissue-specific insulin resistance in mice with mutations in the insulin receptor, IRS-1, and IRS-2. J. Clin. Invest. 105: 199-205.

11. Previs, S.F., Withers, D.J., Ren, J.M., White, M.F. & Shulman, G.I. (2000) Contrasting effects of IRS-1 versus IRS-2 gene disruption on carbohydrate and lipid metabolism in vivo. J. Biol. Chem. 275: 38990-38994.

12. White, M.F. (2002) IRS proteins and the common path to diabetes. Am. J. Physiol. Endocrinol. Metab. 283: E413-422.

13. Ravussin, E. & Smith, S.R. (2002) Increased fat intake, impaired fat oxidation, and failure of fat cell proliferation result in ectopic fat storage, insulin resistance, and type 2 diabetes mellitus. Ann. N-Y Acad. Sci. 967: 363-378.

14. Lowell, B.B. & Shulman, G.I. (2005) Mitochondrial dysfunction and type 2 diabetes. Science 307: 384-387.

15. Sutton, G.M., Trevaskis, J.L., Hulver, M.W., McMillan, R.P., Markward, N.J., Babin, M.J., Meyer, E.A. & Butler, A.A. (2006) Diet-genotype interactions in the development of the obese, insulin-resistant phenotype of C57BL/6J mice lacking melanocortin-3 or -4 receptors. Endocrinology 147: 2183-2196.

16. Elmquist, J.K., Coppari, R., Balthasar, N., Ichinose, M. & Lowell, B.B. (2005) Identifying hypothalamic pathways controlling food intake, body weight, and glucose omeostasis. J. Comp. Neurol. 493: 63-71.

17. Asilmaz, E., Cohen, P., Miyazaki, M., Dobrzyn, P., Ueki, K., Fayzikhodjaeva, G., Soukas, A.A., Kahn, C.R., Ntambi, J.M. et al. (2004) Site and mechanism of leptin action in a rodent form of congenital lipodystrophy. J. Clin. Invest. 113: 414-424.

18. Morton, G.J., Blevins, J.E., Williams, D.L, Niswender, K.D., Gelling, R.W., Rhodes, C.J., Baskin, D.G. & Schwartz, M.W. (2005) Leptin action in the forebrain regulates the hindbrain response to satiety signals. J. Clin. Invest. 115: 703-710.

19. Coppari, R., Ichinose, M., Lee, C.E., Pullen, A.E., Kenny, C.D., McGovern, R.A., Tang, V., Liu, S.M., Ludwig, T. et al. (2005) The hypothalamic arcuate nucleus: A key site for mediating leptin's effects on glucose homeostasis and locomotor activity. Cell Metabolism 1: 63-72.

20. Minokoshi, Y., Kim, Y.-B., Peroni, O.D., Fryer, L.G.D., Muller, C., Carling, D. & Kahn, B.B. (2002) Leptin stimulates fatty-acid oxidation by activating AMP-activated protein kinase. Nature 415: 339-343.

21. Roden, M., Price, T.B., Perseghin, G., Petersen, K.F., Rothman, D.L., Cline, G.W. & Shulman, G.I. (1996) Mechanism of free fatty acid-induced insulin resistance in humans. J. Clin. Invest. 97: 2859-2865.

22. Dresner, A., Laurent, D., Marcucci, M., Griffin, M.E., Dufour, S., Cline, G.W., Slezak, L.A., Andersen, D.K., Hundal, R.S. et al. (1999) Effects of free fatty acids on glucose transport and IRS-1-associated phosphatidylinositol 3-kinase activity. J. Clin. Invest. 103: 253-259.

23. Kim, Y.B., Shulman, G.I. & Kahn, B.B. (2002) Fatty acid infusion selectively impairs insulin action on Akt1 and protein kinase C lambda/zeta but not on glycogen synthase kinase-3. J. Biol. Chem. 277: 32915-32922.

24. Roden, M., Krssak, M., Stingl, H., Gruber, S., Hofer, A., Furnsinn, C., Moser, E. & Waldhausl, W. (1999) Rapid impairment of skeletal muscle glucose transport/phosphorylation by free fatty acids in humans. Diabetes 48: 358-364.

25. Yu, C., Chen, Y., Cline, G.W., Zhang, D., Zong, H., Wang, Y., Bergeron, R., Kim, J.K., Cushman, S.W. et al. (2002) Mechanism by which fatty acids inhibit insulin activation of insulin receptor substrate-1 (IRS-1)-associated phosphatidylinositol 3-kinase activity in muscle. J. Biol. Chem. 277: 50230-50236.

26. Rajala, M.W. & Scherer, P.E. (2003) Minireview: The adipocyte at the crossroads of energy homeostasis, inflammation, and atherosclerosis. Endocrinology 144: 3765-3773.

27. Kadowaki, T. & Yamauchi, T. (2005) Adiponectin and adiponectin receptors. Endocr. Rev. 26: 439-451.

28. Flier, J.S. (2004) Obesity wars. Molecular progress confronts an expanding epidemic. Cell 116: 337-350.

29. Nishizawa, H., Matsuda, M., Yamada, Y., Kawai, K., Suzuki, E., Makishima, M., Kitamura, T. & Shimomura, I. (2004) Musclin, a novel skeletal muscle-derived secretory factor. J. Biol. Chem. 279: 19391-19395.

30. Oike, Y., Akao, M., Yasunaga, K., Yamauchi, T., Morisada, T., Ito, Y., Urano, T., Kimura, Y., Kubota, Y. et al. (2005) Angiopoietin-related growth factor antagonizes obesity and insulin resistance. Nat. Med. 11: 400-408.

31. Sutton, G.M., Trevaskis, J.L., Hulver, M.W., MacMillan, R.P., Markward, N.J., Meyer, E.A., Babin, M.J. & Butler, A.A. (2006) Diet-Genotype Interactions in the Development of the Obese, Insulin Resistant Phenotype of C57BL/6J mice lacking Melanocortin-3 or -4 Receptors. Endocrinology 147: 2183-2196.

32. Albarado, D.C., McClaine, J., Stephens, J.M., Mynatt, R.L., Ye, J., Bannon, A.W., Richards, W.G. & Butler, A.A. (2004) Impaired coordination of nutrient intake and substrate oxidation in melanocortin-4 receptor knockout mice. Endocrinology 145: 243-252.

33. Browning, J.D. & Horton, J.D. (2004) Molecular mediators of hepatic steatosis and liver injury. J. Clin. Invest. 114: 147-152.

34. Sparks, L.M., Xie, H., Koza, R.A., Mynatt, R., Hulver, M.W., Bray, G.A. & Smith, S.R. (2005) A high-fat diet coordinately downregulates genes required for mitochondrial oxidative phosphorylation in skeletal muscle. Diabetes 54: 1926-1933.

35. Teran-Garcia, M., Rankinen, T., Koza, R.A., Rao, D.C. & Bouchard, C. (2005) Endurance training-induced changes in insulin sensitivity and gene expression. Am. J. Physiol. Endocrinol. Metab. 288: E1168-1178.

36. Koza, R.A., Nikonova, L., Hogan, J., Rim, J.S., Mendoza, T., Faulk, C., Skaf, J. & Kozak, L.P. (2006) Changes in gene expression foreshadow diet-induced obesity in genetically identical mice. PLoS Genet. 2: e81.

37. Clark, H.F., Gurney, A.L., Abaya, E., Baker, K., Baldwin, D., Brush, J., Chen, J., Chow, B., Chui, C. et al. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 13: 2265-2270.

38. Kay, M.A., Glorioso, J.C. & Naldini, L. (2001) Viral vectors for gene therapy: the art of turning infectious agents into vehicles of therapeutics. Nat. Med. 7: 33-40.

39. Chen, G., Koyama, K., Yuan, X., Lee, Y., Zhou, Y.T., O'Doherty, R., Newgard, C.B. & Unger, R.H. (1996) Disappearance of body fat in normal rats induced by adenovirus-mediated leptin gene therapy. Proc. Natl. Acad. Sci. USA 93: 14795-14799.

40. Satoh, H., Nguyen, M.T., Trujillo, M., Imamura, T., Usui, I., Scherer, P.E. & Olefsky, J.M. (2005) Adenovirus-mediated adiponectin expression augments skeletal muscle insulin sensitivity in male Wistar rats. Diabetes 54: 1304-1313.

41. Satoh, H., Nguyen, M.T., Miles, P.D., Imamura, T., Usui, I. & Olefsky, J.M. (2004) Adenovirus-mediated chronic "hyper-resistinemia" leads to in vivo insulin resistance in normal rats. J. Clin. Invest. 114: 224-231.

42. Xu, A., Wang, Y., Keshaw, H., Xu, L.Y., Lam, K.S. & Cooper, G.J. (2003) The fat-derived hormone adiponectin alleviates alcoholic and nonalcoholic fatty liver diseases in mice. J. Clin. Invest. 112: 91-100.

43. Yamauchi, T., Kamon, J., Minokoshi, Y., Ito, Y., Waki, H., Uchida, S., Yamashita, S., Noda, M., Kita, S. et al. (2002) Adiponectin stimulates glucose utilization and fatty-acid oxidation by activating AMP-activated protein kinase. Nat. Med. 8: 1288-1295.

44. George, S., Rochford, J.J., Wolfrum, C., Gray, S.L., Schinner, S., Wilson, J.C, Soos, M.A., Murgatroyd, P.R., Williams, R.M. et al. (2004) A family with severe insulin resistance and diabetes due to a mutation in AKT2. Science 304: 1325-1328.

45. Bae, S.S., Cho, H., Mu, J. & Birnbaum, M.J. (2003) Isoform-specific regulation of insulin-dependent glucose uptake by Akt/protein kinase B. J. Biol. Chem. 278: 49530-49536.

46. Trevaskis, J.L. & Butler, A.A. (2005) Double leptin (Lepob) and melanocortin-4 receptor (Mc4r) gene mutations have an additive effect on fat mass, and are associated with reduced effects of leptin on weight loss and food intake. Endocrinology 146: 4257-4265.

47. Clegg, D.J., Brown, L.M., Woods, S.C. & Benoit, S.C. (2006) Gonadal hormones determine sensitivity to central leptin and insulin. Diabetes 55: 978-987.

48. Clegg, D.J., Riedy, C.A., Smith, K.A., Benoit, S.C. & Woods, S.C. (2003) Differential sensitivity to central leptin and insulin in male and female rats. Diabetes 52: 682-687.

49. Butler, A.A., Blakesley, V.A., Koval, A., deJong, R., Groffen, J. & LeRoith, D. (1997) In vivo regulation of CrkII and CrkL proto-oncogenes in the uterus by insulin-like growth factor-I. Differential effects on tyrosine phosphorylation and association with paxillin. J. Biol. Chem. 272: 27660-27664.

50. Butler, A.A. (2006) The melanocortin system and energy balance. Peptides 27: 301-309.

51. Aizawa-Abe, M., Ogawa, Y., Masuzaki, H., Ebihara, K., Satoh, N., Iwai, H., Matsuoka, N., Hayashi, T., Hosoda, K. et al. (2000) Pathophysiological role of leptin in obesity-related hypertension. J. Clin. Invest. 105: 1243-1252.

52. Ogawa, Y., Masuzaki, H., Hosoda, K., Aizawa-Abe, M., Suga, J., Suda, M., Ebihara, K., Iwai, H., Matsuoka, N. et al. (1999) Increased glucose metabolism and insulin sensitivity in transgenic skinny mice overexpressing leptin. Diabetes 48: 1822-1829.

53. Combs, T.P., Pajvani, U.B., Berg, A.H., Lin, Y., Jelicks, L.A., Laplante, M., Nawrocki, A.R., Rajala, M.W., Parlow, A.F. et al. (2004) A transgenic mouse with a deletion in the collagenous domain of adiponectin displays elevated circulating adiponectin and improved insulin sensitivity. Endocrinology 145: 367-383.

54. Yamauchi, T., Kamon, J., Waki, H., Imai, Y., Shimozawa, N., Hioki, K., Uchida, S., Ito, Y., Takakuwa, K. et al. (2003) Globular adiponectin protected ob/ob mice from diabetes and ApoE-deficient mice from atherosclerosis. J. Biol. Chem. 278: 2461-2468.

55. Collins, S., Martin, T.L., Surwit, R.S. & Robidoux, J. (2004) Genetic vulnerability to diet-induced obesity in the C57BL/6J mouse: physiological and molecular characteristics. Physiol. Behav. 81: 243-248.

56. Bates, S.H., Kulkarni, R.N., Seifert, M. & Myers, M.G., Jr. (2005) Roles for leptin receptor/STAT3-dependent and -independent signals in the regulation of glucose homeostasis. Cell Metab. 1: 169-178.

57. Shimomura, I., Bashmakov, Y. & Horton, J.D. (1999) Increased levels of nuclear SREBP-lc associated with fatty livers in two mouse models of diabetes mellitus. J. Biol. Chem. 274: 30028-30032.

58. Masuzaki, H., Ogawa, Y., Aizawa-Abe, M., Hosoda, K., Suga, J., Ebihara, K., Satoh, N., Iwai, H., Inoue, G. et al. (1999) Glucose metabolism and insulin sensitivity in transgenic mice overexpressing leptin with lethal yellow agouti mutation: usefulness of leptin for the treatment of obesity-associated diabetes. Diabetes 48: 1615-1622.

59. Heisler, L.K., Jobst, E.E., Sutton, G.M., Zhou, L., Borok, E., Thornton-Jones, Z., Liu, H.Y., Zigman, J.M., Balthasar, N. et al. (2006) Serotonin Reciprocally Regulates Melanocortin Neurons to Modulate Food Intake. Neuron 51(2): 239-249.

60. Butler, A.A., Kesterson, R.A., Khong, K., Cullen, M.J., Pelleymounter, M.A., Dekoning, J., Baetscher, M. & Cone, R.D. (2000) A unique metabolic syndrome causes obesity in the melanocortin-3 receptor-deficient mouse. Endocrinology 141: 3518-3521.

Полные описания всех ссылок, цитируемых в этой спецификации, таким образом, включены в качестве ссылки. Кроме того, в случае другого непримиримого конфликта руководством должна служить настоящая спецификация.

1. Фармацевтическая композиция, содержащая пептид Enhol или его функциональный фрагмент, функциональный гомолог или функциональный структурный аналог с консервативными аминокислотными заменами, и фармацевтически приемлемый носитель для лечения и профилактики патофизиологического состояния, связанного с повышенной массой тела, где указанный пептид Enhol или его функциональный фрагмент, функциональный гомолог или функциональный структурный аналог с консервативными аминокислотными заменами имеет следующие характеристики:
а. является, по существу, гомогенным препаратом; и
b. по меньшей мере на 70% гомологичен любой из последовательностей SEQ ID N0: 2, 10, 11, 12-18; и
с. модулирует энергетический метаболизм, липидный обмен и/или действие инсулина; и
d. является пептидом млекопитающего, мыши, человека или синтетическим пептидом.

2. Способ лечения патофизиологического состояния, относящегося к гомеостазу массы тела, включающий введение индивидууму терапевтически эффективного количества фармацевтической композиции, содержащей пептид Enhol или его функциональный фрагмент, функциональный гомолог или функциональный структурный аналог с консервативными аминокислотными заменами, где указанный пептид Enhol или его функциональный фрагмент, функциональный гомолог или функциональный структурный аналог с консервативными аминокислотными заменами имеет следующие характеристики:
а. является, по существу, гомогенным препаратом; и
b. по меньшей мере на 70% гомологичен любой из последовательностей SEQ ID N0: 2, 10, 11, 12-18; и
с. модулирует энергетический метаболизм, липидный обмен и/или действие инсулина; и
d. является пептидом млекопитающего, мыши, человека или синтетическим пептидом.

3. Способ профилактики патофизиологического состояния, относящегося к гомеостазу массы тела, включающий введение индивидууму терапевтически эффективного количества фармацевтической композиции, содержащей пептид Enhol или его функциональный фрагмент, функциональный гомолог или функциональный структурный аналог с консервативными аминокислотными заменами, где указанный пептид Enhol или его функциональный фрагмент, функциональный гомолог или функциональный структурный аналог с консервативными аминокислотными заменами имеет следующие характеристики:
а. является, по существу, гомогенным препаратом; и
b. по меньшей мере на 70% гомологичен любой из последовательностей SEQ ID N0: 2, 10, 11, 12-18; и
с. модулирует энергетический метаболизм, липидный обмен и/или действие инсулина; и
d. является пептидом млекопитающего, мыши, человека или синтетическим пептидом.

4. Способ по любому из пп.2 или 3, где патофизиологическим состоянием является ожирение.

5. Способ по любому из пп.2 или 3, дополнительно включающий введение индивидууму соединения, выбранного из группы, состоящей из лептина и адипонектина.

6. Способ по любому из пп.2 или 3, где патофизиологическим состоянием является патофизиологическое состояние, связанное с ожирением, включая любое состояние, выбранное из гипергликемии, гиперинсулинемии, резистентности к инсулину, гиперлипидемии и сахарного диабета типа 2.

7. Способ по любому из пп.2 или 3, где стадия введения индивидууму включает интраперитонеальное введение.

8. Способ улучшения или снижения резистентности к инсулину у индивидуума, включающий введение индивидууму терапевтически эффективного количества пептида Enhol с последовательностью SEQ ID N0: 2 и 8-18 или его функционального фрагмента, функционального гомолога или функционального структурного аналога с консервативными аминокислотными заменами.

9. Способ облегчения или лечения симптомов диабета у индивидуума, включающий введение индивидууму терапевтически эффективного количества пептида Enhol с последовательностью SEQ ID N0: 2 и 8-18 или его функционального фрагмента, функционального гомолога или функционального структурного аналога с консервативными аминокислотными заменами.

10. Способ предотвращения или задержки начала ожирения у индивидуума, включающий введение индивидууму терапевтически эффективного количества пептида Enhol с последовательностью SEQ ID N0: 2 и 8-18 или его функционального фрагмента, функционального гомолога или функционального структурного аналога с консервативными аминокислотными заменами.

11. Способ облегчения или снижения гиперлипидемии у индивидуума, включающий введение индивидууму терапевтически эффективного количества пептида Enhol с последовательностью SEQ ID N0: 2 и 8-18 или его функционального фрагмента, функционального гомолога или функционального структурного аналога с консервативными аминокислотными заменами.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к получению антигенных пептидов, и может быть использовано в медицине. .

Изобретение относится к новым пептидным соединениям и их применению в способах диагностической оптической визуализации. .

Изобретение относится к области биотехнологии, конкретно к получению гемопоэтических клеток из крови, и может быть использовано в медицине. .

Изобретение относится к области биотехнологии и может быть использовано в диагностике рака предстательной железы, а также в дифференциальной диагностике между раком предстательной железы и доброкачественной гиперплазии.

Изобретение относится к медицине, а именно к иммунологии. .
Изобретение относится к способу получения железосодержащего сукцинилированного казеина, включающий стадии: а) реакция казеина, по меньшей мере, с одним сукцинилирующим агентом с образованием водной суспензии сукцинилированного казеина, причем стадия (а) включает стадии: (а1) суспендирование казеина в воде; (а2) при необходимости, доведение рН водной суспензии по меньшей мере до 6; (а3) добавление, по меньшей мере, одного сукцинилирующего агента при поддержании рН, по меньшей мере, 6 посредством добавления, по меньшей мере, одного основания; (а4) осаждение полученного сукцинилированного казеина после добавления сукцинилирующего агента путем доведения рН до приблизительно от 2 до 7,0 для получения водной суспензии сукцинилированного казеина, имеющей рН приблизительно от 2 до 7,0, b) реакция водной суспензии сукцинилированного казеина, полученного на стадии (а), с, по меньшей мере, одной солью железа с образованием железосодержащего сукцинилированного казеина, причем стадия (b) включает добавление, по меньшей мере, одной соли железа к водной суспензии сукцинилированного казеина при поддержании рН казеина равным, по меньшей мере, 2 посредством добавления, по меньшей мере, одного основания для получения железосодержащего сукцинилированного казеина.

Изобретение относится к области иммунологии и касается модуляторов гликопротеинового лиганда 1 Р-селектина. .
Изобретение относится к косметическому средству, предназначенному для повышения эластичности кожи и содержащему активный ингредиент и носитель, где активный ингредиент содержит комплекс, который включает теломерную последовательность ДНК и связанный с ней пептид, имеющий сигнал ядерной локализации, и который способен проникать через плазматическую мембрану клетки.
Изобретение относится к медицине и касается вагинальных суппозиториев, содержащих композицию рекомбинантных белков, состоящую из аминокислотных последовательностей белка Е7 вируса папилломы человека 16 и 18 типов соответственно, которые ковалентно соединены с аминокислотной последовательностью белка теплового шока м.м.
Изобретение относится к медицине, а именно к неонатологии, и может быть использовано для профилактики сепсиса у новорожденных. .
Изобретение относится к медицине, офтальмологии и может быть использовано для лечения атрофии зрительного нерва у детей в возрасте от 1 до 6 месяцев. .

Изобретение относится к лекарственным средствам и касается применения антагониста рецептора СВ1, представляющего собой N-пиперидино-5-(4-хлорфенил)-1-(2,4-дихлорфенил)-4-метилпиразол-3-карбоксамид или одну из его фармацевтически приемлемых солей, при получении композиции для лечения печеночных фиброзов.
Изобретение относится к медицине, а именно к вертеброневрологии. .

Изобретение относится к области медицины и касается способов лечения заболеваний антагонистами VEGF
Наверх