Способ улучшения структуры и/или функций артериол

Изобретение относится к способу улучшения структуры и/или функций артериол у млекопитающих с патологией, которая характеризуется утолщенными стенками артериол в головном мозге или почках, включающий введение указанному млекопитающему пептида с аминокислотной последовательностью D-W-F-K-A-F-Y-D-K-V-A-E-K-F-K-E-A-F (SEQ ID №5) или обратную последовательность F-A-E-K-F-K-E-A-V-K-D-Y-F-A-K-F-W-D (SEQ ID №444), в дозах, достаточных для улучшения структуры и функции артериол. Изобретение обеспечивает улучшение структуры и/или функций артериол и сохранение функций жизненно важных органов-мишеней, таких как мозг и почки. 19 з.п. ф-лы, 29 ил.

 

Данная работа была частично поддержана грантом № HL30568 Национального института сердца, крови и легких Национальных институтов здравоохранения. Правительство Соединенных Штатов Америки может иметь определенные права на данное изобретение.

Область техники, к которой относится изобретение

Настоящее изобретение относится к области сосудистой медицины. В особенности, настоящее изобретение относится к новым способам улучшения структуры и функций артериол и, таким образом, к уменьшению патологий, связанных с нарушением кровообращения.

Уровень техники

В данном контексте артериолы представляют собой кровеносные сосуды в системе артериального кровообращения (не путать с венозным кровообращением), диаметр которых (после фиксации перфузией или in vivo) <200 мкм. В настоящее время существует обширная литература, описывающая изменения в артериолах, связанные с гипертонией, старением, субарахноидальным кровоизлиянием, многоочаговой деменцией, болезнью Альцгеймера и хроническими заболеваниями почек, а также с другими состояниями. Из этой литературы следует, что самые разнообразные патологические состояния могут приводить к утолщению указанных артериол, что, в свою очередь, сопровождается ослаблением нормальной сосудистой активности.

Нормальной реакцией на снижение кровяного давления является расширение кровеносных сосудов, что уменьшает сопротивление потоку крови и позволяет поддерживать нормальный кровоток. Неспособность артериол расширяться несмотря на снижение кровяного давления может привести к уменьшению притока крови к целевому органу. Если целевым органом является мозг, то снижение кровотока может привести к инфаркту области, обеспечиваемой артериолами.

Так как артериолы очень малы, они обычно снабжают маленькую область мозга, и потому связанный с ними инфаркт будет невелик. Он может, вообще, восприниматься как провал в памяти. Однако, по мнению авторов изобретения, накопление серии таких инсультов может со временем привести к значительным повреждениям органов.

Основные способы профилактики таких повреждений органов включают контроль за кровяным давлением, а также за содержанием в плазме глюкозы и липидов. Известно, что некоторые агенты (такие как статины) позволяют улучшить структуру и функцию маленьких и больших артерий; это связывают со способностью таких агентов уменьшать содержание холестерина и снижать инфильтрацию в артерии воспалительных клеток (см., например, Schonbeck et al. (2004) Circulation 109 (21 Suppl 1): 1118-26).

Раскрытие изобретения

Настоящее изобретение относится к неожиданному открытию, согласно которому кровеносные сосуды, размер которых меньше размера самых маленьких артерий (то есть артериолы), способны утолщаться, утрачивать свою функцию и вызывать повреждения тканей в таких непохожих друг на друга органах, как мозг и почки. Настоящее изобретение направлено на способ улучшения структуры и функции артериол и сохранение функций органов-мишеней, таких как мозг и почки.

Таким образом, в соответствии с некоторыми направлениями реализации изобретение относится к способам улучшения структуры и/или функции артериол. Способы, в целом, включают введение нуждающемуся в таком лечении млекопитающему одного или более активных агентов, описанных здесь в целом, в дозе, достаточной для улучшения структуры или функции артериол. В соответствии с различными аспектами изобретения артериола представляет собой артериолу в почке, и/или мозгу, и/или в альвеолах. Млекопитающее может быть представлено человеком, например пациентом, нуждающимся в таком терапевтическом или профилактическом лечении, или животным. Таким образом, рассматриваются как медицинские, так и ветеринарные возможности применения заявки. В соответствии с различными аспектами изобретения млекопитающее может быть представлено человеком с диагностированной потерей памяти, нарушением обучаемости и/или нарушением функции почек и/или нарушением альвеолярной функции (функции легких). В соответствии с некоторыми аспектами изобретения млекопитающее может быть представлено человеком, которому не поставлен диагноз атеросклероза, и/или похожих патологий и который не находится в группе риска этих заболеваний, и/или которого не лечат от атеросклероза и похожих патологий. В соответствии с различными аспектами изобретения доза активного ингредиента (например, пептида, и/или пептидомиметика, и/или липида) представлена в виде дозированной формы. В соответствии с различными аспектами изобретения активный агент (агенты) подготовлен для введения путем, выбранным из группы, включающей пероральное, назальное, ректальное введение, внутрибрюшинные и внутрисосудистые инъекции, подкожное, чрескожное и внутримышечное введение. В соответствии с различными аспектами изобретения способ введения выбран из группы, включающей пероральное, назальное, ректальное введение, внутрибрюшинные и внутрисосудистые инъекции, подкожное, чрескожное и внутримышечное введение. В соответствии с некоторыми аспектами активный агент (агенты) выбран из группы, включающей D4F, L4F, обратный D4F, обратный L4F, D4F с кольцевой перестановкой, L4F с кольцевой перестановкой, обратный D4F с кольцевой перестановкой, обратный L4F с кольцевой перестановкой, а также DMPC (1,2-димиристоил-sn-глицеро-3-фосфохолин). В соответствии с различными аспектами изобретения активный агент (агенты) вводят совместно с фармацевтически приемлемыми наполнителями.

Некоторые аспекты настоящего изобретения относятся также к применению активного агента, описанного здесь, для профилактики и лечения нарушения структуры и функций артериол. Это также относится и к применению описанного здесь активного агента для изготовления лекарственных средств, используемых для профилактики и лечения нарушения структуры и функций артериол.

Настоящее изобретение относится также к наборам для лечения состояния, характеризующегося ненормальной структурой или функцией артериол. Обычно, такие наборы включают по меньшей мере один контейнер, содержащий описанные здесь активные агенты, а также инструкции по применению активных агентов для лечения состояний, характеризующихся ненормальной структурой или функцией артериол. В соответствии с различными аспектами изобретения активный агент (например, пептид, и/или пептидомиметик, и/или липид) представлен в виде дозированной единицы. В соответствии с различными аспектами изобретения активный агент (агенты) составлен для введения по пути, выбранному из группы, включающей пероральное, назальное, ректальное введение, внутрибрюшинные и внутрисосудистые инъекции, подкожное, чрескожное и внутримышечное введение. В соответствии с некоторыми аспектами активный агент (агенты) выбран из группы, включающей D4F, L4F, обратный D4F, обратный L4F, D4F с кольцевой перестановкой (кольцевой D4F), L4F с кольцевой перестановкой (кольцевой L4F), обратный D4F с кольцевой перестановкой (обратный кольцевой D4F), обратный L4F с кольцевой перестановкой (обратный кольцевой L4F), а также DMPC. В соответствии с различными аспектами изобретения активный агент (агенты) вводят совместно с фармацевтически приемлемыми наполнителями.

Определения

Термин "выделенный", "очищенный" или "биологически чистый" в отношении выделенного полипептида означает вещество, в основном или в значительной степени отделенное от компонентов, которые в обычных условиях сопровождают его в естественном состоянии. Применительно к нуклеиновым кислотам и/или полипептидам термин может означать нуклеиновые кислоты или полипептиды, не ограниченные по концам последовательностями, которые обычно прикреплены к ним. Химически синтезированные полипептиды являются "выделенными", поскольку они не найдены в естественном состоянии (например, в крови, сыворотке и т.д.). В соответствии с некоторыми аспектами термин "выделенный" показывает, что полипептид не встречается в природе.

Термины "полипептид", "пептид" и "протеин" здесь используются взаимозаменяемо и означают полимер из аминокислотных остатков. Термины применимы к аминокислотным полимерам, в которых по меньшей мере один аминокислотный остаток представляет собой искусственный химический аналог соответствующих природных аминокислот, а также к аминокислотным полимерам, которые встречаются в естественных условиях.

Термин "амфипатический спиральный пептид" означает пептид, содержащий по меньшей мере одну амфипатическую спираль (амфипатический спиральный домен). Некоторые амфипатические спиральные пептиды настоящего изобретения могут содержать две или более (например, 3, 4, 5 и т.д.) амфипатические спирали.

Термин "амфипатическая спираль класса А" означает белковую структуру, образующую α-спираль с разделением полярных и неполярных поверхностей с положительно заряженными остатками, находящимися на полярной-неполярной границе раздела, и с отрицательно заряженными остатками, находящимися в центре полярных поверхностей (см., например, Segrest et at. (1990) Proteins: Structure, Function, and Genetics 8: 103-117).

"Аполипопротеин J" (apo-J) встречается также и под другими названиями, включая кластерин, TRPM2, GP80 и SP 40,40 (Fritz (1995) Рр 112 In: Clusterin: Role in Vertebrate Development, Function, and Adaptation (Harmony JAK Ed.), R.G. Landes, Georgetown, TX). Впервые он был описан как гетеродимерный гликопротеин и компонент белков, секретируемых культуральными клетками Sertoli крыс (Kissinger et al. (1982) Biol Reprod; 27: 233240). Преобразованный продукт представляет собой одноцепочечный предшественник протеина, который подвергается внутриклеточному расщеплению в 34 кДа α-субъединицу и 47 кДа α-субъединицу, которые связаны дисульфидными мостиками (Collard and Griswold (187) Biochem., 26: 3297-3303). Это связано с повреждениями клеток, липидным транспортом и апоптозом и может принимать участие в удалении продуктов распада, образовавшихся в результате повреждений или гибели клеток. Показано, что кластерин имеет высокое сродство для связывания с разнообразными молекулами, включая липиды, пептиды, протеины, а также гидрофобный зонд 1-анилино-8-нафталинсульфонат (Bailey et al. (2001) Biochem., 40: 11828-11840).

Амфипатическая спираль класса G обнаружена в глобулярных протеинах, отсюда и название класса (G = globular, глобулярный). Признаком данного класса амфипатических цепей является случайное распределение положительно и отрицательно заряженных остатков на полярной поверхности, а также узкая неполярная грань. Вследствие узости неполярной поверхности представители этого класса с трудом связываются с фосфолипидами (см., например, Segrest et al. (1990) Proteins: Structure, Function, and Genetics. 8: 103-117; а также Erratum (1991) Proteins: Structure, Function and Genetics, 9: 79). Существует несколько взаимозаменяемых аполипопротеинов, обладающих похожими, но не идентичными характеристиками с G-амфипатической спиралью. Подобно G-амфипатической спирали представители указанного класса характеризуются случайным распределением положительно и отрицательно заряженных остатков на полярной поверхности. Однако в отличие от G-амфипатической спирали с узкой неполярной поверхностью, представители этого класса характеризуется более широкой неполярной поверхностью, что позволяет им легко связывать фосфолипиды, и для обозначения данного отличия этот класс называют G* (см. Segrest et al. (1992) J. Lipid Res., 33: 141-166; а также Anantharamaiah et al. (1993) Pp.109-142 In: The Amphipathic Helix, Epand, R.M. Ed CRC Press, Boca Raton, Florida). В работе Jones et al. (1992) J. Lipid Res. 33: 287-296 описаны компьютерные программы для идентификации и классификации амфипатических спиральных доменов. Эти программы включают, но не ограничиваются программами спирального колеса (WHEEL или WHEEL/SNORKEL), спиральными сетевыми программами (HELNET, HELNET/SNORKEL, HELNET/Angle), программами по присоединению спиральных колес (COMBO или COMBO/SNORKEL), программами для присоединения спиральных сетей (COMNET, COMNET/SNORKEL, COMBO/SELECT, COMBO/NET), консенсусными программами колес (CONSENSUS, CONSENSUS/SNORKEL) и им подобными.

Термин "улучшение" применительно к фразе "улучшение одного или нескольких симптомов атеросклероза" означает ослабление, предотвращение или устранение одного или нескольких симптомов, характеризующих атеросклероз и/или связанные с ним патологии. Такое ослабление включает, без ограничения указанным, устранение или снижение содержания окисленных фосфолипидов, снижение интенсивности образования и отрыва атеросклеротических бляшек, уменьшение числа таких клинических случаев, как сердечные приступы, ангина или инсульты, уменьшение гипертонии, уменьшение биосинтеза воспалительных белков, снижение содержания холестерина в плазме и т.д.

Термин "энантиомерные аминокислоты" означает аминокислоты, способные существовать по меньшей мере в двух формах, являющихся зеркальными отражениями друг друга. Большинство аминокислот (кроме глицина) являются энантиомерными и могут существовать в так называемой L-форме (L аминокислоты) и D-форме (D-аминокислоты). Большинство природных аминокислот является L-аминокислотами. Термины "L-аминокислоты" и "D-аминокислоты" применяют для обозначения абсолютных конфигураций аминокислот, а не конкретного направления вращения плоскости поляризованного света. Эти определения соответствуют терминам, распространенным среди компетентных специалистов в данной области. В настоящей заявке аминокислоты обозначают с использованием стандартных однобуквенных или трехбуквенных кодов, например, приведенных в стандарте Standard ST.25 руководства Handbook On Industrial Property Information and Documentation.

Термин "защитная группа" означает химическую группу, которая, связываясь с функциональной группой аминокислоты (например, с боковой цепочкой, альфа-аминогруппой, альфа-карбоксильной группой и т.д.) блокирует или маскирует свойства этой группы. Предпочтительные амино-терминальные защитные группы включают, без ограничения указанным, ацетильные или аминогруппы. Другие амино-терминальные защитные группы включают, без ограничения указанным, алкильные цепи, как в жирных кислотах, пропионил, формил и другие. Предпочтительные карбоксильные терминальные защитные группы включают, без ограничения указанным, группы, образующие амиды или эфиры.

Фраза "защитить фосфолипид от окисления окисляющим агентом" означает способность соединения уменьшить скорость окисления фосфолипида (или количество образующегося окисленного фосфолипида), если фосфолипид взаимодействует с окислителем (например, с перекисью водорода, 13-(S)-HPODE, 15-(S)-HPETE, HPODE, HPETE, HODE, НЕТЕ и т.д.).

Термин "липопротеины низкой плотности", или ЛПНП (LDL) следует интерпретировать так, как принято среди компетентных специалистов в данной области. В целом, LDL означает комплекс протеина и липидов, который при выделении методом ультрацентрифугирования обнаруживается во фракции с плотностью от 1,019 до 1,063.

Термин "липопротеины высокой плотности", или ЛПВП (HDL) следует интерпретировать так, как принято среди компетентных специалистов в данной области. В целом, HDL означает комплекс протеина и липидов, который при выделении методом ультрацентрифугирования обнаруживается во фракции с плотностью от 1,063 до 1,21.

Термин "HDL группы I" (ЛПВП группы I) означает липопротеины высокой плотности или их компоненты (например, A-I, параоксоназу, ацетилгидролазу фактора активации тромбоцитов и т.д.), которые уменьшают количество окисленных липидов, то есть липопротеинов низкой плотности) или которые защищают окисляемые липиды от окисления окисляющими агентами.

Термин "HDL группы II" (ЛПВП группы II) означает такие HDL, которые проявляют незначительную активность (или не проявляют активности) по защите липидов от окисления или по "починке" (например, восстановлению) окисленных липидов.

Термин "компонент HDL" означает компонент (например, молекулы), включающий в себя липопротеины высокой плотности. Анализ на наличие HDL, защищающих липиды от окисления или исправляющих (например, восстанавливающих) окисленные липиды, включает в себя также и анализ на наличие компонентов HDL (например, апоА-I, параоксоназу, ацетилгидролазу фактора активации тромбоцитов и т.д.), которые проявляют такую активность.

Термин "человеческий пептид апоА-I (ароА-I)" означает человеческий пептид апоА-I полной длины или его фрагмент или домен, который содержит амфипатическую спираль класса А.

"Реакция моноцитов" здесь означает моноцитарную активность, характеризующую воспалительный ответ, который связан с образованием атеросклеротических бляшек. Реакцию моноцитов характеризуют адгезией моноцитов к клеткам сосудистой стенки (например, к клеткам сосудистого эндотелия) и/или хемотаксис в субэндотелиальное пространство и/или дифференциацию моноцитов в макрофаги.

Термин "отсутствие изменений" при использовании в связи с количеством окисленных фосфолипидов означает отсутствие детектируемых изменений, предпочтительно, отсутствие статистически значимых изменений (например, доверительный интервал, по меньшей мере 85%, предпочтительно, по меньшей мере 90%, более предпочтительно, по меньшей мере 95%, наиболее предпочтительно, по меньшей мере 98% или 99%). Термин может применяться также к анализам, в которых обнаружено, что содержание окисленных фосфолипидов изменяется, но не так сильно, как в отсутствие описанных здесь протеинов, или по сравнению с другими положительными или отрицательными контролями.

Далее будут использованы следующие сокращения: РАРС: L-α-1-пальмитоил-2-арахидоноил-sn-глицеро-3-фосфохолин; POVPC: 1-пальмитоил-2-(5-оксовалерил)-sn-глицеро-3-фосфохолин; PGPC: 1-пальмитоил-2-глутарил-sn-глицеро-3-фосфохолин; PEIPC: 1-пальмитоил-2-(5,6-эпоксиизопростан Е2)-sn-глицеро-3-фосфохолин; ChC18:2: холестериллинолеат; ChC18:2-OOH: холестериллинолеат гидропероксид; DMPC: 1,2-дитетрадеканоил-рац-глицерол-3-фосфохолин; PON: параоксоназа; HPF: стандартизированное поле высокой энергии; РАРС: L-α-1-пальмитоил-2-арахидоноил-sn-глицеро-3-фосфохолин; BL/6: C57BL/6J; C3H:C3H/HeJ.

Термин "консервативная замена" применительно к протеинам или пептидам соответствует аминокислотным заменам, которые несущественно изменяют активность (специфичность (например, для липопротеинов) или сродство связывания (например, для липидов или липопротеинов)) молекулы. Как правило, консервативные аминокислотные замены предполагают замену одного аминокислотного остатка другим аминокислотным остатком с такими же химическими свойствами (например, заряд или гидрофобность). Каждая из следующих шести групп содержит аминокислоты, которые, как правило, являются примерами консервативных замен друг для друга: 1) Аланин (А), серин (S), треонин (Т); 2) аспарагиновая кислота (D), глутаминовая кислота (Е); 3) аспарагин (N), глутамин (Q); 4) аргинин (R), лизин (К); 5) изолейцин (I), лейцин (L); 6) фенилаланин (F), тирозин (Y), триптофан (W).

Термин "идентичный" или "идентичный на указанное число процентов" в контексте сравнения двух или более нуклеиновых кислот или полипептидных последовательностей означает две или более последовательности или подпоследовательности, которые одинаковые или обладают указанным процентом одинаковых аминокислотных остатков или нуклеотидов, если их сравнивают и выравнивают для достижения максимального соответствия по одному из следующих алгоритмов сравнения последовательностей или методом визуального контроля. В случае пептидов настоящего изобретения идентичность последовательностей определяется по полной длине пептида.

Как правило, при сравнении последовательностей одна последовательность играет роль последовательности сравнения, с которой сравнивают тестируемые последовательности. В соответствии с алгоритмом сравнения последовательностей тестовую последовательность и последовательность сравнения вводят в компьютер и при необходимости задают координаты подпоследовательностей и параметры программы алгоритма сравнения последовательностей. Основываясь на введенных параметрах, программа реализации алгоритма сравнения вычисляет процент идентичности тестовой последовательности по отношению к последовательности сравнения.

Оптимальное выравнивание последовательностей для их сравнения можно выполнить, например, по алгоритму локальной гомологий (Smith & Waterman, Adv. Appl. Math. 2: 482 (1981)), по алгоритму выравнивания гомологии (Needleman &Wunsch, J. Mol. Biol. 48: 443 (1970)), по методу поиска сходства (Pearson & Lipman (1988) Proc. Natl. Acad. ScL USA 85: 2444), с использованием компьютеризованной реализации этих алгоритмов (GAP, BESTFIT, FASTA, и TFASTA программного пакета Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, W1), а также методом визуального контроля (см., в общем случае, работы Ausubel et al., supra).

Примером применимого алгоритма является PILEUP. Программа создает множественное выравнивание для группы родственных последовательностей с использованием прогрессивного, попарного выравнивания, при этом выводятся соотношения последовательностей и процент их идентичности. Программа выводит на экран также "дерево" или "дендрограмму", демонстрирующую отношения кластеризации, используемые для создания выравнивания. PILEUP использует в своей работе упрощенный метод прогрессивного выравнивания (Feng & Doolittle (1987) J. Mol. Evol. 35: 351-360). Это метод напоминает описанный в работе Higgins & Sharp (1989) CABIOS 5: 151-153. С ее помощью можно выровнять до 300 последовательностей длиной до 5000 нуклеотидов или аминокислот каждая. Процедура множественного выравнивания начинается с попарного выравнивания двух самых похожих последовательностей, в результате получают кластер двух выровненных последовательностей. Этот кластер затем выравнивают по отношению к следующей наиболее похожей последовательности или кластеру выровненных последовательностей. Для выравнивания двух кластеров последовательностей используют простое расширение метода попарного выравнивания двух индивидуальных последовательностей. Финальное выравнивание достигается серией прогрессивных попарных выравниваний. Для запуска программы необходимо указать конкретные последовательности и координаты аминокислот и нуклеотидов для областей сравнения, а также различные параметры. Например, для сравнения последовательности сравнения с другой тестовой последовательностью с целью определения отношения процентной идентичности последовательностей необходимо задать следующие параметры: вес пробела по умолчанию (3,00), вес длины пробела по умолчанию и взвешенные концы пробелов.

Другим примером алгоритма, применимого при определении процента идентичности последовательностей и их сходства, является алгоритм BLAST, описанный в работе Altschul et al. (1990) J. Mol. Biol. 215: 403-410. Программное обеспечение, необходимое для BLAST-анализа, доступно широкой общественности в Национальном центре биотехнологической информации (National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/)). Программа сначала находит высокоранговые пары последовательностей (HSP). Для этого в последовательности-запросе идентифицируются короткие слова длины W, которые при выравнивании со словом той же длины в последовательности из базы данных либо точно соответствуют ему, либо удовлетворяют некоторому пороговому значению Т. Т называют пороговым рангом слова соседа. Эти первоначальные слова-соседи затем используются как начальные данные для инициации поисков более длинных содержащих их HSP. Слова удлиняются вдоль каждой последовательности в обоих направлениях так долго, как только можно увеличивать кумулятивный ранг выравнивания. Для подсчета кумулятивных рангов используются (в случае нуклеотидных последовательностей) параметры М (подкрепляющий ранг для пары соответствующих остатков; всегда больше нуля) и N (штрафной ранг для пары несоответствующих остатков; всегда меньше нуля). В случае аминокислотных последовательностей для подсчета кумулятивного ранга используется матрица рангов. Удлинение слов в каждом направлении прекращается, в случае, если кумулятивный ранг опускается ниже максимального значения на величину X; в связи с накоплением одного или нескольких отрицательно ранжированных выравниваний остатков кумулятивный ранг опускается до нуля или ниже; при достижении конца одной из последовательностей. Параметры W, Т и Х алгоритма BLAST определяют чувствительность и скорость выравнивания. Для нуклеотидных последовательностей программа по умолчанию использует длину слова (W), равную 11, ожидание (Е) 10, М=5, N=4, и сравниваются обе цепочки. Для аминокислотных последовательностей длина слова W по умолчанию равна 3, ожидание (Е) 10, а также используется матрица ранжирования BLOSUM62 (см. Henikoff & Henikoff (1989) Proc. Natl. Acad. ScL USA 89: 10915).

Помимо подсчета процента идентичности последовательностей, алгоритм BLAST производит также статистический анализ сходства двух последовательностей (см., например, Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA, 90: 5873-5787). Одной характеристикой сходства, выдаваемой указанным алгоритмом, является мельчайшая вероятность суммы (Р(N)), соответствующая вероятности случайного возникновения соответствия между двумя нуклеотидными или аминокислотными последовательностями. Например, нуклеотидная последовательность считается совпадающей с последовательностью сравнения, если мельчайшая вероятность суммы при сравнении тестовой последовательности с последовательностью сравнения меньше, чем, приблизительно, 0,1, более предпочтительно, если меньше, чем, приблизительно, 0,01, наиболее предпочтительно, если меньше, чем, приблизительно, 0,001.

"Кольцевой протеин" - это такой белок, естественные/природные концы которого соединены друг с другом, и образовавшийся кольцевой протеин открыт в какой-либо другой точке для создания новых С- и N-концов. Кольцевые протеины нельзя создать фактическим соединением концов и созданием открытого участка в другом месте, их синтезируют/экспрессируют de novo с помощью последовательности, идентичной соответствующему кольцевому варианту. Два протеина считаются связанными кольцевой перестановкой (СР)), если фрагмент С-терминального участка первого протеина соответствует фрагменту N-терминального участка второго протеина, а фрагмент N-терминального участка первого протеина соответствует фрагменту С-терминального участка второго протеина. Специалисты, компетентные в данной области, знают методы идентификации кольцевых перестановок (см., например, Uliel et al. (1999) Bioinfonnatics, 15(11): 930-936).

Краткое описание чертежей

На фигурах 1А, 1В и 1C показано, что мышь, у которой отсутствуют рецепторы LDL (LDLR-/-), имеет артериолы мозга с более толстыми стенками, по сравнению с мышью дикого типа (WT). Фигура 1А: толщина стенок маленьких артериол (диаметром 15-40 мкм); Фигура 1В: толщина стенок средних артериол (диаметром 41-80 мкм); Фигура 1C: толщина стенок больших артериол (диаметром 81-160 мкм).

На фигуре 2 показаны результаты непрерывного выполнения задачи, требующей выбора альтернативного решения в Т-образном лабиринте (Т-САТ) для мышей LDR-/- на Западной диете, которым давали D4F и "искаженный" D4F ("искаженный" пептид - означает здесь пептид, который состоит из остатков встречающегося в природе пептида или его функционального производного, в котором изменен порядок следования аминокислотных остатков).

На фигуре 3 показаны результаты непрерывного выполнения задачи, требующей выбора альтернативного решения в Т-образном лабиринте (Т-САТ) для мышей LDR-/- на Западной диете, которым давали D4F и "искаженный" D4F (sc D-4F), выраженные в виде процента изменения.

Фигура 4 иллюстрирует улучшение выполнения задачи в Т-образном лабиринте под действием D4F.

На фигуре 5 показано, что пероральное введение DMPC улучшает вазореактивность сосудов у мышей с отсутствующими рецепторами LDL на Западной диете.

На фигурах 6А-6С показано, что толщина стенок артериол мозга (измеренных на секциях Н&Е) увеличена у мышей с отсутствующими рецепторами LDL с обедненным питанием (n=4) по сравнению с мышами дикого типа (n=4), и еще больше увеличивается при переводе мышей на Западную диету (n=4). На фигуре 6А показана толщина стенок артериол с просветом 15-40 мкм диаметром. На фигуре 6В показана толщина стенок артериол с просветом 41-80 мкм диаметром. На фигуре 6С показана толщина стенок артериол с просветом 81-160 мкм диаметром. На гистограмме представлены данные по среднему ± SEM. WT, мышь дикого типа; LDL-/- Chow, мышь с отсутствующими LDL-рецепторами на обедненной диете; LDL-/- Western, мышь с отсутствующими LDL-рецепторами на Западной диете через 6 недель.

На фигурах 7A-7G показано, что толщина стенок артериол мозга (измеренных на секциях Н&Е) уменьшена у мышей с отсутствующими рецепторами LDL, которым давали D-4F, но не "искаженный" D-4F. Мышей с отсутствующими рецепторами LDL 6 недель держали на Западной диете, после чего они получили 300 мкг/мл D-4F в питьевой воде (n=15) или 300 мкг/мл "искаженного" D-4F в питьевой воде (n=15). На фигуре 7А показана толщина стенок артериол с просветом 10-20 мкм диаметром. На фигуре 7В показана толщина стенок артериол с просветом 21-50 мкм диаметром. На фигуре 7С показана толщина стенок артериол с просветом 51-100 мкм диаметром. На фигуре 7D показаны диаметры просветов артериол у мышей. На фигуре 7Е показано значение толщины стенок, поделенное на диаметр просвета для артериол диаметром 10-20 мкм. На фигуре 7F показано значение толщины стенок, поделенное на диаметр просвета для артериол диаметром 21-50 мкм. На фигуре 7G показано значение толщины стенок, деленное на диаметр просвета для артериол диаметром 51-100 мкм. На гистограмме представлено среднее значение ± SEM для 15 мышей в каждой группе.

Как показано на фигурах 8А-8Е, содержание α-актина гладкой мускулатуры артериол мозга увеличено у мышей с отсутствующими рецепторами LDL на Западной диете. Значение этого параметра снижается после лечения D-4F, но не "искаженным" D-4F. Фигура 8А: мышей с отсутствующими рецепторами LDL кормили обедненной пищей (n=10) или держали на Западной диете (n=10) в течение 6 недель, после чего артериолы их мозга были окрашены для определения α-актина гладкой мускулатуры, и для каждой артериолы определили отношение толщины стенки к диаметру просвета. Значения выражены как среднее значение ± SEM для 10 мышей в каждой группе. Фигуры 8В-8Е. Артериолы мозга мышей, описанных на фигуре 7 и Панели А этой фигуры, окрашены для определения ± -актина гладкой мускулатуры. Фигура 8В: Примеры артериол мозга, окрашенных для определения α-актина гладкой мускулатуры. Фигура 8С: отношение толщины стенки к диаметру просвета для артериол с просветом диаметром 10-20 мкм, взятых у мышей, фигура 7. Фигура 8D: отношение толщины стенки к диаметру просвета для артериол с просветом диаметром 21-50 мкм, взятых у мышей, фигура 7. Фигура 8Е: отношение толщины стенки к диаметру просвета для артериол с просветом диаметром 51-100 мкм, взятых у мышей, фигура 7. На гистограмме представлено среднее значение ± SEM для 15 мышей в каждой группе.

На фигурах 9A-9G показаны показатели мышей с отсутствующими рецепторами LDL в Т-образном лабиринте при непрерывном выполнении задачи, требующей выбора альтернативного решения (Т-САТ) в зависимости от диеты и лечения. Фигуры 9A-9D: у мышей, описанных на фигуре 8А, определяли характеристики пространственной памяти на модели Т-САТ. Фигура 9А: Определено число спонтанных чередований. Данные представлены в виде среднего значения ± SEM для 15 испытаний с 10 мышами в каждой группе. Фигура 9В: Определен процент спонтанных чередований. Данные представлены в виде среднего значения ± SEM для 15 испытаний с 10 мышами в каждой группе. Фигура 9С: Определена скорость спонтанных чередований, отличающаяся от 50% случайного выбора. Данные представлены в виде среднего значения ± SEM для 15 испытаний с 10 мышами в каждой группе. Фигура 9D: Определено время, требующееся для завершения испытания. Данные представлены в виде среднего значения ± SEM для 15 испытаний с 10 мышами в каждой группе. Фигуры 9E-9G: мышей, описанных на фигуре 7 и фигурах 8В-8Е, тестировали на производительность пространственной памяти в соответствии с моделью Т-САТ, как описано выше. Фигура 9Е: Определено число спонтанных чередований. Данные представлены в виде среднего значения ± SEM для 15 испытаний с 15 мышами в каждой группе. Фигура 9F: Определен процент спонтанных чередований. Данные представлены в виде среднего значения ± SEM для 15 испытаний с 15 мышами в каждой группе. Фигура 9G: Определена скорость спонтанных чередований, отличающаяся от 50% случайного выбора. Данные представлены в виде среднего значения ± SEM для 15 испытаний с 15 мышами в каждой группе.

Осуществление изобретения

Настоящее изобретение основано на неожиданном открытии, согласно которому кровеносные сосуды, размер которых меньше размера самых маленьких артерий (то есть артериолы), способны утолщаться, утрачивать свою функцию и вызывать повреждения тканей в таких непохожих друг на друга органах-мишенях, как мозг и почки. Настоящее изобретение относится к способу улучшения структуры и функции артериол и сохранению функций органов-мишеней, таких как мозг и почки.

Авторы изобретения предположили, что нарушения, наблюдаемые в больших артериях, имеют место также и в маленьких артериях и даже в мельчайших кровеносных сосудах, артериолах. Артериолы представляют собой кровеносные сосуды диаметром меньше, приблизительно, 200 мкм, более типично, меньше, приблизительно, 100 мкм. Авторы предположили также, что, если благоприятный эффект ароА-I пептидомиметика (D-4F) наблюдается как в больших артериях (Navab et al. (2002) Circulation, 105: 290-292; Van Lenten et al. (2002) Circulation, 106: 1127-1132), так и в маленьких артериях (Ou et al. (2003) Circulation, 107: 2337-2341), он должен иметь место также и в артериолах. Было также обнаружено, что стенки артериол головного мозга от 10 до 100 мкм диаметром утолщаются у мышей с отсутствующими рецепторами LDL по сравнению с мышами дикого типа, что это утолщение более выражено для Западной диеты, и что оно сопровождается снижением показателей выполнения задачи в Т-образном лабиринте при непрерывном выполнении задачи, требующей выбора альтернативного решения. Увеличение толщины стенок артериол мозга частично обусловлено повышением содержания α-актина гладкой мускулатуры артериол, положение значительно улучшалось при лечении D-4F. Видимо, лечение D-4F мышей с отсутствующими рецепторами LDL, питающихся в соответствии с Западной диетой, снижает толщину стенок артериол мозга независимо от содержания липидов в плазме и от диаметра просвета артериол; при этом также улучшается пространственная память.

Соответственно, предполагается, что использование D-4F, L-4F и других активных агентов описанных здесь пептидов позволяет эффективно улучшить описанную здесь структуру и/или функцию артериол и, таким образом, облегчить один или несколько симптомов состояния, характеризующегося нарушениями структуры и/или функции артериол. Такие состояния включают, например, нарушения неврологической функции (например, связанные с болезнью Альцгеймера, Паркинсона, возрастным ухудшением памяти, ухудшением памяти, вызванным инсультом, болезнью Бенсвангера и т.п.), нарушения функции почек, нарушения функции альвеол и подобные им.

Некоторые аспекты настоящего изобретения относятся к новым способам улучшения структуры и функции артериол путем введения одного или нескольких агентов, которые изолируют, и/или удаляют, и/или разрушают воспалительные липиды и конвертируют провоспалительные липопротеины высокой плотности (HDL) в противовоспалительные HDL или делают противовоспалительные HDL еще более противовоспалительными. К числу таких активных агентов относятся некоторые пептиды, содержащие амфипатическую спираль класса А (см., например, U.S. Patent 6,664,230, PCT Publications WO 2002/15923, и WO 2004/034977, а также находящиеся на рассмотрении патентные заявки USSN: 09/896,841, 10/187,215, 10/273,386, и 10/423,830, которые включены сюда по ссылке), пептиды, содержащие амфипатическую спираль класса G* (см., например, PCT publication WO 03/086,326, а также находящуюся на рассмотрении патентную заявку US application USSN 10/120,508, которая включена сюда по ссылке), короткие пептиды и непептиды с молекулярным весом меньше 900 дальтон, растворимость которых в этилацетате не превышает 4 мг/мл, которые растворимы в водном буфере при рН 7 и при контакте с фосфолипидами в водной среде образуют частицы диаметром, приблизительно, 7,5 мкм, а также упакованные бислои, размеры которых составляют, приблизительно, от 3,4 до 4,1 мкм, а расстояние между ними в стопе составляет, приблизительно, 2 нм (см., например, PCT/US 2004/026288, находящуюся на рассмотрении патентную заявку U.S. applications USSN 10/649,378, и 10/913,800 и находящуюся на рассмотрении патентную заявку U.S. application USSN 60/600,925, соответственно, которые включены сюда по ссылке); а также пероральные синтетические фосфолипиды, sn-1 и sn-2, положения в которых идентичны и содержат по меньшей мере 3 атома углерода (см., например, находящиеся на рассмотрении патентные заявки U.S. Applications 09/539,569 и 09/994,227, а также заявку РСТ publication WO 01/75168, которые включены сюда по ссылке).

Некоторые направления реализации настоящего изобретения относятся к введению млекопитающему (например, человеку) одного или нескольких описанных здесь активных агентов (пептидов, пептидомиметиков, липидов, маленьких органических молекул и т.д.). Предпочтительно, агент (агенты) вводят в дозе или в режиме дозировок, достаточном для улучшения структуры и/или функции артериол, предпочтительно, артериол диаметром менее чем, приблизительно, 200 мкм, более предпочтительно, диаметром менее чем, приблизительно, 160 мкм, еще более предпочтительно, если диаметр меньше, приблизительно, 80 мкм, и наиболее предпочтительно, если меньше, приблизительно, 50 мкм или 40 мкм.

I. Активные агенты

Для лечения одного или нескольких описанных выше показаний подходит множество агентов. Эти агенты включают, без ограничения указанным, амфипатические спиральные пептиды класса А, относящиеся к классу А амфипатические спиральные пептидомиметики ароА-I, содержащие ароматические или алифатические остатки на неполярной поверхности, небольшие пептиды, включая пентапептиды, тетрапептиды, трипептиды, дипептиды и пары аминокислот, Apo-J (С*-пептиды), а также пептидомиметики, например, описанные далее.

А) Амфипатические спиральные пептиды класса А

В соответствии с некоторыми аспектами, к числу активных агентов, применяемых в способах настоящего изобретения, относятся амфипатические спиральные пептиды класса А, например, описанные в патентах U.S. Patent 6,664,230, и РСТ публикациях WO 02/15923 и WO 2004/034977. Обнаружено, что пептиды, содержащие амфипатическую спираль класса А (пептиды класса А), помимо уменьшения симптомов атеросклероза, эффективны для лечения также одного или нескольких других описанных здесь показаний.

Пептиды класса А характеризуются образованием α-спирали, которая обеспечивает разделение полярных и неполярных остатков, формируя полярные и неполярные поверхности с положительно заряженными остатками на полярной-неполярной границе раздела, и с отрицательно заряженными остатками в центре полярной поверхности (см., например, Anantharamaiah (1986) Meth. Enzymol, 128: 626-668). Отмечено также, что четвертый экзон ароА-I при сворачивании в 3,667 остатков/поворот приводит к образованию амфипатической спиральной структуры класса А.

Один из пептидов класса А, под названием 18А (см., например, Anantharamaiah (1986) Meth. Enzymol, 128:626-668) удалось модифицировать в соответствии с приведенным здесь описанием, получив пептиды для перорального введения, чрезвычайно эффективные при ингибировании или профилактике симптомов атеросклероза и/или других описанных здесь показаний. Не будучи связанными никакой особой теорией, авторы предполагают, что пептиды настоящего изобретения могут действовать in vivo, связывая молекулы, инициирующие окисление LDL.

Авторы изобретения выяснили, что повышение количества остатков Phe на гидрофобной поверхности 18А теоретически должно повысить сродство к липидам. Этот вывод получен вычислительными методами, выполненными в работе Palgunachari et al. (1996) Arteriosclerosis, Thrombosis, & Vascular Biology 16:328-338. Теоретически, систематическое замещение остатков на неполярной поверхности 18А на фенилаланин может привести к получению шести пептидов. Пептиды с дополнительными 2, 3 и 4 остатками Phe могут обладать теоретическим сродством к липидам, равным (λ) 13, 14 и 15 единиц соответственно. Однако значение λ подскакивает сразу на четыре единицы, если число дополнительных Phe увеличить с 4 до 5 (до 19 единиц λ). Увеличение до 6 или 7 остатков Phe приводит к менее резкому повышению (до 20 и 21 единицы λ соответственно).

Было получено множество таких пептидов класса А, включая пептиды под названием 4F, D4F, 5F, D5F и подобные им. Разнообразные пептиды класса А ингибировали развитие патологических изменений у мышей, чувствительных к развитию атеросклероза. Кроме того, все они демонстрировали различную, но значительную эффективность в уменьшении симптомов различных описанных здесь патологий. Большое количество таких пептидов проиллюстрировано в таблице 1.

В соответствии с некоторыми предпочтительными аспектами пептиды включают вариации 4F ((SEQ ID NO:5 в таблице 1, известные также как L-4F, где все остатки представляют собой L-аминокислоты) или D-4F, где по меньшей мере один остаток представляет собой D-аминокислоту). В любом из описанных здесь пептидов С-конец и/или N-конец и/или внутренние остатки могут быть заблокированы одной или несколькими блокирующими группами, как описано здесь.

У пептидов в таблице 1 амино-конец защищен ацетильной группой или N-метилантранилиловой группой, а карбоксильный конец защищен амидной группой, однако, любую защитную группу можно удалить или заменить на другую защитную группу, как описано здесь. В соответствии с особенно предпочтительными аспектами пептиды содержат одну или более D-аминокислот, как описано здесь. В соответствии с некоторыми аспектами все аминокислоты (то есть все энантиомерные аминокислоты) пептидов из таблицы 1 находятся в D-форме.

Следует отметить также, что таблица 1 не является полностью исчерпывающей. С помощью описанных здесь методов (например, консервативными или полуконсервативными заменами (например, заменой D на Е), удлинениями, делециями и т.д.) можно получить другие подходящие спиральные амфипатические пептиды класса А. Так, в соответствии с одним аспектом изобретения практикуется усечение одного или нескольких показанных здесь пептидов (например, пептидов из таблицы 1 с SEQ ID Nos: 2-20 и 39-). Например, пептид SEQ ID NO: 21 содержит 14 аминокислот с С-конца 18А и одну или несколько D-аминокислот, пептиды SEQ ID NOS: 22-38 иллюстрируют другие способы усечения.

Подходят также более длинные пептиды. Они могут полностью формировать амфипатическую спираль класса А, или такую спираль (спирали) могут формировать один или более доменов пептида. Настоящее изобретение охватывает также и многомерные варианты пептидов (например, конкатемеры). Например, проиллюстрированные здесь пептиды можно объединить (непосредственно или с помощью линкера (углеродного линкера или с помощью одной или нескольких аминокислот) с одной или несколькими промежуточными аминокислотами). Иллюстративные полимерные пептиды включают 18A-Pro-18A, а также пептиды с номерами SEQ ID NOs:78-85, в соответствии с некоторыми аспектами они включают одну или более D-аминокислот, более предпочтительно, если все аминокислоты находятся в D-форме, как описано здесь, и/или с одним или обоими защищенными концами.

Следует иметь в виду также, что, помимо ясно проиллюстрированных здесь пептидных последовательностей, настоящее изобретение охватывает также ретро- и ретро-инверсные формы каждого из этих пептидов. В ретро-формах обращено направление каждой последовательности. В инверсных формах обращена хиральность составных аминокислот (то есть L-форма становится D-формой, а D-форма - L-формой). В ретро-инверсных формах изменены порядок и хиральность аминокислот. Так, например, ретро-форма пептида D4F (DWFKAFYDKVAEKFKEAF, SEQ ID NO:5), где амино-конец представляет собой аспартат (D), а карбоксильный конец - фенилаланин (F) характеризуется такой же последовательностью, но у нее амино-конец соответствует фенилаланину, а карбоксильный конец - аспартату (то есть FAEKFKEAVKDYFAKFWD, SEQ ID NO:444). Если пептид D4F содержит только D-аминокислоты, то ретро-инверсная форма будет представлена последовательностью SEQ ID NO:444 и содержать только L-аминокислоты. Например, 4F и Rev-4F представляют собой зеркальные отражения друг друга с идентичной сегрегацией полярных и неполярных поверхностей с положительно заряженными остатками на полярно-неполярной границе и отрицательно заряженными остатками в центре полярных поверхностей. Эти зеркальные отображения одного и того же аминокислотного полимера идентичны с точки зрения сегрегации полярных и неполярных поверхностей с положительно заряженными остатками на полярно-неполярной границе и отрицательно заряженными остатками в центре полярных поверхностей. Подробнее ретро- и ретро-инверсные пептиды описаны в работе Chorev and Goodman (1995) TibTech, 13: 439-445).

Если у пептида приведена только последовательность, а ориентация не указана явным образом, то следует считать, что последовательность соответствует ориентации от амина к карбоксилу, ретро-форме (то есть с ориентацией от карбоксила к амину), ретро-форме, в которой L-аминокислоты заменены на D-аминокислоты или D-аминокислоты заменены на L-аминокислоты, а также ретро-инверсной форме, в которой обращены как порядок, так и хиральность аминокислот.

Следует иметь в виду также, что, помимо явным образом проиллюстрированных здесь пептидных последовательностей, изобретение включает также кольцевые перестановки (СР) каждого пептида, а также кольцевые перестановки ретро-, инверсных и ретро-инверсных форм таких пептидов. Кольцевая перестановка пептида представляет собой такой пептид, аминокислотная последовательность которого идентична той, которую можно получить соединением амино- и карбоксильного концов первоначального пептида и открытием полученного кольцевого пептида для образования нового амино- и карбоксильного концов.

В) Другие относящиеся к классу А амфипатические спиральные пептидомиметики ароА-1 с ароматическими или алифатическими остатками на неполярной поверхности.

В соответствии с некоторыми аспектами реализации настоящее изобретение относится к модифицированным амфипатическим спиральным пептидам класса А. Некоторые предпочтительные пептиды включают по меньшей мере один ароматический остаток в центре неполярной поверхности, например, 3F (содержится в 4F), или по меньшей мере один алифатический остаток в центре неполярной поверхности, например, 3F, см. таблицу 2. Не будучи связанными никакой теорией, авторы полагают, однако, что центральные ароматические остатки неполярной поверхности пептида 3F из-за наличия в центре неполярной поверхности π-электронов позволяют молекулам воды подойти ближе к гидрофобным липидным алкильным цепям пептидо-липидного комплекса, которые, в свою очередь, принимают реакционно активные формы кислорода (такими как гидропероксиды липидов), защищая от них клеточную поверхность. Аналогично, авторы полагают, что пептиды с алифатическими остатками в центре неполярной поверхности, например, 3F, действуют аналогично 3F, но не так эффективно.

Предпочтительные пептиды конвертируют провоспалительные HDL в противовоспалительные или делают противовоспалительные HDL еще более противовоспалительными, и/или снижают вызванную LDL хемотактическую активность моноцитов, вызванную клетками артериальной стенки в той же или большей степени, чем D4F или другие пептиды из таблицы 1.

Таблица 2
Примеры некоторых предпочтительных пептидов
Название Последовательность SEQ ID NO
(3F) AC-DKWKAVYDKFAEAFKEFL-NH2 104
(3F) AC-DKLKAFYDKVFEWAKEAF-NH2 105

С) Меньшие пептиды

Неожиданно было установлено, что некоторые маленькие пептиды, содержащие не менее трех аминокислотных остатков, предпочтительно (но не обязательно), если по меньшей мере один аминокислотный остаток является D-стереоизомером, и содержащие гидрофобные домены для обеспечения липидно-протеиновых взаимодействий и гидрофильные домены для обеспечения растворимости в воде, также проявляют значительные противовоспалительные свойства и эффективны для лечения одной или нескольких описанных здесь патологий. Как правило, маленькие пептиды содержат, приблизительно, от 2 до 15 аминокислотных остатков, более предпочтительно, приблизительно, от 3 до 10 или 11 аминокислотных остатков, наиболее предпочтительно, приблизительно, от 4 до 8 или 10 аминокислотных остатков. В соответствии с различными аспектами изобретения пептиды, как правило, характеризуются наличием гидрофобных концевых аминокислот, либо эти терминальные аминокислоты делают гидрофобными, включая в них одну или более гидрофобных "защитных" групп. Различные "маленькие пептиды" описаны в находящихся на рассмотрении патентных заявках USSN 10/649,378, поданной 26 августа 2003, USSN 10/913,800, поданной 6 августа 2004 и в РСТ Application PCT/US 2004/026288.

В соответствии с некоторыми аспектами пептиды соответствуют приведенной ниже формуле I:

где n=0 или 1, X1 представляет собой гидрофобную аминокислоту и/или содержит гидрофобную "защитную" группу, X4 представляет собой гидрофобную аминокислоту и/или содержит гидрофобную "защитную" группу; причем, если n=0, то X2 представляет собой кислую или основную аминокислоту; если n=1, то Х2 и X3 представляют собой кислую аминокислоту, основную аминокислоту, алифатическую аминокислоту или ароматическую аминокислоту, так что, если X2 - кислая аминокислота, то X3 - основная, алифатическая или ароматическая аминокислота; если X2 - основная аминокислота, то X3 - кислая, алифатическая или ароматическая аминокислота; и если X2 - алифатическая или ароматическая аминокислота, то X3 представляет собой кислую или основную аминокислоту.

К области настоящего изобретения относятся также и более длинные пептиды (например, длиной до 10, 11 или 15 аминокислотных остатков). Как правило, если более короткие пептиды (например, соответствующие формуле I) содержат кислые, основные, ароматические или алифатические аминокислотные остатки, то более длинные пептиды содержат кислые, основные, ароматические или алифатические домены, которые, в свою очередь, содержат два или более аминокислотных остатка соответствующего типа.

1) Функциональные свойства маленьких активных пептидов

Неожиданным открытием настоящего изобретения оказалось то, что некоторые физические свойства позволяют предсказать способность маленьких пептидов (например, пептидов длиной менее 10 аминокислотных остатков, предпочтительно, менее 8 аминокислотных остатков, еще более предпочтительно, от 3 до 5 или 6 аминокислотных остатков) настоящего изобретения придавать HDL более выраженные противовоспалительные свойства и ослаблять у млекопитающих атеросклероз и/или другие патологии, характеризующиеся воспалительными реакциями. Указанные физические свойства включают высокую растворимость в этилацетате (например, более, чем приблизительно 4 мг/мл) и растворимость в водном буфере при рН 7,0. При взаимодействии с фосфолипидами, такими как 1,2-димиристоил-sn-глицеро-3-фосфохолин (DMPC) в водной среде особенно эффективные маленькие пептиды индуцируют или принимают участие в образовании частиц диаметром, приблизительно, 7,5 нм (±0,1 нм), и/или индуцируют или принимают участие в образовании упакованных бислоев с размером бислоя, приблизительно, 3,4-4,1 нм и с расстоянием между ними в стопе, приблизительно, 2 нм, и/или индуцируют или принимают участие в образовании пузырьковых структур размером, приблизительно, 38 нм. В соответствии с некоторыми предпочтительными аспектами изобретения молекулярный вес маленьких пептидов составляет менее, чем, приблизительно, 900 Да (дальтон).

Таким образом, некоторые аспекты настоящего изобретения охватывают маленькие пептиды, ослабляющие один или более симптомов описанных здесь показаний/патологий, например, воспалительных состояний, причем эти пептиды характеризуются следующими свойствами: их длина колеблется, приблизительно, от 3 до 8 аминокислотных остатков, предпочтительно, приблизительно, от 3 до 6 или 7 аминокислотных остатков, более предпочтительно, приблизительно, от 3 до 5 аминокислотных остатков; они растворимы в этилацетате в концентрации более чем, приблизительно 4 мг/мл; они растворимы в водном буфере при рН 7,0; при взаимодействии с фосфолипидами в водной среде они образуют частицы диаметром, приблизительно 7,5 нм и/или упакованные бислои размером, приблизительно 3,4-4,1 нм и с расстоянием между ними в стопе, приблизительно 2 нм; их молекулярный вес менее, чем, приблизительно 900 Да; они преобразуют провоспалительные HDL в противовоспалительные HDL или делают противовоспалительные HDL еще более противовоспалительными; и не содержат аминокислотных последовательностей Lys-Arg-Asp-Ser (SEQ ID NO:235), особенно, в которых все остатки аминокислот в Lys-Arg-Asp и Ser находятся в L-конфигурациях. В соответствии с некоторыми аспектами эти маленькие пептиды защищают фосфолипид от окисления окисляющими агентами.

Хотя и нет необходимости так ограничивать описанные выше маленькие пептиды, в соответствии с некоторыми аспектам изобретения, указанные маленькие пептиды могут содержать те, что описаны ниже.

2) Трипептиды

Обнаружено, что можно синтезировать такие трипептиды (пептиды длиной в три аминокислотных остатка), которые проявляют желаемые свойства, описанные в настоящем изобретении (например, способность преобразовывать провоспалительные HDL в противовоспалительные HDL, способность уменьшать индуцированную LDL хемотактическую активность моноцитов, вызванную клетками стенки артерии, способность увеличивать содержание пре-бета HDL и т.д.). В соответствии с некоторыми аспектами настоящего изобретения данные пептиды описываются формулой I, где N=0, они представлены также далее формулой II:

где концевые аминокислотные остатки (X1 и X4) являются гидрофобными благодаря наличию гидрофобной боковой цепи, или потому, что боковая цепь или С- и/или N-концы заблокированы одной или более гидрофобными защитными группами (например, N-конец может быть заблокирован группами Boc-, Fmoc-, никотинил- и т.д., а С-конец может быть заблокирован группой (tBu)-OtBu или подобными). В соответствии с некоторыми аспектами аминокислотный остаток X2 является либо кислым (например, аспарагиновая кислота, глутаминовая кислота и т.д.), либо основным (например, гистидин, аргинин, лизин и т.д.). Все аминокислоты пептида могут находится в L-форме, или среди них может быть одна или более D-аминокислот.

Предпочтительные трипептиды настоящего изобретения включают, без ограничения указанным, те, что показаны в таблице 3.

Следует отметить, что, хотя пептиды таблицы 3 приведены с указанием конкретных защитных групп, эти группы можно заменить на другие защитные группы, как описано в настоящем изобретении, и/или одну или более указанных защитных групп можно удалить.

3) Маленькие пептиды с центральными кислыми или основными аминокислотными остатками

В соответствии с некоторыми аспектами настоящего изобретения длина пептидов настоящего изобретения колеблется, приблизительно, от четырех до десяти аминокислотных остатков. Обычно, терминальные аминокислотные остатки гидрофобны либо из-за наличия гидрофобной боковой цепи, либо из-за того, что С- и/или N-концы заблокированы одной или более гидрофобными защитными группами (например, N-конец может быть заблокирован группами Воc-, Fmoc-, никотинил- и т.д., а С-конец может быть заблокирован группой (tBu)-OtBu или им подобными). Как правило, в центральной части пептида находятся основной и кислый аминокислотные остатки (например, в тетрапептиде), или основной и/или кислый домен в случае более длинной молекулы.

Такие тетрапептиды можно описать формулой I, где X1 и X4 - гидрофобны и/или содержат гидрофобные защитные группы (группу), как описано в настоящем изобретении, X2 - кислый, а X3 - основной, или X2 - основной, а X3 - кислый. Пептиды могут содержать только L-аминокислотные остатки или по меньшей мере один D-аминокислотный остаток.

Предпочтительные тетрапептиды настоящего изобретения включают, без ограничения указанным, представленные в таблице 4.

Следует отметить, что, хотя пептиды в таблице 4 приведены с указанием конкретных защитных групп, эти группы можно заменить на другие защитные группы, как описано в настоящем изобретении, и/или одну или более указанных защитных групп можно удалить.

4) Маленькие пептиды с кислыми или основными аминокислотными остатками, расположенными в центре вместе с центральной алифатической аминокислотой.

В соответствии с некоторыми аспектами настоящего изобретения длина пептида колеблется, приблизительно, от четырех до десяти аминокислотных остатков. Терминальные аминокислотные остатки, как правило, гидрофобны либо благодаря наличию гидрофобных боковых цепей, либо потому что они содержат одну или более гидрофобных защитных групп. Концевые аминокислотные остатки (X1 и X4) гидрофобны либо благодаря наличию гидрофобных боковых цепей, либо потому что боковые цепи или С- и/или N-концы заблокированы одной или несколькими гидрофобными защитными группами (например, N-конец заблокирован группами Воc-, Fmoc-, никотинил- и т.д., а С-конец заблокирован (tBu)-OtBu, и т.д.). Как правило, центральная часть пептида содержит основной или кислый аминокислотный остаток, а также алифатический аминокислотный остаток (например, в тетрапептиде), или, в случае более длинного пептида, основной или кислотный домен и алифатический домен.

Такие тетрапептиды можно представить формулой I, где X1 и X4 гидрофобны и/или содержат гидрофобные защитные группы, как описано в настоящей заявке, X2 представляет собой кислую или основную группу, а X3 - алифатическую, или X2 - алифатическая группа, а X3 - кислая или основная. Пептид может содержать только L-аминокислоты, а может содержать одну или несколько D-аминокислот, или все аминокислотные остатки пептида находятся в D-форме.

Некоторые предпочтительные пептиды настоящего изобретения включают, без ограничения указанным, те, что показаны в таблице 5.

Таблица 5
Примеры некоторых предпочтительных пептидов, содержащих в центре кислый или основной аминокислотный остаток совместно с алифатическим аминокислотным остатком
X1 X2 X3 X4 SEQ ID NO
Fmoc-Lys(εBoc) Leu Arg Ser(tBu)-OtBu 380
Fmoc-Lys(εBoc) Arg Leu Ser(tBu)-OtBu 381
Fmoc-Lys(εBoc) Leu Arg Thr(tBu)-OtBu 382
Fmoc-Lys(εBoc) Arg Leu Thr(tBu)-OtBu 383
Fmoc-Lys(εBoc) Glu Leu Ser(tBu)-OtBu 384
Fmoc-Lys(εBoc) Leu Glu Ser(tBu)-OtBu 385
Fmoc-Lys(εBoc) Glu Leu Thr(tBu)-OtBu 386
Fmoc-Lys(εFmoc) Leu Arg Ser(tBu)-OtBu 387
Fmoc-Lys(εFmoc) Leu Arg Thr(tBu)-OtBu 388
Fmoc-Lys(εFmoc) Glu Leu Ser(tBu)-OtBu 389
Fmoc-Lys(εFmoc) Glu Leu Thr(tBu)-OtBu 390
Boc-Lys(Fmoc) Glu Thr(tBu)-OtBu 391
Boc-Lys(εFmoc) Leu He Ser(tBu)-OtBu 392
Boc-Lys(εFmoc) Leu Arg Thr(tBu)-OtBu 393
Boc-Lys(εFmoc) Glu Arg Ser(tBu)-OtBu 394
Boc-Lys(εFmoc) Glu Leu Thr(tBu)-OtBu 395
Boc-Lys(εBoc) Leu Leu Ser(tBu)-OtBu 396
Boc-Lys(εBoc) Arg Arg Thr(tBu)-OtBu 397
Boc-Lys(εBoc) Leu Phe Thr(tBu)-OtBu 398
Boc-Lys(εBoc) Glu Arg Thr(tBu) 399
Boc-Lys(εBoc) Glu He Thr(tBu) 400
Boc-Lys(εBoc) Glu Val Thr(tBu) 401
Boc-Lys(εBoc) Glu Ala Thr(tBu) 402
Boc-Lys(εBoc) Glu Gly Ser(tBu)-OtBu 403
Boc-Lys(εBoc) Glu Leu Thr(tBu)-OtBu 404

Следует отметить, что, хотя пептиды таблицы 5 приведены с указанием конкретных защитных групп, эти группы можно заменить на другие защитные группы, как описано в настоящем изобретении, и/или одну или более указанных защитных групп можно удалить.

5) Маленькие пептиды с кислыми или основными аминокислотными остатками, расположенными в центре вместе с центральной ароматической аминокислотой.

В соответствии с некоторыми аспектами настоящего изобретения длина "маленького" пептида колеблется, приблизительно, от четырех до десяти аминокислотных остатков. Терминальные аминокислотные остатки, как правило, гидрофобны либо благодаря наличию гидрофобных боковых цепей, либо потому что они содержат одну или более гидрофобных защитных групп. Концевые аминокислотные остатки (X1 и X4) гидрофобны либо благодаря наличию гидрофобных боковых цепей, либо потому что боковые цепи или С- и/или N-концы заблокированы одной или несколькими гидрофобными защитными группами (например, N-конец заблокирован группами Воc-, Fmoc-, никотинил- и т.д., а С-конец заблокирован (tBu)-OtBu, и т.д.). Как правило, центральная часть пептида содержит основной или кислый аминокислотный остаток, а также ароматический аминокислотный остаток (например, в тетрапептиде), или, в случае более длинного пептида, основной или кислотный домен и ароматическим доменом.

Такие тетрапептиды можно представить формулой I, где X1 и X4 гидрофобны и/или содержат гидрофобные защитные группы, как описано в настоящей заявке, X2 представляет собой кислую или основную группу, а X3 - ароматическую, или X2 - ароматическая группа, а X3 - кислая или основная. Пептид может содержать только L-аминокислоты, а может соде ржать одну или несколько D-аминокислот, или все аминокислотные остатки пептида находятся в D-форме. Пентапептиды можно представить, слегка изменив формулу I, в нее надо включить остаток X5. Такие пептиды показаны в таблице 6, где X5 преимущественно представляют собой ароматические аминокислотные остатки.

Некоторые предпочтительные пептиды настоящего изобретения включают, без ограничения указанным, те, что показаны в таблице 6.

Таблица 6
Примеры предпочтительных пептидов, содержащих в центре кислый или основной аминокислотный остаток вместе с ароматическим аминокислотным остатком.
X1 X2 X3 X5 X4 SEQ ID NO
Fmoc-Lys(εBoc) Arg Trp Tyr(tBu)-OtBu 405
Fmoc-Lys(εBoc) Trp Arg Tyr(tBu)-OtBu 406
Fmoc-Lys(εBoc) Arg Tyr Trp-OtBu 407
Fmoc-Lys(εBoc) Tyr Arg Trp-OtBu 408
Fmoc-Lys(εBoc) Arg Tyr Trp Thr(tBu)-OtBu 409
Fmoc-Lys(εBoc) Arg Tyr Thr(tBu)-OtBu 410
Fmoc-Lys(εBoc) Arg Trp Thr(tBu)-OtBu 411
Fmoc-Lys(εFmoc) Arg Arg Tyr(tBu)-OtBu 412
Fmoc-Lys(εFmoc) Arg Arg Trp-OtBu 413
Fmoc-Lys(εFmoc) Arg Arg Trp Thr(tBu)-OtBu 414
Fmoc-Lys(εFmoc) Arg Arg Thr(tBu)-OtBu 415
Fmoc-Lys(εFmoc) Arg Arg Thr(tBu)-OtBu 416
Boc-Lys(εFmoc) Arg Trp Tyr(tBu)-OtBu 417
Boc-Lys(εFmoc) Arg Tyr Trp-OtBu 418
Boc-Lys(εFmoc) Arg Tyr Trp Thr(tBu)-OtBu 419
Boc-Lys(εFmoc) Arg Tyr Thr(tBu)-OtBu 420
Boc-Lys(εFmoc) Arg Trp Trp Thr(tBu)-OtBu 421
Boc-Glu Lys(εFmoc) Tyr(tBu)-OtBu 422
Boc-Lys(εBoc) Arg Trp Tyr(tBu)-OtBu 423
Boc-Lys(εBoc) Arg Tyr Trp-OtBu 424
Boc-Lys(εBoc) Arg Tyr Trp Thr(tBu)-OtBu 425
Boc-Lys(εBoc) Arg Tyr Thr(tBu)-OtBu 426
Boc-Lys(εBoc) Arg Phe Thr(tBu)-OtBu 427
Boc-Lys(εBoc) Arg Trp Thr(tBu)-OtBu 428

Следует отметить, что, хотя пептиды таблицы 6 приведены с указанием конкретных защитных групп, эти группы можно заменить на другие защитные группы, как описано в настоящем изобретении, и/или одну или более указанных защитных групп можно удалить.

6) Маленькие пептиды с ароматическими аминокислотными остатками или аминокислотами, разделенными в центре остатком (остатками) гистидина.

В соответствии с некоторыми аспектами настоящего изобретения пептиды настоящего изобретения характеризуются наличием π-электронов в центре молекулы, обеспечивающих гидратацию частицы, что позволяет указанным пептидным частицам перехватывать провоспалительные окисленные липиды, такие как гидропероксиды жирных кислот и фосфолипиды, содержащие продукт окисления арахидоновой кислоты в положении sn-2.

В соответствии с некоторыми аспектами такие пептиды содержат минимум, приблизительно, четыре, и максимум, приблизительно, десять аминокислотных остатков, предпочтительно (но не обязательно), если по меньшей мере один аминокислотный остаток является D-стереомером, причем конечные аминокислотные остатки гидрофобны либо благодаря наличию гидрофобных боковых цепей, либо потому что терминальные аминокислотные остатки содержат одну или более гидрофобных блокирующих групп (например, N-конец заблокирован группами Воc-, Fmoc-, никотинил- и т.д., а С-конец заблокирован (tBu)-OtBu, и т.д.). Вместо наличия кислого или основного аминокислотного остатка в центре такого пептида, у них, обычно, в центре располагается ароматический аминокислотный остаток или несколько ароматических аминокислотных остатков, разделенных гистидином.

Некоторые предпочтительные пептиды настоящего изобретения включают, без ограничения указанным, те, что показаны в таблице 7.

Таблица 7
Примеры пептидов, содержащих в центре ароматические аминокислотные остатки или ароматические домены, возможно, разделенные одним или более гистидинами.
X1 X2 X3 X4 X5 SEQ ID NO
Boc-Lys(εBoc) Phe Trp Phe Ser(tBu)-OtBu 429
Boc-Lys(εBoc) Phe Trp Phe Thr(tBu)-OtBu 430
Boc-Lys(εBoc) Phe Tyr Phe Ser(tBu)-OtBu 431
Boc-Lys(εBoc) Phe Tyr Phe Thr(tBu)-OtBu 432
Boc-Lys(εBoc) Phe His Phe Ser(tBu)-OtBu 433
Boc-Lys(εBoc) Phe His Phe Thr(tBu)-OtBu 434
Boc-Lys(εBoc) Val Phe Phe-Tyr Ser(tBu)-OtBu 435
Никотинил-Lys(εВос) Phe Trp Phe Ser(tBu)-OtBu 436
Никотинил-Lys(εВос) Phe Trp Phe Thr(tBu)-OtBu 437
Никотинил-Lys(εВос) Phe Tyr Phe Ser(tBu)-OtBu 438
Никотинил-Lys(εВос) Phe Tyr Phe Thr(tBu)-OtBu 439
Никотинил-Lys(εВос) Phe His Phe Ser(tBu)-OtBu 440
Никотинил-Lys(εВос) Phe His Phe Thr(tBu)-OtBu 441
Воc-Leu Phe Trp Phe Thr(tBu)-OtBu 442
Воc-Leu Phe Trp Phe Ser(tBu)-OtBu 443

Следует отметить, что, хотя пептиды таблицы 7 приведены с указанием конкретных защитных групп, эти группы можно заменить на другие защитные группы, как описано в настоящем изобретении, и/или одну или более указанных защитных групп можно удалить.

7) Краткие выводы относительно трипептидов и тетрапептидов

Для ясности, некоторые три- и тетрапептиды настоящего изобретения кратко описаны ниже в таблице 8.

Таблица 8
Общая структура некоторых пептидов настоящего изобретения
X1 Х2 Х3 Х4
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Кислая или основная - Гидрофобная боковая цепь или гидрофобная защитная группа (группы)
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Основная Кислая Гидрофобная боковая цепь или гидрофобная защитная группа (группы)
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Кислая Основная Гидрофобная боковая цепь или гидрофобная защитная группа (группы)
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Кислая или основная Алифатическая Гидрофобная боковая цепь или гидрофобная защитная группа (группы)
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Алифатическая Кислая или основная Гидрофобная боковая цепь или гидрофобная защитная группа (группы)
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Кислая или основная Ароматическая Гидрофобная боковая цепь или гидрофобная защитная группа (группы)
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Ароматическая Кислая или основная Гидрофобная боковая цепь или гидрофобная защитная группа (группы)
Гидрофобная боковая цепь или гидрофобная защитная группа (группы) Ароматическая Гистидин Ароматическая Гидрофобная боковая цепь или гидрофобная защитная группа (группы)

При рассмотрении более длинных пептидов X2 и X3 может соответствовать доменам (например, областям, содержащим две или более аминокислоты указанного типа), а не индивидуальным аминокислотам. Таблица 8 приведена для иллюстрации, она не ограничивает область настоящего изобретения. Используя приведенную в заявке информацию, легко можно установить другие подходящие пептиды.

8) Парные аминокислоты и дипептиды

К области настоящего изобретения относится открытие, что некоторые пары аминокислот, введенные совместно друг с другом или связанные друг с другом через линкер, образуют дипептид, проявляющий одно или более описанных здесь свойств. Не будучи связанными никакой конкретной теорией, авторы предполагают, что, когда пары аминокислот вводят совместно, как описано здесь, они способны индуцировать образование мицелл in vivo или участвовать в этом процессе.

Подобно другим описанным здесь маленьким пептидам, авторы полагают, что пары аминокислот будут взаимодействовать in vivo, демонстрируя такие физические свойства, как высокая растворимость в этилацетате (например, более 4 мг/мл) и растворимость в водном буфере при рН 7,0. Предполагается, что при взаимодействии с фосфолипидами, такими как 1,2-димиристоил-sn-глицеро-3-фосфохолин (1,2-Dimyristoyl-sn-glycero-3-phosphocholine, DMPC), в водной среде, пары аминокислот индуцируют или принимают участие в образовании частиц диаметром, приблизительно, 7,5 нм (±0,1 нм) и/или индуцируют или принимают участие в образовании упакованных бислоев размером порядка 3,4-4,1 нм с расстоянием между бислоями в стопе, приблизительно, 2 нм, и/или индуцируют или принимают участие в образовании пузырьковых (везикулярных) структур размером, приблизительно, 38 нм).

Более того, предполагается, что пары аминокислот могут проявлять одно или более следующих физиологически релевантных свойств:

1. Они конвертируют провоспалительные HDL в противовоспалительные или делают противовоспалительные HDL еще более противовоспалительными.

2. Они снижают индуцированную LDL хемотактическую активность моноцитов, вызванную клетками артериальной стенки.

3. Они стимулируют образование и циклинг пре-β HDL.

4. Они повышают содержание холестерина HDL; и/или

5. Они повышают параоксоназную активность HDL.

Пары аминокислот можно вводить по отдельности (последовательно или одновременно, например, в составе комбинированного препарата), или их можно ковалентно связать друг с другом, непосредственно или через линкер (например, линкер PEG, углеродный линкер, ветвистый линкер, линкер в виде неразветвленной цепи, гетероциклический линкер, линкер, сформированный из дериватизированного липида и т.д.). В соответствии с некоторыми аспектами пары аминокислот ковалентно связывают друг с другом пептидной связью, образуя дипептид. В соответствии с некоторыми аспектами изобретения, хотя дипептид, как правило, содержит две аминокислоты с прикрепленной защитной группой на каждой, в область настоящего изобретения подпадают также дипептиды, в которых только одна аминокислота содержит одну или более защитных групп.

Пары аминокислот, как правило, содержат такие аминокислоты, каждая из которых связана по меньшей мере с одной защитной группой (например, как описано здесь, с гидрофобной защитной группой). Аминокислоты могут быть в D- или L-форме. В соответствии с некоторыми аспектами, если составляющие пары аминокислоты не связаны друг с другом, каждая из них может содержать по две защитные группы (например, такие как молекулы 1 и 2 в таблице 9).

Таблица 9
Иллюстрация пар аминокислот настоящего изобретения
Пара аминокислот/дипептид
1. Boc-Arg-OtBu*
2. Boc-Glu-OtBu*
3. Boc-Phe-Arg-OtBu**
4. Boc-Glu-Leu-OtBu**
5. Boc-Arg-Glu-OtBu***
* Обычно, такая молекула вводится совместно с другой аминокислотой.
** В соответствии с некоторыми аспектами настоящего изобретения, эти дипептиды могут вводиться друг с другом.
*** В соответствии с некоторыми аспектами настоящего изобретения, этот пептид можно вводить либо по отдельности, либо вместе с одним из других описанных здесь пептидов.

Подходящую пару аминокислот можно легко обнаружить. Для этого необходимо приготовить пару аминокислот и/или дипептид и затем провести ее скрининг на наличие одного или более физических и/или физиологических свойств, описанных выше. В соответствии с некоторыми аспектами настоящего изобретения пара аминокислот и/или дипептид содержит аспарагиновую кислоту и фенилаланин. В соответствии с некоторыми аспектами одна из входящих в состав пары аминокислот и/или дипептидов аминокислота - это (-)-N-[(транс-4-изопропилциклогексан)карбонил]-D-фенилаланин (натеглинид).

В соответствии с некоторыми аспектами составляющие пару аминокислоты независимо выбраны из группы, содержащей кислые аминокислоты (например, аспарагиновая аминокислота, глутаминовая аминокислота и т.д.), основные аминокислоты (например, лизин, аргинин, гистидин и т.д.), а также неполярные аминокислоты (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, триптофан, метионин и т.д.). В соответствии с некоторыми аспектами, если первая аминокислота кислая или основная, то вторая аминокислота неполярная, и если вторая аминокислота кислая или основная, то первая аминокислота неполярная. В соответствии с некоторыми аспектами изобретения, если первая аминокислота кислая, то вторая основная, и наоборот (см., например, таблицу 10).

Похожие комбинации можно получить, вводя пары дипептидов. Так, например, в соответствии с некоторыми аспектами, молекулы 3 и 4 таблицы 9 можно вводить совместно.

Таблица 10
Некоторые обобщенные пары аминокислот/дипептиды
Первая аминокислота Вторая аминокислота
1. Кислая Основная
2. Основная Кислая
3. Кислая Неполярная
4. Неполярная Кислая
5. Основная Неполярная
6. Неполярная Основная

Следует отметить, что указанные пары аминокислот/дипептиды приведены только для иллюстративных целей и не ограничивают область настоящего изобретения. С помощью приведенной здесь информации можно легко определить и другие подходящие пары аминокислот/дипептиды.

D) Apo-J (G* пептиды)

Одним из несомненных открытий настоящего изобретения стал тот факт, что пептиды, имитирующие амфипатические спиральные домены apo-J, могут ослаблять один или несколько симптомов атерослероза и/или других описанных здесь патологий. Аполипопротеин J имеет широкую неполярную грань, называемую глобулярным протеиноподобным, или G* амфипатическим спиральным доменом. Амфипатическая спираль класса G содержится в глобулярных протеинах, отсюда и название класса G. Этот класс амфипатической спирали характеризуется случайным распределением положительно и отрицательно заряженных остатков на полярной поверхности и узкой неполярной поверхностью. Из-за узости неполярной поверхности этот класс с трудом взаимодействует с фосфолипидами. Амфипатическая спираль G* обладает похожими, но не идентичными характеристиками. Подобно классу G, пептиды G* характеризуются случайным распределением положительно и отрицательно заряженных остатков на полярной поверхности. Однако в отличие от класса G с узкой неполярной поверхностью, пептиды этого класса характеризуются широкой неполярной поверхностью, позволяющей легко связываться с фосфолипидами, и потому соответствующий класс называется G*, чтобы показать его отличие от амфипатической спирали класса G.

В находящихся на рассмотрении патентных заявках описано большое количество подходящих амфипатических пептидов G* (USSN 10/120,508, подана 5 апреля 2002, USSN 10/520,207, подана 1 апреля 2003, и РСТ Application PCT/US 03/09988, подана 1 апреля 2003 года). Кроме того, подходящие пептиды настоящего изобретения, родственные амфипатическим спиральным доменам G* apo J, приведены в таблице 11.

Таблица 11
Предпочтительные пептиды для использования в соответствии с настоящим изобретением, родственные амфипатическим спиральным доменам G* apo J
Аминокислотная последовательность SEQ ID NO
LLEQLNEQFNWVSRLANLTQGE 444
LLEQLNEQFNWVSRLANL 445
NELQEMSNQGSKYVNKEIQNAVNGV 446
IQNAVNGVKQIKTLIEKTNEE 447
RKTLLSNLEEAKKKKEDALNETRESETKLKEL 448
PGVCNETMMALWEECK 449
PCLKQTCMKFYARVCR 450
ECKPCLKQTCMKFYARVCR 451
LVGRQLEEFL 452
MNGDRIDSLLEN 453
QQTHMLDVMQD 454
FSRASSIIDELFQD 455
PFLEMIHEAQQAMDI 456
PTEFIREGDDD 457
RMKDQCDKCREILSV 458
PSQAKLRRELDESLQVAERLTRKYNELLKSYQ 459
LLEQLNEQFNWVSRLANLTEGE 460
DQYYLRVTTVA 461
PSGVTEVVVKLFDS 462
PKFM ETVAEKALQEYRKKHRЕ 463

Пептиды настоящего изобретения, однако, не ограничены G*-вариантами apoJ. В общем случае, подходят также G*-домены практически любого подходящего протеина, предпочтительно, апо-протеины. Особые преимущества таких протеинов легко можно определить, проведя анализ защитной активности (например, защита LDL от окисления и т.п.), такой как показан здесь в разделе Примеры. Некоторые особенно предпочтительные протеины включают G*-амфипатические спиральные домены или их варианты (например, консервативные замены и т.п.) протеинов, включая, без ограничения указанным, аро AI, apo AIV, аро Е, аро СII, аро Cm и подобные им.

Некоторые предпочтительные пептиды, связанные с амфипатическими спиральными доменами G*, родственными апопротеинам, которые отличаются от аро J, приведены в таблице 12.

В таблице 13 приведены дополнительные иллюстративные примеры пептидов G*.

Другая серия подходящих пептидов включает, без ограничения указанным, приведенные в таблице 14.

Таблица 14
Примеры пептидов с улучшенной гидрофобной фазой
Название Последовательность SEQ ID NO
V2W3A5F1017-D-4F Ac-Asp-Val-Trp-Lys-Ala-Ala-Tyr-Asp-Lys-Phe-Ala-Glu-Lys-Phe-Lys-Glu-Phe-Phe-NH2 601
V2W3F10-D-4F Ac-Asp-Val-Trp-Lys-Ala-Phe-Tyr-Asp-Lys-Phe-Ala-Glu-Lys-Phe-Lys-Glu-Ala-Phe-NH2 602
W3-D-4F Ac-Asp-Phe-Trp-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Phe-Lys-Glu-Ala-Phe-NH2 603

Описанные здесь пептиды (V2W3 A5F10, 17-D-4F; V2W3F10-D-4F; W3-D-4F) могут быть даже более активными, чем исходный пептид D-4F.

Другие подходящие пептиды включают, без ограничения указанным Р1-диметилтирозин-D-Аrg-Phе-Lys-Р2 (SEQ ID NO:604) и Р1-диметилтирозин-Аrg-Gly-Leu-Р2, где Р1 и Р2 представляют собой описанные здесь защитные группы. В соответствии с некоторыми аспектами изобретения эти пептиды включают, без ограничения указанным, Вос-диметилтирозин-D-Аrg-Phе-Lys(OtBu) and Вос-диметилтирозин -Arg-Glu-Leu(OtBu).

В соответствии с некоторыми аспектами пептиды настоящего изобретения включают, без ограничения указанным, такие пептиды, которые содержат или состоят из аминокислотной последовательности LAEYHAK (SEQ ID NO:605), включающей по меньшей мере одну D-аминокислоту и по меньшей мере одну или две терминальные защитные группы. В соответствии с некоторыми аспектами настоящее изобретение относится к пептиду А, облегчающему по меньшей мере один симптом воспалительных состояний, где: длина пептида колеблется, приблизительно, от 3 до 10 аминокислотных остатков; аминокислотная последовательность пептида включает кислые или основные остатки, чередующиеся с ароматическими или гидрофобными остатками; пептид содержит гидрофобные терминальные аминокислоты или терминальные аминокислоты, несущие гидрофобные защитные группы; он не представляет собой последовательность LAEYHAK (SEQ ID NO:606), все аминокислотные остатки которой находятся в L-форме; этот пептид конвертирует провоспалительные HDL в противовоспалительные или делает противовоспалительные HDL еще более противовоспалительными.

Следует отметить, что приведенные таблицы с пептидами не являются исчерпывающими. Используя приведенную в заявке информацию, можно получить обычными способами и другие подходящие пептиды (например, можно выполнить консервативные или полуконсервативные замены (например, заменить D на Е), вставки, удаления и т.д.). Так, например, в соответствии с одним аспектом изобретения можно выполнить усечение одного или нескольких пептидов с номерами SEQ ID Nos:444-472.

Подходят также более длинные пептиды. Они могут полностью формировать амфипатическую спираль класса G или G*, или такая спираль (спирали) могут формироваться одним или несколькими доменами пептида. Настоящее изобретение направлено также и на многомерные версии пептидов. Например, пептиды из таблицы можно соединить, непосредственно или через линкер (такой как углеродный линкер или одна или более аминокислот), содержащий одну или несколько промежуточных аминокислот. Подходящие линкеры включают, без ограничения указанным, пролин(-Pro-), Gly4Ser3 (SEQ ID NO: 607), (Gly4Ser)3 (SEQ ID NO: 608) и подобные. Примером многомерных пептидов настоящего изобретения является (D-J336)-P-(D-J336) (i.e. Ac-L-L-E-Q-L-N-E-Q-F-N-W-V-S-R-L-A-N-L-T-Q-G-E-P-L-L-E-Q-L-N-E-Q-F-N-W-V-S-R-L-A-N-L-T-Q-G-E-NH2, SEQ ID NO:609).

Настоящее изобретение относится также к "гибридным" пептидам, содержащим по меньшей мере один G или G* амфипатический спиральный домен и по меньшей мере одну амфипатическую спираль класса А. Подходящие амфипатические спиральные пептиды класса А описаны в патенте РСТ publication WO 02/15923. Так, примером "гибридного" пептида является (D-J336)-Pro-(4F) (то есть Ac-L-L-E-Q-L-N-E-Q-F-N-W-V-S-R-L-A-N-L-T-Q

-G-E-P-D-W-F-K-A-F-Y-D-K-V-A-E-K-F-K-E-A-F-NH2, SEQ ID NO:610) и подобные им.

Используя приведенную информацию, компетентный специалист в данной области легко может модифицировать приведенные для примера амфипатические спиральные пептиды, получив другие подходящие варианты apoJ и/или амфипатических G и/или А спиральных пептидов настоящего изобретения. Например, можно осуществить стандартные консервативные или полуконсервативные замены (например, Е на D) существующих аминокислот. Для предсказания влияния различных замен на сродство полученного пептида к липидам можно воспользоваться компьютерным методом, описанным в работе Palgunachari et al. (1996) Arteriosclerosis, Thrombosis, & Vascular Biology 16: 328-338. Пептиды можно удлинять или укорачивать, главное, сохранять при этом класс спиральной структуры (структур). Можно также вводить замены, повышающие сходство пептида с эндогенными пептидами, производимыми самим организмом.

Хотя, в соответствии с предпочтительными аспектами изобретения в пептидах настоящего изобретения используются природные аминокислоты или D-формы природных аминокислот, к области настоящего изобретения относятся также и аминокислоты, не встречающиеся в природе (например, метионинсульфоксид, метионинметилсульфониум, норлейцин, эпсилон-аминокапроновая кислота, 4-аминобутановая кислота, тетрагидроизохинолин-3-карбоновая кислота, 8-аминокаприловая кислота, 4-аминомасляная кислота, Lys(N(эпсилон)-трифторацетил), α-аминоизомасляная кислота и подобные им).

Для конструирования и/или оценки новых пептидов могут использоваться компьютерные методы. Компьютерные программы для идентификации и классификации амфипатических спиральных доменов хорошо известны специалистам в данной области, многие из них описаны в работе Jones et al. (1992) J. Lipid Res. 33: 287-296). Такие программы включают, без ограничения указанным, программы спирального колеса (WHEEL или WHEEL/SNORKEL), спиральные сетевые программы (HELNET, HELNET/SNORKEL,HELNET/Angle), программы по присоединению спиральных колес (COMBO или COMBO/SNORKEL), программы для присоединения спиральных сетей (COMNET, COMNET/SNORKEL, COMBO/SELECT, COMBO/NET), консенсусные программы колес (CONSENSUS, CONSENSUS/SNORKEL) и подобные им.

Е) Блокирующие группы и D-остатки.

Различные пептиды и/или пары аминокислот настоящего изобретения могут быть без защитных групп, но в некоторых аспектах (в особенности, для перорального введения) они могут содержать одну, две, три, четыре или более защитных групп. Защитные группы могут быть сопряжены с С- или N-концами пептида (пептидов) и/или с одним или более внутренними остатками, содержащими пептид (пептиды) (например, можно заблокировать одну или более R-групп аминокислот). Так, например, в соответствии с некоторыми аспектами настоящего изобретения, любой описанный здесь пептид может содержать, например, защищающую амино-конец ацетильную группу и/или защищающую карбоксильный конец амидную группу. Примером такого "пептида с двойной защитой" является Ac-L-L-E-Q-L-N-E-Q-F-N-W-V-S-R-L-A-N-L-T-Q-G-E-NH2, причем любую или обе защитные группы можно удалить или заменить другой описанной здесь защитной группой.

Вне связи с какой-либо конкретной теорией открытием настоящего изобретения является тот факт, что блокировка, в особенности, амино- и/или карбоксильного конца пептидов настоящего изобретения, существенно улучшает пероральную доставку и значительно повышает период полураспада в сыворотке.

Для этой цели доступно большое количество защитных групп. Такие группы включают, без ограничения указанным, ацетильные, амидные и алкильные группы, причем ацетильные и алкильные группы особенно предпочтительны для защиты N-конца, а амидные группы особенно предпочтительны для защиты карбоксильного конца. В соответствии с некоторыми предпочтительными аспектами защитные группы включают, без ограничения указанным, такие алкильные цепи, как жирные кислоты, пропеонил, формил и другие. Особенно предпочтительные карбоксил-защитные группы включают амиды, сложные эфиры и группы, образующие простые эфиры. В соответствии с одним предпочтительным аспектом изобретения ацетильная группа используется для защиты амино-конца, а амидная группа для защиты карбоксильного конца. Эти защитные группы усиливают тенденции пептидов к образованию спиралей. Некоторые особенно предпочтительные блокирующие группы включают алкильные группы различной длины, например, группы формулы СН3-(СН2)n-СО-, где n колеблется от 1 до, приблизительно, 20, предпочтительно, от 1 до, приблизительно, 16 или 18, более предпочтительно, приблизительно, от 3 до 13, наиболее предпочтительно, приблизительно, от 3 до 10.

В соответствии с некоторыми предпочтительными аспектами защитные группы включают, без ограничения указанным, такие алкильные цепи, как жирные кислоты, пропеонил, формил и другие. Особенно предпочтительные карбоксил-защитные группы включают амиды, сложные эфиры и группы, образующие простые эфиры. В соответствии с одним предпочтительным аспектом изобретения ацетильная группа используется для защиты амино-конца, а амидная группа для защиты карбоксильного конца. Эти защитные группы усиливают тенденции пептидов к образованию спиралей. Некоторые особенно предпочтительные блокирующие группы включают алкильные группы различной длины, например, группы формулы СН3-(СН2)n-СО-, где n колеблется от 1 до, приблизительно, 20, предпочтительно, от 1 до, приблизительно, 16 или 18, более предпочтительно, приблизительно, от 3 до 13, наиболее предпочтительно, приблизительно, от 3 до 10.

Другие защитные группы включают, без ограничения указанным, Fmoc, трет-бутоксикарбонил (t-BOC), 9-флуоренацетильную группу, 1-флуоренкарбоксильную группу, 9-флуоренкарбоксильную группу, 9-флуоренон-1-карбоксильную группу, бензилоксикарбонил, ксантил (Xan), тритил (Trt), 4-метилтритил (Mtt), 4-метокситритил (Mmt), 4-метокси-2,3,6-триметилбензолсульфонил (Mtr), мезитилен-2-сульфонил (Mts), 4,4-диметоксибензгидрил (Mbh), тозил (Tos), 2,2,5,7,8-пентаметил хроман-6-сульфонил (Pmc), 4-метилбензил (MeBzl), 4-метоксибензил (MeOBzl), бензилокси (BzlO), бензил (Bzl), бензоил (Bz), 3-нитро-2-пиридинсульфенил(Npys), 1-(4,4-диметил-2,6-диоксоциклогексилиден)этил (Dde), 2,6-дихлорбензил (2,6-диСl-Вzl), 2-хлорбензилоксикарбонил (2-Cl-Z), 2-бромбензилоксикарбонил (2-Br-Z), бензилоксиметил (Bom), циклогексилокси (сНхО), трет-бутоксиметил (Bum), трет-бутокси (tBuO), трет-бутил (tBu), ацетил (Ас) и трифторацетил (TFA).

Защитные/блокирующие группы хорошо известны специалистам в данной области. Известны также и методы сопряжения этих групп с соответствующими остатками, включая пептиды настоящего изобретения (см., например, Greene et al., (1991) Protective Groups in Organic Synthesis, 2nd ed., John Wiley & Sons, Inc. Somerset, N.J.). В соответствии с одним предпочтительным аспектом, например, ацетилирование выполняется на этапе синтеза, когда пептид находится на смоле, с использованием ангидрида кислоты. Для введения амидной защиты необходимо выбрать правильную смолу для синтеза. При синтезе пептидов, описанных в примерах, использовалась каточная амидная смола. По завершении синтеза все полуперманентные защитные группы на кислых бифункциональных аминокислотах, таких как Asp и Glu, и на основной аминокислоте Lys, а также на гидроксиле Tyr, одновременно удалялись. В результате обработки кислотой пептиды сходят со смолы с защищенным N-концом (в виде ацетила) и карбоксильным концом (в виде NH2), все остальные защитные группы удаляются одновременно со сходом со смолы.

В соответствии с некоторыми особенно предпочтительными аспектами изобретения пептиды содержат одну или более D-аминокислот, как описано в настоящей заявке. В соответствии с некоторыми аспектами, в D-форме находится по меньшей мере две энантиомерные аминокислоты, более предпочтительно по меньшей мере четыре аминокислоты, наиболее предпочтительно по меньшей мере 8 или 10 энантиомерных аминокислот. В соответствии с некоторыми аспектами все энантиомерные аминокислотные остатки описанных здесь пептидов находятся в D-форме.

В соответствии с некоторыми аспектами настоящего изобретения по меньшей мере 50% энантиомерных аминокислот находится в D-форме, более предпочтительно, по меньшей мере 80%, наиболее предпочтительно, по меньшей мере 90% или даже все энантиомерные аминокислоты находятся в D-форме.

F) Пептидомиметики

Помимо описанных здесь пептидов, изобретение охватывает также и пептидомиметики. Обычно используемые в фармацевтической промышленности аналоги пептидов представляют собой непептидные вещества, свойства которых аналогичны свойствам пептида-основы (образец). Такие типы непептидных соединений называются "пептидомиметиками" (Fauchere (1986) Adv. Drug Res. 15: 29; Veber and Freidinger (1985) TINS p.392; and Evans et al. (1987) J. Med. Chem. 30: 1229), для их разработки, обычно, используют методы компьютеризованного молекулярного моделирования. Пептидомиметики, структурно похожие на применимые пептиды, могут использоваться для создания эквивалентного терапевтического или профилактического эффекта.

В общем случае, пептидомиметики структурно похожи на соответствующие пептиды (например, SEQ ID NO:5 таблицы 1), но одна или несколько пептидных связей в них могут быть замещены на связи, выбранные из следующей группы: -CH2NH-, -CH2S-, -CH2-CH2-, -CH=CH- (цис и транс), -СОСН2-, -СН(ОН)СН2-, -CH2SO-. Замещение осуществляется методами, известными в соответствующей области и подробно описанными в следующих работах: Spatola (1983) р.267 in Chemistry and Biochemistry of Amino Acids, Peptides, and Proteins, B. Weinstein, eds., Marcel Dekker, New York,; Spatola (1983) Vega Data 1(3) Peptide Backbone Modifications (общий обзор); Morley (1980) Trends Phartn Sd pp.463-468 (общий обзор); Hudson et at. (1979) Int J Pept Prot Res 14: 177-185 (-CH2NH-, CH2CH2-); Spatola et al. (1986) Life Sci 38: 1243-1249 (-CH2-S); Hann, (1982) / Chem Soc Perkin Trans 1307-314 (-CH-CH-, цис и транс); Almquist et al. (1980) J Med Chem. 23: 1392-1398 (-COCH2-); Jennings-White et ?/.(1982) Tetrahedron Lett. 23: 2533 (-COCH2-); Szelke et al., European Appln. EP 45665 (1982) CA: 97: 39405 (1982) (-CH(OH)CH2-); Holladay et al. (1983) Tetrahedron Lett 24: 4401-4404 (-C(OH)CH2-); and Hruby (1982) Life Scl, 31:189-199 (-CH2-S-)).

Одной особенно предпочтительной непептидной связью является -CH2NH-. Такие пептидомиметики могут обладать значительными преимуществами по сравнению с соответствующими полипептидами, включая, например, более экономичные способы получения, большая химическая стабильность, улучшенные фармакологические свойства (период полураспада, поглощение в организме, сила, эффективность и т.п.), сниженная антигенность и другие.

Кроме того, кольцевые перестановки описанных здесь пептидов, или связанные пептиды (включая циклические пептиды), содержащие обобщающую типичную последовательность или вариацию, в целом, идентичную обобщающей типичной последовательности, можно получить способами, известными в соответствующей области (Rizo and Gierasch (1992) Ann. Rev. Biochem. 61: 387), например, введением внутренних остатков цистеина, способных образовать внутримолекулярные дисульфидные мостики, циклизующие пептид.

G) Маленькие органические молекулы

В соответствии с некоторыми аспектами настоящего изобретения активные агенты настоящего изобретения включают маленькие органические молекулы, например, описанные в находящейся на рассмотрении заявке USSN 60/600,925, поданной 11 августа 2004. В соответствии с различными аспектами маленькие органические молекулы напоминают и, в некоторых случаях, имитируют тетра- и пентапептиды, описанные в находящейся на рассмотрении заявке USSN 10/649,378, поданной 26 августа 2003, и USSN 60/494,449, поданной 11 августа.

Молекулярный вес маленьких органических молекул настоящего изобретения, как правило, меньше приблизительно 900 дальтон. Как правило, такие молекулы хорошо растворимы в этилацетате (например, в концентрации не менее 4 мг/мл), а также растворимы в водном буфере при рН 7,0.

Взаимодействие фосфолипидов, таких как 1,2-димиристоил-sn-глицеро-3-фосфохолин (DMPC), с маленькими органическими молекулами настоящего изобретения в водной среде, как правило, приводит к образованию частиц диаметром, приблизительно, 7,5 нм (±0,1 нм). Помимо этого, часто образуются упакованные бислои с размером слоя порядка 3,4-4,1 нм и с расстоянием между слоями в стопе, приблизительно, 2 нм. Часто образуются также везикулярные структуры размером, приблизительно, 38 нм. Более того, когда молекулы настоящего изобретения вводят млекопитающему, они делают HDL более противовоспалительными и облегчают один или несколько симптомов атеросклероза и/или других состояний, характеризующихся воспалительным ответом.

Таким образом, в соответствии с некоторыми аспектами настоящего изобретения маленькая органическая молекула описывает вещество, которое уменьшает выраженность одного или нескольких симптомов патологии, характеризующейся воспалительными реакциями у млекопитающих (например, атеросклероза), причем это вещество растворимо в этилацетате в концентрации более 4 мг/мл, растворимо в водном буфере при рН 7,0 и при взаимодействии с фосфолипидами в водной среде формирует частицы диаметром приблизительно 7,5 нм, и упакованные бислои с размером слоя порядка 3,4-4,1 нм и с расстоянием между слоями в стопе приблизительно 2 нм, а также характеризуется молекулярным весом менее чем 900 Дальтон.

В соответствии с некоторыми аспектами молекула имеет следующую формулу:

.

где Р1, Р2, Р3 и Р4 представляют собой выбранные независимо гидрофобные защитные группы; R1 и R4 - выбранные независимо аминокислотные R-группы; n, i, х, y и z независимо принимают значение 0 или 1, так что, когда n=х=0, R1 - гидрофобная группа; и когда y=i=0, то R4 - гидрофобная группа; R2 и R3 - кислые или основные группы при рН 7,0, так что, если R2 - кислая, то R3 - основная, и если R2 - основная, то R3 - кислая; а R5 при ее наличии выбрана из группы, включающей ароматическую группу, алифатическую группу, положительно заряженную группу и отрицательно заряженную группу. В соответствии с некоторыми аспектами изобретения R2 или R3 представляет собой -(СН2)j-СООН, где j=1, 2, 3 или 4 и/или -(CH2)j-NH2, где j=1, 2, 3, 4 или 5, или -(CH2)j-NH-C(=NH)-NH2, где n=1, 2, 3 или 4. В соответствии с некоторыми аспектами группы R2, R3 и R5, при наличии, представляют собой кислые аминокислотные R-группы. Так, например, в соответствии с различными аспектами R2 и R3 независимо представляют собой аспарагиновую аминокислотную R-группу, глутаминовую аминокислотную R-группу, лизиновую аминокислотную R-группу, гистидиновую аминокислотную R-группу или аргининовую аминокислотную R-группу (как показано в таблице 1).

В соответствии с некоторыми аспектами R1 выбран из группы, включающей R-группу Lys, R-группу Trp, R-группу Phe, R-группу Leu, R-группу Orn, или R-группу norLeu. В соответствии с некоторыми аспектами R4 выбран из группы, содержащей R-группу Ser, R-группу Thr, R-группу IIe, R-группу Leu, R-группу norLeu, R-группу Phe, или R- группу Tyr.

В соответствии с различными аспектами х=1, а R5 представляет собой ароматическую группу (например, R-группу Trp). В соответствии с различными аспектами, по меньшей мере одна из переменных n, x, y и i равна 1, а Р1, Р2, Р3 и Р4, если они присутствуют, независимо выбраны из группы, включающей полиэтиленгликоль (PEG), ацетил, амид, алкильную группу, содержащую от 3 до 20 атомов углерода, Fmoc, 9-флуоренацетильную группу, 1-флуоренкарбоксильную группу, 9-флуоренкарбоксильную, 9-флуоренон-1-карбоксильную группу, бензилоксикарбонил, ксантил (Xan), тритил (Trt), 4-метилтритил (Mtt), 4-метокситритил (Mtt), 4-метокси-2,3,6-триметилбензолсульфонил (Mtr), мезитилен-2-сульфонил (Мts), -4,4-диметоксибензгидрил (Мbh), Тозил (Tos), 2,2,5,7,8-пентаметил хроман-6-сульфонил (Рmc), 4-метилбензил (MeBzl), 4-метоксибензил (MeOBzl), бензилокси (BzlO), бензил (Bzl), бензоил (Bz), 3-нитро-2-пиридинсульфенил (Npys), 1-(4,4-диметил-2,6-диоксоциклогексилиден)этил (Dde), 2,6-дихлорбензил (2,6-диСl-Вzl), 2-хлорбензилоксикарбонил (2-Cl-Z), 2-бромбензилоксикарбонил (2-Br-Z), бензилоксиметил (Воm), трет-бутоксикарбонил (Воc), циклогексилокси (сН×О), трет-бутоксиметил (Bum), трет-бутокси (tBuO), трет-бутил (tBu), пропильную группу, а бутильную группу, пентильную группу, гексильную группу и трифторацетил (TFA). В соответствии с некоторыми аспектами, Р1, при наличии, и/или Р2, при наличии, независимо выбраны из группы, включающей Воc-, Fmoc-, и никотинил-, и/или Р3, при наличии и/или Р4, при наличии, независимо выбраны из группы, включающей tBu и OtBu.

Хотя здесь было приведено большое количество защитных групп (Р1, Р2, Р3, Р4), этот список приводится только для иллюстрации и не является ограничивающим. В свете приведенной в заявке информации компетентный в соответствующей области специалист легко сможет определить другие защитные/блокирующие группы. Можно выбрать такие группы, которые позволяют минимизировать разложение препарата в желудочно-кишечном тракте (например, при пероральном фармацевтическом способе введения) и/или повысить поглощение/биодоступность (например, через мукозальные поверхности при назальном или ректальном способе введения или при ингаляции) и/или увеличить период полураспада в сыворотке/плазме. В соответствии с некоторыми аспектами защитные группы можно вводить как наполнитель или как компонент наполнителя.

В соответствии с некоторыми аспектами изобретения z=0, и молекула соответствует формуле:

где Р1, Р2, Р3, Р4, R1, R2, R3, R4, n, x, y и I описаны выше.

В соответствии с некоторыми аспектами изобретения, z=0, и молекула соответствует формуле:

.

где R1, R2, R3 и R4 описаны выше.

В соответствии с одним аспектом молекула соответствует формуле:

В соответствии с некоторыми аспектами настоящее изобретение относится к маленьким молекулам, характеризующимся одним или несколькими описанными здесь физическими и/или функциональными свойствами и соответствующими формуле:

где Р1, Р2, Р3 и Р4 представляют собой описанные выше независимо выбранные гидрофобные защитные группы, n, x и у независимо принимают значения 0 или 1; j, k и I независимо принимают значения 0, 1, 2, 3, 4 или 5; R2 и R3 представляют собой кислые или основные группы при рН 7,0, так что, если R2 - кислая, то R3 - основная, и если R2 - основная, то R3 - кислая. В соответствии с некоторыми предпочтительными аспектами, маленькие молекулы растворимы в воде; и их молекулярный вес меньше 900 Дальтон. В соответствии с некоторыми аспектами значения n, x, у, j и I равны 1; а k=4.

В соответствии с некоторыми аспектами, Р1 и/или Р2 представляют собой ароматические защитные группы. В соответствии с некоторыми аспектами, R2 и R3 - аминокислотные R-группы, например, как описано выше. В соответствии с различными аспектами, по крайней мере одна переменная n, х или у равна 1, а Р1, Р2, Р3 и Р4 при их наличии независимо представляют собой защитные группы, например, как описано выше, выбранные из числа следующих: полиэтиленгликоль (PEG), ацетил, амид, алкильная группа, содержащая от 3 до 20 атомов углерода, Fmoc, 9-флуоренацетильная группа, 1-флуоренкарбоксильная группа, 9-флуоренкарбоксильная, 9-флуоренон-1-карбоксильная группа, бензилоксикарбонил, ксантил (Хаn), тритил (Trt), 4-метилтритил (Mtt), 4-метокситритил (Mmt), 4-метокси-2,3,6-триметилбензолсульфонил (Mtr), мезитилен-2-сульфонил (Мts), -4,4-диметоксибензгидрил (Mbh), тозил (Tos), 2,2,5,7,8-пентаметил хроман-6-сульфонил (Рms), 4-метилбензил (MeBzl), 4-метоксибензил (MeOBzl), бензилокси (BzlO), бензил (Bzl), бензоил (Bz), 3-нитро-2-пиридинсульфенил (Npys), 1-(4,4-диметил-2,6-диоксоциклогексилиден)этил (Dde), 2,6-дихлорбензил (2,6-диСl-Вzl), 2-хлорбензилоксикарбонил (2-Cl-Z), 2-бромбензилоксикарбонил (2-Br-Z), бензилоксиметил (Воm), трет-бутоксикарбонил (Воc), циклогексилокси (сНхО), трет-бутоксиметил (Bum), трет-бутокси (tBuO), трет-бутил (tBu), пропильную группу, а бутильную группу, пентильную группу, гексильную группу и трифторацетил (TFA).

II. Функциональный анализ активных агентов.

Некоторые активные агенты, используемые в способах настоящего изобретения, описаны здесь различными формулами (например, приведенная выше формула I) и/или конкретными последовательностями. В соответствии с некоторыми аспектами, предпочтительные активные агенты настоящего изобретения можно охарактеризовать одним или несколькими следующими функциональными признаками:

1. Они конвертируют провоспалительные HDL в противовоспалительные или делают противовоспалительные HDL еще более противовоспалительными.

2. Они снижают индуцированную LDL хемотактическую активность моноцитов, вызванную клетками стенок артерии.

3. Они стимулируют образование и циклинг пре-β HDL.

4. Они повышают содержание HDL-холестерина и/или

5. Они повышают HDL-параоксоназную активность.

Конкретные описанные здесь агенты и/или агенты, соответствующие различным описанным здесь формулам, можно при необходимости протестировать на наличие одной или нескольких типов указанной активности.

Методы проверки каждого функционального свойства хорошо известны компетентным специалистам в данной области. В особенности, следует отметить, что методы анализа хемотактической активности моноцитов, HDL-холестерина и HDL-параоксоназной активности проиллюстрированы в патенте PCT/USOI/26497 (WO 2002/15923).

III. Получение пептидов.

Пептиды настоящего изобретения можно химически синтезировать стандартными методами химического синтеза пептидов, или, особенно, если пептиды не содержат D-аминокислотных остатков, их можно экспрессировать рекомбинантно. В соответствии с некоторыми направлениями реализации изобретения рекомбинантно экспрессируют даже пептиды, содержащие D-аминокислотные остатки. В этом случае организм-носитель (например, бактерия, растение, грибковые культуры и т.д.) культивируются в окружении, в котором одна или несколько аминокислот содержатся исключительно в D-форме. В такой системе пептиды, экспрессируемые рекомбинантно, будут содержать эти аминокислоты.

В соответствии с предпочтительными аспектами изобретения пептиды химически синтезируются любым из множества известных компетентным специалистам методов жидкофазного или твердофазного пептидного синтеза. Твердофазный синтез, при котором С-терминальная аминокислота последовательности прикрепляется к нерастворимому носителю с последовательным добавлением остальных аминокислот последовательности, является предпочтительным методом химического синтеза полипептидов настоящего изобретения. Методы твердофазного синтеза хорошо известны компетентным специалистам в данной области и описаны, например, в работах Barany and Merrifield (1963) Solid-Phase Peptide Synthesis; pp.3-284 in The Peptides: Analysis, Synthesis, Biology. Vol.2: Special Methods in PeptideSynthesis, Part A.; Merrifield et al. (1963) J. Am. Chem. Soc, 85: 2149-2156, and Stewart et al. (1984) Solid Phase Peptide Synthesis, 2nd ed. Pierce Chem. Co., Rockford, I11.

В соответствии с некоторыми аспектами настоящего изобретения пептиды синтезируются методами твердофазного пептидного синтеза с использованием бензгидриламиновой смолы (Beckman Bioproducts, 0,59 ммоль NH2/г смолы) в качестве твердого носителя. СООН-терминальная аминокислота (например, трет-бутилкарбонил-Phe) прикрепляется к твердому носителю с помощью 4-оксиметилфенацетильной группы. Такая связь более стабильна, чем обычно используемая связь через бензиловый сложный эфир, и получившийся пептид все еще можно отщепить гидрированием. Для этой цели используется гидрирование с переносом, в качестве донора водорода применяется муравьиная кислота. Подробные протоколы пептидного синтеза и анализа получаемых пептидов описаны в приложении к работе Anantharamaiah et al. (1985) J. Biol. Chem., 260(16): 10248-10255.

Следует отметить, что при химическом синтезе пептидов, особенно, пептидов, содержащих D-аминокислоты, помимо продукта требуемой длины, обычно, образуется большое количество укороченных пептидов. Процесс очистки (например, методом HPLC), обычно, сопровождается потерей значительного количества требуемого продукта.

Открытием настоящего изобретения явился тот факт, что при синтезе D-пептида (например, D-4), для того, чтобы избежать связанных с очисткой длинной формы потерь, можно диализировать и использовать всю смесь и, таким образом, избежать этапа заключительной очистки HPLC. "Сила" (эффективность) такой смеси по сравнению с высокоочищенным продуктом снижается, приблизительно, на 50% (например, в пересчете на вес протеинового продукта), но, так как в этой смеси содержится в шесть раз больше пептида, общая активность существенно возрастает.

IV. Фармацевтические составы.

Для того чтобы осуществить способы настоящего изобретения, один или несколько агентов настоящего изобретения (например, пептиды, пептидомиметики, липиды) необходимо ввести, например, индивидууму с нарушением функции артериол или у которого функция артериол может быть нарушена (например, в мозге или в почках). Агенты (например, пептиды, пептидомиметики, липиды) можно вводить в "нативной" форме или, при необходимости, в форме солей, сложных эфиров, амидов, пролекарств, производных и т.д., если только соль, эфир, амид, пролекарство или производное подходит фармакологически, то есть эффективно в соответствии с настоящим способом. Соли, эфиры, амиды, пролекарства и другие производные активных агентов можно приготовить стандартными методами, известными специалистам, компетентным в синтетической органической химии, и описанными, например, в работе March (1992) Advanced Organic Chemistry; Reactions, Mechanisms and Structure, 4th Ed. N. Y. Wiley-Interscience.

Например, соли присоединения кислот получают из свободных оснований обычными методами, как правило, включающими реакцию с подходящей кислотой. В общем случае, основную форму лекарства растворяют в полярном органическом растворителе, таком как метанол или этанол, и в раствор добавляют кислоту. Полученная соль либо сразу выпадает в осадок, либо ее можно осадить, добавив менее полярный растворитель. Кислоты, подходящие для приготовления солей присоединения кислот, включают органические кислоты, например уксусная, пропионовая, гликолевая, пировиноградная, щавелевая, яблочная, малоновая, янтарная, малеиновая, фумаровая, винная, лимонная, бензойная, коричная, миндальная, метансульфоновая, этансульфоновая, пара-толуолсульфоновая, салициловая и т.д., и неорганические кислоты, например хлороводородная, бромоводородная, серная, азотная, фосфорная и т.д. Соль присоединения кислоты можно снова превратить в свободное основание добавлением подходящего основания. Особенно предпочтительными солями присоединения кислот активных агентов являются соли галогенидов, которые, например, могут быть получены с помощью хлороводородной или бромоводородной кислот. С другой стороны, основные соли агентов (например, пептидов или пептидомиметиков) готовят аналогично с помощью фармацевтически приемлемого основания, такого как гидроксид натрия, калия, аммония, кальция, триметиламин и т.д. Особенно предпочтительные основные соли включают соли щелочных металлов, например натриевую соль, а также соли меди.

Получение эфиров, как правило, включает функционализацию гидроксильной и/или карбоксильной групп, которые могут присутствовать в структуре молекулы лекарства. Сложные эфиры, как правило, представляют собой ацилзамещенные производные свободных спиртовых групп, то есть это группы, полученные из карбоновых кислот формулы RCOOH, где R представляет собой алкил, предпочтительно, низший алкил. Эфиры можно при желании снова конвертировать в свободные кислоты с использованием обычных процедур гидрогенолиза или гидролиза.

Амиды и пролекарства также готовят способами, известными компетентным специалистам или описанными в соответствующей литературе. Например, амиды можно приготовить из эфиров с помощью подходящих аминов или из ангидрида или хлорангидрида кислоты реакцией с аммиаком или низшим алкиламином. Пролекарства обычно готовят ковалентно присоединяя какую-либо группу с образованием соединения, терапевтически неактивного до модификации в результате метаболизма в организме индивидуума.

Описанные здесь агенты (например, пептиды, пептидомиметики, липиды) эффективны при парентеральном, топическом, пероральном, назальном (или с использованием другой формы ингаляции), ректальном или местном введении (с использованием аэрозолей или трансдермально) для профилактического и/или терапевтического лечения атеросклероза и/или его сиптомов. Фармацевтические композиции можно вводить в виде разнообразных дозированных лекарственных форм, в зависимости от способа введения. Подходящие дозированные формы включают, без ограничения указанным, порошки, таблетки различных видов, пилюли, капсулы, суппозитории, пластыри, назальные спреи, составы для инъекций, имплантируемые системы с замедленным выделением активного вещества, липидные комплексы и т.д.

Для приготовления фармацевтической композиции агенты (например, пептиды, пептидомиметики и/или липиды) настоящего изобретения, как правило, комбинируют с фармацевтически приемлемым носителем (наполнителем). Фармацевтически приемлемые носители могут содержать одно или более фармацевтически приемлемых соединений, которые, например, стабилизируют композицию или повышают/понижают абсорбцию активных агентов (агента). Физиологически приемлемые соединения могут включать, например, углеводороды (такие как глюкоза, сахароза или декстраны), антиоксиданты (такие как аскорбиновая кислота или глютатион), хелатирующие вещества, протеины с низким молекулярным весом, блокирующие и усиливающие усвоение вещества (такие как липиды), композиции, уменьшающие разложение или гидролиз активных агентов, а также наполнители или другие стабилизаторы и/или буферы.

Другие физиологически приемлемые соединения включают увлажнители, эмульгаторы, диспергирующие агенты или консерванты, особенно эффективные для предотвращения роста или деятельности микроорганизмов. Различные консерванты хорошо известны и включают, например, фенол и аскорбиновую кислоту. Компетентный специалист понимает, что выбор фармацевтически приемлемого носителя (носителей), включая физиологически приемлемые соединения, зависит, например, от способа введения активного агента (агентов) и от его (их) конкретных физико-химических характеристик.

Предпочтительно, чтобы наполнители были стерильными. В общем случае, в них отсутствуют нежелательные примеси. Эти композиции могут быть стерилизованы обычными, хорошо известными способами.

В терапевтических целях композиции настоящего изобретения вводят пациенту с одним или несколькими симптомами атеросклероза, или у которого эти симптомы могут возникнуть, в количестве, достаточном для лечения или, по крайней мере, для частичного предотвращения или приостановки заболевания и/или его осложнений. Количество, достаточное для достижения этой цели, называется "терапевтически эффективной дозой". Эффективное количество агента зависит от тяжести заболевания и от общего состояния здоровья пациента. Допустимы однократные или многократные введения композиции, в зависимости от того, какая дозировка и частота необходима пациенту и переносится им. В любом случае композиция должна доставлять достаточное количество активных агентов составов настоящего изобретения, чтобы эффективно вылечить (ослабить) один или несколько симптомов у пациента.

Концентрация агента может колебаться в широких пределах, и определяется, в основном, с учетом объемов жидкости, вязкости, веса тела и т.п. в соответствии с конкретным выбранным способом введения и потребностями пациента. Однако, как правило, концентрации агентов выбирают так, чтобы пациент получал дозу, приблизительно, от 0,1 или 1 мг/кг/день до 50 мг/кг/день или несколько больше. Типичные дозировки колеблятся, приблизительно, от 3 мг/кг/день до 3,5 мг/кг/день, предпочтительно, приблизительно, от 3,5 мг/кг/день до 7,2 мг/кг/день, более предпочтительно, приблизительно, от 7,2 мг/кг/день до 11,0 мг/кг/день, наиболее предпочтительно, приблизительно, от 11,0 мг/кг/день до 15 мг/кг/день. В соответствии с некоторыми предпочтительными аспектами изобретения доза колеблется, приблизительно, от 10 мг/кг/день до 50 мг/кг/день. В соответствии с некоторыми аспектами дозировка колеблется от 20 до 50 мг дважды в день, принимаемые перорально. Необходимо понимать, что такие дозировки можно менять, чтобы оптимизировать терапевтический режим для конкретного пациента или группы пациентов.

В соответствии с некоторыми предпочтительными аспектами пептиды, пептидомиметики и/или липиды настоящего изобретения вводят перорально (например, в виде таблетки) или в виде инъекций в соответствии со стандартными методами, хорошо известными специалистам в соответствующей области. В соответствии с другими предпочтительными аспектами, агент (агенты) можно вводить через кожу с помощью традиционных чрескожных систем доставки лекарств, то есть чрескожных "пластырей", где активный агент (агенты), как правило, содержится в ламинированной структуре, которая закрепляется на коже и является приспособлением для доставки лекарства. В такой структуре лекарственная композиция, как правило, содержится внутри слоя, или "резервуара", находящегося под верхним защитным слоем. Необходимо понимать, что термин "резервуар" в данном контексте означает количество "активных ингредиентов", доступных для доставки через поверхность кожи. Так, например, резервуар может содержать активные агенты в составе клея, нанесенного на защитный слой пластыря, или в составе любой из многочисленных матриц, известных компетентным специалистам в данной области. Пластырь может содержать один или несколько резервуаров.

В соответствии с одним аспектом изобретения резервуар содержит полимерную матрицу фармацевтически приемлемого контактного адгезивного материала, фиксирующего систему на коже при доставке лекарства. Примеры подходящих кожных контактных адгезивных материалов включают, без ограничения указанным, полиэтилены, полисилоксаны, полиизобутилены, полиакрилаты, полиуретаны и подобные вещества. С другой стороны, содержащий лекарство резервуар и кожный контактный адгезивный материал могут представлять собой различные слои, причем адгезивный слой находится под резервуаром, который в данном случае может представлять собой либо описанную выше полимерную матрицу, либо представлять собой жидкость или гидрогель, либо принимать какую-либо другую форму. Защитный слой в таких ламинатах, представляющий собой верхнюю поверхность приспособления, предпочтительно, является первичным структурным элементом "пластыря" и придает гибкость всему приспособлению. Выбираемый для защитного слоя материал, предпочтительно, непроницаем для активных агентов и других присутствующих веществ.

Другие предпочтительные составы для топической доставки лекарств включают, без ограничения указанным, мази и кремы. Мази - это полутвердые препараты, как правило, основанные на вазелине и других производных нефти. Содержащие активный агент кремы, как правило, представляют собой вязкие жидкие или полутвердые эмульсии, часто типа масло-в-воде или вода-в-масле. Основы кремов, как правило, смываются водой и содержат фазу масла, эмульсификатор и водную фазу. Масляная фаза, часто называемая "внутренней", содержит, обычно, вазелин и жирный спирт, такой как цетиловый или стеариловый спирт; объем водной фазы, обычно (но не всегда), превышает объем масляной, и водная фаза, как правило, содержит увлажнитель. Эмульгатор в креме, как правило, представляет собой неионное, анионное, катионное или амфотерное поверхностно-активное вещество. Компетентному специалисту понятно, что конкретный состав мази или крема определяется так, чтобы обеспечить оптимальную доставку лекарства. Как и в случае остальных носителей, мази должны быть инертными, стабильными, нераздражающими и несенсибилизирующими.

В отличие от обычных пептидных составов пептиды настоящего изобретения, содержащие D-аминокислоты, можно вводить, даже перорально, без дополнительной защиты против протеолиза желудочным соком и т.д. Тем не менее, в соответствии с некоторыми аспектами настоящего изобретения, доставку пептидов можно улучшить с помощью защитных наполнителей. Как правило, для этого либо в полипептид включают композицию, делающую его устойчивым к кислотному и ферментативному гидролизу, либо помещают его в устойчивый к таким воздействиям носитель, такой как липосомы. Средства защиты полипептидов при пероральной доставке хорошо известны в соответствующей области (см., например, U.S. Patent 5,391,377, где описано использование липидных композиций для пероральной доставки терапевтических агентов).

Увеличения времени полураспада препарата в организме можно добиться с помощью систем "упаковки" протеинов с замедленным высвобождением. Такие системы хорошо известны специалистам в соответствующей области. В соответствии с одним предпочтительным аспектом может использоваться биодеградируемая основанная на микросферах система доставки протеинов и липидов ProLease (Tracy (1998) Biotechnol. Prog. 14: 108; Johnson et al. (1996), Nature Med. 2: 795; Herbert et al. (1998), Pharmaceut. Res. 15, 357). Она представляет собой сухой порошок из биодеградируемых полимерных микросфер, содержащих протеин в полимерной матрице, который можно использовать в виде сухого состава для введения с или без дополнительных агентов.

Процесс изготовления микросфер ProLease был спроектирован так, чтобы обеспечить высокую эффективность инкапсуляции протеинов при сохранении их целостности. Процесс включает: i) получение лиофилизированных частиц протеина из массы протеина путем распыления, предназначенного для лиофилизации раствора лекарства со стабилизирующими наполнителями; ii) получение суспензии лекарства в полимере с последующей обработкой ультразвуком или гомогенизацией для снижения размера частиц лекарства; iii) получение замороженных микросфер лекарства в полимере путем распыления в жидком азоте; iv) экстракцию полимерного растворителя в этаноле; и v) фильтрацию и вакуумную сушку для получения готового сухого продукта в виде порошка. Полученный порошок содержит твердую форму протеина, гомогенно и жестко диспергированную в порах частиц полимера. Чаще всего используемый в описанном процессе полимер, полилактид-ко-гликолид (PLG) является биосовместимым и биодеградируемым.

Инкапсуляцию можно проводить при низких температурах (например, -40°С). При этом протеин находится в твердой фазе в отсутствие воды, что сводит к минимуму индуцированную водой конформационную мобильность протеина, предотвращая деградацию белка, при которой вода действует как реагент, а также позволяет избежать появления границы раздела между водной и органической фазами, на которой протеин может подвергаться денатурации. Предпочтительный процесс предполагает использование растворителей, в которых большая часть протеинов нерастворима, что приводит к высокой эффективности инкапсуляции (например, более 95%).

В соответствии с другим аспектом, по меньшей мере один компонент раствора можно представлять в виде "концентратов", например, в контейнере для хранения (например, заданного объема), готовыми для разбавления, или в сухом виде в капсуле для растворения, готовыми для добавления требуемого объема воды.

Приведенные составы и способы введения являются иллюстративными, но не ограничивающими. На основании приведенной здесь информации можно легко спроектировать другие подходящие составы и режимы введения.

V. Наборы для лечения состояний, характеризующихся нарушением структуры и/или функций артериол.

В соответствии с другим аспектом настоящее изобретение представляет наборы для улучшения одного или нескольких симптомов патологий, характеризующихся нарушением структуры и/или функций артериол или для профилактического лечения субъектов (людей или животных), у которых может развиться такое состояние. Предпочтительно, наборы содержат контейнер с одним или несколькими описанными здесь активными агентами. Активные агенты могут быть представлены в виде дозированной лекарственной формы (например, в виде суппозиториев, таблеток, каплетов, пластырей и т.д.) и/или могут применяться в сочетании с одним или несколькими фармацевтически приемлемыми наполнителями.

Наборы могут, кроме того, содержать один или несколько других агентов, используемых для лечения интересующего состояния/патологии. Такие агенты включают, без ограничения указанным, бета-блокаторы, сосудорасширяющие средства, аспирин, статины, ингибиторы ангиотензин превращающего фермента или его рецепторов и подобные вещества, например, описанные выше.

Кроме того, наборы могут включать этикетки и/или инструкции с указаниями (например, протоколы) по осуществлению способов или применению средств настоящего изобретения в профилактических и терапевтических целях. Предпочтительные инструкции описывают применение одного или нескольких активных агентов настоящего изобретения для облегчения одного или нескольких симптомов, связанных с состояниями, характеризующимися нарушением структуры и/или функций артериол, и/или для предотвращения обострения или усиления одного или нескольких таких симптомов у индивидуума, у которого может развиться такое состояние. Инструкции могут также включать описание предпочтительных режимов дозировки/лечения, противопоказаний и т.д.

Хотя инструкции, как правило, предлагаются в письменной или печатной форме, они не ограничиваются ими. Настоящее изобретение предполагает использование любого носителя, способного хранить такие инструкции и передавать их пользователю. Подобные носители включают, но без ограничения указанным, электронные средства хранения информации (например, магнитные диски, ленты, картриджы, чипы), оптические средства хранения информации (например, компакт диски) и подобные им. К числу подобных носителей могут относиться также адреса Интернет-сайтов, содержащих указанные инструкции.

Примеры

Следующие далее примеры предназначены исключительно для иллюстрации и не ограничивают формулу изобретения.

Пример 1

Как показано на фигурах 1А, 1В и 1C, мыши с отсутствующими рецепторами LDL (LDLR-/-) имеют артериолы с более толстыми стенками, по сравнению с мышами дикого типа (WT). На обезжиренной стандартной диете мыши без LDL-рецепторов характеризуются двукратно повышенным уровнем LDL в плазме по сравнению с мышами дикого типа. На такой диете у них развивается только незначительный атеросклероз, но, как видно из фигур, даже несмотря на это, артериолы их головного мозга существенно утолщаются. Кроме того, как видно из следующих фигур, при переводе этих мышей на обогащенную жирами и холестерином диету (так называемую Западную диету) артериолы их мозга утолщаются значительно сильнее. На Западной диете такие мыши демонстрируют также значительный атеросклероз.

Как недавно сообщалось, мыши LDLR-/- имеют нарушения пространственной памяти, что связывают со снижением синаптической плотности в гиппокампе (Mulder et al. (2004) Neurobiology of Disease 16:212-219, см., например, содержащийся в этой статье фигура 2).

Как показано на фигуре 2, шести недельное лечение препаратом D-4F мышей LDLR-/- на Западной диете (препарат вводился в питьевую воду в концентрации 300 мкг/мл) значительно повышало количество спонтанных чередований в Т-лабиринте, в то же время, введение того же количества контрольного пептида (искаженный D-4F) не приводило к подобным результатам.

Показанные на фигуре 2 результаты для мышей, принимавших D-4F, по сравнению с контрольным пептидом, в значительной степени сходны с результатами, приведенными на фигуре 2 процитированной выше работы Mulder et al., в которой сравнивали LDLR-/- мышей с мышами дикого типа (LDLR+/+), если предположить, что пероральное введение D-4F обращало ненормальность мышей LDLR-/-. Данные на фигуре из работы Mulder et al. представлены как "процент чередований". Данные из фигуры 2 настоящей заявки выражены как "Количество спонтанных чередований". Как показано на фигуре 3 ниже, если выразить данные для мышей с D-4F по сравнению с искаженным D-4F в виде процента чередований, то результаты получатся такими же.

На фигуре 4 представлены данные, дополнительно свидетельствующие об улучшении показателей в Т-лабиринте для мышей, принимавших D-4F, по сравнению с контрольным пептидом, искаженным D-4F (Sc D-4F).

Ранее сообщалось, что инъекции D-4F повышают вазореактивность лицевых артерий (Ou Z, Ou J, Ackerman AW et al. L-4F, миметик аполипропротеина A-I, восстанавливает баланс оксида азота и супероксид аниона в эндотелиальных клетках, обработанных липопротеинами низкой плотности. Ou et al. (2003) Circulation; 107: 1520-1524; Ou et al. (2003) Circulation 107: 2337-2341). В этих опубликованных работах изучалась лицевая мышиная артерия. Внутренний диаметр артерии составляет, приблизительно, 250 мкм).

Другой вариант применения настоящего изобретения проиллюстрирован на фигуре 5. На нем показано, что введение DMPC мышам без LDL-рецепторов на Западной диете значительнее повышал вазореактивность их лицевых артерий по сравнению с введением соевого лецитина.

Восьминедельных самок мышей без LDL-рецепторов держали на Западной диете, и давали им в это время либо чистую питьевую воду (контроль, n=6), либо питьевую воду, в которую был добавлен 1 мг/мл соевого лецитина (n=6) или DMPC (n=6). Шесть недель спустя у всех мышей извлекли подчелюстной сегмент лицевой артерии и определили процент релаксации 2 мм артериальных колец (предварительно сократившихся) в ответ на введение ацетилхолина (эндотелий-зависимый релаксант) в концентрациях от 0,01 до 10 мкМ. Специфичность релаксации подтвердили введением 300 мкМ L-NAME (ингибитор синтетазы оксида азота) и нитропруссида натрия (не зависящий от эндотелия донор оксида азота). Между группами, получавшими L-NAME (это вещество ингибирует вызванное ацетилхолином расширение сосудов) и нитропруссид натрия или папаверин (вызывающий максимальную вазодилятацию) различий не было обнаружено. В отсутствие указанных добавок заметное ингибирование ацетилхолиновой вазорелаксации наблюдалось в контрольной группе. В группе, получавшей соевый лецитин, наблюдается динамика в сторону повышения релаксации, но статистического отличия обнаружено не было. Значимое улучшение вазорелаксации наблюдалось у мышей, получавших DMPC (р<0,01 при 1 мкМ ацетилхолина; р<0,001 при 10 мкМ ацетилхолина). Логарифм концентрации ацетилхолина, вызывавшей 50% релаксацию (Log EC50 в мМ) составлял 0,473 для контрольной группы, 0,057 для группы, принимавшей соевый лецитин, и 0,006 для группы, принимавшей DMPC.

Недавно авторы опубликовали информацию о том, что введение DMPC мышам без ароЕ вызывает повышение уровней ароА-I и HDL-холестерина в плазме, что приводит к секвестрации/удалению/разрушению воспалительных липидов и превращению провоспалительных HDL в противовоспалительные, при этом происходила профилактика или наблюдалась регрессия атеросклероза на этой мышиной модели (Navab M, Hama S, Hough G et al. Oral synthetic phospholipids (DMPC) raises high-density lipoprotein cholesterol levels, improves high-density lipoprotein function, and markedly reduces atherosclerosis in apolipoprotein E-null mice. Пероральные синтетические фосфолипиды (DMPC) повышают содержание липопротеинхолестерина высокой плотности, улучшают функционирование липопротеинов высокой плотности и значительно снижают атеросклероз у мышей без аполипопротеина Е. Circulation 2003; 108: 1735-1739).

Таким образом, авторы изобретения нашли два различных агента, секвестрирующих/удаляющих/разрушающих воспалительные липиды (D-4F и DMPC). Один из них представляет собой пероральный пептид, а другой - пероральные фосфолипиды. Они оба повышают ароА-I и содержание холестерина HDL и оба улучшают функционирование артерий, что было показано на маленькой, лицевой артерии. Открытие настоящего изобретения относится к способу улучшения структуры и функций сосудов, меньших самой маленькой артерии, то есть артериол. Артериолы непосредственно отвечают за перфузию тканей органов таких различных, как мозг и почки. На основании представленных здесь и неопубликованных данных авторы полагают, что настоящее изобретение относится к общему способу улучшения структуры и функции артериол путем введения агентов, секвестирующих/удаляющих/разрушающих воспалительные липиды и превращающих провоспалительные липопротеины высокой плотности (HDL) в противовоспалительные, а также делающих противовоспалительные HDL еще более противовоспалительными. Такие агенты включают пептиды, содержащие амфипатическую спираль класса А, пептиды, содержащие амфипатическую спираль G*, короткие пептиды и непептиды с молекулярным весом не более 900 Дальтон, растворимые в этилацетате в концентрации не менее 4 мг/мл, растворимые в водном буфере при рН 7,0, и при взаимодействии с фосфолипидами в водной среде образующие частицы диаметром, приблизительно, 7,5 нм, а также упакованные бислои с размером слоя порядка 3,4-4,1 нм с расстоянием между ними в стопе, приблизительно, 2 нм; а также пероральные синтетические фосфолипиды, у которых положения sn-1 и sn-2 идентичны, и в них содержится по меньшей мере три атома углерода.

Пример 2. АроА-I пептидомиметик D-4F уменьшает толщину стенок артериол мозга и улучшает пространственную память у мышей без LDL-рецепторов на Западной диете

Резюме

Толщина стенок артериол мозга диаметром 10-100 мкм определена у мышей C57BL/6 дикого типа и без LDL-рецепторов, находящихся на обычной (обедненной жирами) и Западной диете, причем, кроме этой диеты, мышам не давали ничего или давали D-4F или искаженный D-4F. Пространственную память определяли по выполнению мышами непрерывной задачи, требующей выбора альтернативного решения в Т-образном лабиринте. У мышей без LDL-рецепторов на обедненной жирами диете толщина стенок артериол мозга была увеличена по сравнению с мышами дикого типа, она еще более возрастала при кормлении таких мышей по Западной диете (р<0,001). Такое увеличение толщины стенок артериол мозга частично было вызвано повышением содержания α-актина гладкой мускулатуры и снижалось при лечении D-4F, но не искаженным D-4F. Западная диета приводила к значимым нарушениям поведения в Т-лабиринте (р<0,05) и улучшалась при введении D-4F, по сравнению с искаженным D-4F (р<0,05). Изменения показателей выполнения задачи в лабиринте и толщины стенок артериол были независимы от содержания липидов в плазме и от диаметра просвета артериол.

Лечение мышей без LDL-рецепторов на Западной диете препаратом D-4F снижает толщину стенок артериол мозга, независимо от содержания липидов в плазме и от диаметра просвета артериол, а также улучшает пространственную память.

Материалы и методы

Материалы

D-4F и искаженный D-4F (пептид с теми же D-аминокислотными остатками, что и в D-4F, но расположенными в последовательности, которая не позволяет пептиду образовать спиральную конформацию, необходимую для связывания липидов) были синтезированы, как описано ранее (Navab et al. (2002) Circulation, 105: 290-292; Navab et al. (2004) Circulation, 109: r120-r125). Источники всех остальных реагентов также были описаны ранее (Navab et al. (2005) Arterioscler Thromb Vase Biol, 25: 1-7).

Мыши и гистопатология

Самки мышей C57BL/6 дикого типа и без LDL-рецепторов получены в лаборатории Jackson Laboratories (Bar Harbour, ME). Мыши содержались на обезжиренной диете (Ralston Purina), затем им была назначена Западная диета (Teldad/Harlan, Madison Wl, diet No. 88137; 42% fat, 0.15% cholesterol, w/w). Для изучения артериол мозга мышей анестезировали внутримышечным введением кетамина (100 мг/кг) и ацепромазина (2,5 мг/кг), сердце подвергали перфузии через левый клапан физиологическим раствором с фосфатным буфером (PBS)) (25 мл) с гепарином (10 ед/мл), а затем 100 мл 4% параформальдегида (PFA) в PBS при рН 7,4, как описано в работе Fernagut et al. (Fernagut et al. (2002) Neuroscience, 114: 1005-1017; Fernagut et al. (2004) Exp Neurol., 185: 47-62). Головной мозг быстро извлекали и выдерживали 24 часа в 4% PFA при температуре 4°С после чего переносили в 10% раствор сахарозы в PBS (рН 7,4) и оставляли там до оседания на дно сосуда с раствором. Правую половину мозга погружали в ОСТ (Tissue-Tek; Miles Laboratories Ltd, Elkhart IN), замораживали в изопентане при температуре -40°С и хранили при температуре -80°С. Секционировали половинки мозга в криостате при температуре -20°С. При этом замороженные мозги коронарно разрезали на секции по 8 мкм, включая расположенное ниже белое вещество, и фиксировали гематоксилинэозином (Н&Е), а также на наличие α-актина гладкой мускулатуры (Serotec, Raleigh, NC). Левые половинки каждого мозга погружали в парафин, коронарно разрезали на секции по 6 мкм и фиксировали Н&Е. Все эксперименты были одобрены комитетом по гуманному обращению с животными (UCLA Animal Research Committee).

Морфометрия и связанные с ней статистические методы

Толщину стенок сосудов всех артериол, расширенных и кросс-секционированных перпендикулярно, определяли методами морфометрии. С помощью 40х микроскопа представленные в разрезе сосуды сфотографировали, применяя программное обеспечение SPOT Image, для каждой секции было выполнено по три измерения внутреннего и внешнего диаметра, после чего данные усреднили. Размеры сосудов колебались от 10 до 160 мкм, и сравнение отношений толщины стенки к диаметру просвета выполнялись по отдельности для артерий с внутренним диаметром 10-20 мкм, 21-50 мкм, 51-100 мкм и >100 мкм. В кортикальной области и более глубоких участках белого вещества каждого мозга исследовали не менее 10 артерий каждой группы (по диаметру), для них определяли толщину стенок и отношение толщины стенок к размеру просвета. Для секций, иммуностатированных на наличие α-актина гладкой мускулатуры, определяли отношение толщины иммунореактивной среды к внутреннему диаметру каждого сосуда. Все измерения выполняли в одной фокальной плоскости с помощью микроскопа Olympus ВН-2,оборудованного 40х линзами. Измерения выполнял один экспериментатор, а затем их повторяли два наблюдателя, не осведомленные о режиме лечения группы животных. Чтобы определить вариацию данных между наблюдателями, все они измерили толщину стенок и диаметр просвета одних и тех же 20 артериол и вычислили отношение толщины к диаметру. Коэффициент вариации составлял 14±1%. Данные обработали программным обеспечением InStat и Prism software (Graphpad, San Diego, CA, U.S.A.). Для определения статистической значимости различий между средними значениями для различных групп использовался непарный t-тест Стьюдента или односторонний метод ANOVA. Множественные сравнения различных групп выполняли с помощью теста множественных сравнений Тукея-Крамера. Значимым считался уровень вероятности 5% (Р<0,05).

Поведенческие эксперименты и связанные с ними статистические методы

Эксперименты по непрерывному выполнению задания, предусматривающего выбор альтернативного решения в Т-образном лабиринте (Т-САТ) выполняли ежедневно от 9 утра до 4 вечера. Все эксперименты проводил один экспериментатор, не осведомленный о режиме лечения группы животных. Мышь переносили в комнату для эксперимента за два часа до его начала, чтобы дать ей возможность освоиться в новой обстановке. Использовавшийся в эксперименте Т-образный лабиринт аналогичен описанному в работе Gerlai et al. (Gerlai (1998) Behavioural Brain Research, 95: 91-101), он состоял из прозрачных акриловых стенок и черного акрилового дна. Размер входного и целевых плеч составляли: длина 75 см, ширина 12 см и высота 20 см. Лабиринт был снабжен тремя переносными гильотиноподобными дверцами, закрывать которые оператор мог удаленно. Комната освещалась светильниками, расположенными на потолке и в полу, специальный вентилятор создавал постоянный фоновый шум. Т-образный лабиринт был отделен от экспериментатора черной занавеской, перемещения мыши в нем отслеживали с помощью ТВ-монитора и записывались на видеокассету. После исследования поведения каждой мыши лабиринт тщательно мыли спреем Windex и сушили бумажными салфетками. Эксперимент по непрерывному чередованию в Т-лабиринте (Т-САТ) не требует приучения животного к рукам и позволяет изучать естественное исследовательское поведение. Использовавшаяся в данном эксперименте процедура аналогична описанной в работе Gerlai et al. (Id.) и включала одно форсированное исследование и 14 исследований свободного выбора. В ходе эксперимента регистрировали сделанный животным выбор направления в каждом из 14 "заходов со свободным выбором" и вычисляли частоту чередований (0% - нет чередований, 100% - чередование при каждом "заходе", 50% - случайное чередование). Регистрировалось и анализировалось также время в секундах, требуемое для выполнения 15 "заходов". Ход эксперимента Т-САТ непрерывно регистрировался системой видеослежения (SD Instruments Inc., San Diego, CA), и эти данные сохранялись в компьютере. Статистическая обработка проводилась с помощью программного обеспечения StatView (SAS Institute, Gary, NC.).

Другие процедуры

Содержание липопротеинов и липидов плазмы определяли, как описано ранее (Navab et al. (2004) Circulation, 109: r120-r125; Navab et al. (2005) Arterioscler Thromb Vase Biol, 25: 1-7).

Результаты

Толщина стенок артериол мозга увеличивалась у мышей без LDL-рецепторов и еще больше увеличивалась при переводе мышей на Западную диету

Как показано на фигуре 6, на обедненной жирами диете толщина стенок артериол у мышей без LDL-рецепторов была увеличена, по сравнению с мышами дикого типа; после шестинедельного соблюдения Западной диеты толщина стенок артериол мышей без LDL-рецепторов увеличилась еще больше.

Утолщение стенок артериол мозга снижается при лечении мышей препаратом D-4F, но не искаженным D-4F

Как показано на фигурах 7А-7С, добавление 300 мкг/мл D-4F в питьевую воду мышей без LDL-рецепторов на Западной диете в течение 6 недель уменьшало толщину стенок артериол мозга, по сравнению с добавлением в питьевую воду той же концентрации искаженного D-4F. Как показано на фигуре 7D, разницы в диаметре просвета артериол мозга у мышей, получавших обычный и искаженный D-4F, обнаружено не было. По мнению некоторых исследователей, чтобы повысить надежность данных, необходимо разделить толщину стенок каждой артериолы на диаметр просвета этой артериолы (Mulvany (1999) Cardiovascular Research, 41: 9-13). На фигурах 7E-7G показано, что отношение толщины стенок к диаметру просвета значительно снижалось у мышей, получавших D-4F, по сравнению с искаженным D-4F. Значимых отличий в плазматической концентрации общего холестерина, LDL-холестерина, HDL-холестерина или триглицеридов у мышей, получавших D-4F и искаженный D-4F, обнаружено не было. Для мышей, принимавших D-4F, содержание общего холестерина составляло 1076±75 мг/дл (Среднее ± SEM), для мышей, принимавших искаженный D-4F, этот параметр составлял 970±61 мг/дл. Содержание LDL и HDL составляло, соответственно, 924±76 и 86±6 мг/дл, для принимавших D-4F мышей, и 834±63 и 79±5 мг/дл, соответственно, для мышей, получавших искаженный D-4F. Содержание триглицеридов составляло 330±25 и 288±25 мг/дл для мышей, принимавших обычный и искаженный D-4F, соответственно.

Утолщение стенок артериол мозга частично вызвано повышением содержания α-актина гладкой мускулатуры

Как показано на фигуре 8А, кормление мышей без LDL-рецепторов по Западной диете приводило к значительному повышению содержания α-актина гладкой мускулатуры в стенках артериол мозга. На фигуре 8В представлены репрезентативные артериолы головного мозга, окрашенные на наличие α-актина клеток гладкой мускулатуры и взятые у мышей, получавших D-4F или искаженный D-4F. На фигурах 8С-8Е количественно показано, что лечение мышей D-4F значительно снижает содержание α-актина в гладкой мускулатуре стенок артериол, по сравнению с мышами, принимавшими искаженный D-4F.

Западная диета приводит к нарушению пространственной памяти у мышей без LDL-рецепторов, которые в значительной степени исправляются под действием D-4F. но не искаженного D-4F

На фигурах 9A-9D показано, что описанные на фигуре 3А мыши без LDL-рецепторов на Западной диете характеризуются нарушениями пространственной памяти по данным Т-САТ. Как видно из фигур 9Е-9G, пероральное лечение D-4F (но не искаженным D-4F) мышей, описанных на фигурах 7 и 8В-8Е значительно повышает характеристики выполнения задачи, в соответствии с тестом в Т-САТ. Хотя для завершения всех 15 "заходов" мышам, получавшим искаженный D-4F, требовалось больше времени, чем мышам, получавшим обычный D-4F (579±23 секунд по сравнению с 548±37 секундами соответственно), это различие не достигало статистической значимости. Тем не менее, данные фигур 9E-9G наглядно демонстрируют четкое улучшение после лечения D-4F.

Обсуждение результатов

Данные этого примера, а также ранее опубликованные 8-10 позволяют предположить, что содержание LDL влияет на все ветви артериального дерева у мышей. Мыши без LDL-рецепторов на обезжиренной диете имеют значительно утолщенные стенки артериол мозга с просветом диаметром 15-40 мкм (фигура 6А). Спустя только шесть недель на Западной диете эти мыши демонстрировали значительное увеличение толщины стенок артериол мозга, по сравнению с мышами дикого типа (фигуры 6А-6С).

Сходства и различия в атеросклеротических и гипертензивных сосудах рассматриваются в работе Heistad и коллег (Heistad et al. (1995) Hypertension, 26: 509-513). Авторы отмечают, что "Изменения в структуре сосудов при атеросклерозе и гипертонии характеризуются утолщением сосудистой стенки и васкулярным "ремоделированием". В процессе ремоделирования наблюдается тенденция к сохранению размера просвета атеросклеротических сосудов и к уменьшению просветов в гипертензивных сосудах. Как видно из фигуры 7D, индуцированное Западной диетой (в течение 6 недель) утолщение артериол мозга мышей без LDL-рецепторов может не зависеть от изменения диаметра просвета. Авторы не измеряли давление крови у этих мышей и не знают, изменится ли диаметр просвета после длительного следования Западной диете. Однако, очевидно, что шестинедельное следование Западной диете приводит к значительному повышению отношения толщины стенок к диаметру просвета и содержания α-актина гладкой мускулатуры (фигура 8А).

Уже давно известно, что обогащенные активными формами кислорода LDL могут стимулировать рост гладкой мускулатуры сосудов (Gorog (1997) Atherosclerosis, 129: 1-7). Известно также, что мыши, живущие в условиях постоянного окислительного стресса из-за дефицита цистатион α-синтазы, характеризуются гипертрофией сосудов мозга и увеличением содержания гладкой мускулатуры в артериолах головного мозга (Baumbach et al. (2002) Circ Res, 91: 931-937). Представляется заманчивым предположить, что пероральное введение D-4F, который снижает содержание гидропероксидов липидов LDL у мышей, не меняя содержание липидов в плазме (Navab et al. (2004) Circulation, 109: r120-r125) 1, может предотвращать повышение содержания α-актина артериол мозга (фигуры 8В-8Е) путем снижения концентрации гидропероксидов липидов и не меняя уровень плазматических липидов.

В работе Mulder et al. (Mulder et al. (2004) Neurobiology of Disease, 16: 212-219) было впервые отмечено, что мыши без LDL-рецепторов на обезжиренной диете характеризуются нарушением пространственной памяти, по сравнению с мышами дикого типа на такой же диете. По мнению авторов, указанное отклонение напоминает то, что было отмечено для мышей без ароЕ (Krugers et al. (1997) Neruo Report, 8: 2505- 2510; Oitzl et al. (1997) Brain Res., 752: 189-196; Zhou et al. (1998) Brain Res., 788: 151- 159; Veinbergs et al. (1999) Neuroscience 91: 401-403; Krzywkowski et al. (1999) Neuroscience 92: 1273-1286; Raber et al. (2000) Nature 404: 352-354) и вызвано первичным нарушением функционирования клеток мозга, обусловленным невозможностью предоставить им липопротеиновые составные части. Приведенная на фигуре 9, а также на фигурах 6-8 настоящего изобретения информация позволяет предложить альтернативную гипотезу. Первичное нарушение может быть частично или полностью обусловлено "синдромом толстых сосудов", описанным в работе Heistad et al. (1995) Hypertension, 26: 509-513, а не невозможностью предоставить клеткам мозга липопротеиновые составные части. В пользу этой гипотезы говорит ухудшение функционального дефекта при усилении гиперлипидемии (фигуры 9A-9D). Если бы первичное нарушение было вызвано отсутствием липопротеинов для клеток мозга, вызванное отсутствием LDL-рецепторов, следовало бы ожидать улучшения функционирования при повышении содержания липопротеинов в плазме, так как доставка липопротеинов в клетки мозга по нерецепторному механизму, скорее всего, будет возрастать с усилением гиперлипидемии. В пользу васкулярного объяснения функциональных отклонений, проиллюстрированного на фигуре 9, говорит также корреляция между функциональными нарушениями и структурными изменениями в артериолах, которые ухудшались при следовании Западной диете (фигуры 6 и 8А) и улучшались при пероральном введении D-4F (но не искаженного D-4F) (фигуры 7 и 8В-8Е). Авторы не измеряли вазореактивность артериол мозга у этих мышей. Однако Pritchard с соавторами обнаружили, что вазореактивность лицевой артерии (диаметром, приблизительно, 240 мкм) мышей без LDL-рецепторов значительно ухудшалась под действием Западной диеты и улучшалась после лечения D-4F (Ou et al. (2003) Circulation, 107: 2337-2341; Ou et al. (2005) Circulation Research 97: 1190-1197. Heistad с коллегами (Heistad et al. (1980) Am. J. Physiol. 239 (Heart Circ. Physiol. 8): H539-H544) обнаружили, что у гиперхолистеринемичных мартышек (которых сделали такими атерогенной диетой), нарушался максимальный церебральный сосудорасширяющий ответ на гиперкапнию, но при действии менее выраженных сосудорасширяющих стимулов авторегуляторный ответ на гипотонию сохранялся. Интересно, что когда мартышек переводили на регрессионную диету и подвергали максимальной вазодилятации, восприимчивость черепно-мозгового артериального русла значительно улучшалось (Armstrong et al. (1983) J Clin. Invest., 71: 104-113).

Интересно отметить, что у людей, больных ангиопатией субкортикальной атеросклеротической энцефалопатии (болезнь Бинсвангера), наблюдалось повышение содержания α-актина гладкой мускулатуры сосудов мозга диаметром меньше 100 мкм (Lin et al. (2000) Stroke, 31: 1838-1842). Заманчиво было бы предположить также, что "синдром толстых сосудов" может играть большую роль в развитии деменций человека, чем предполагалось ранее, и что применение пептидов, имитирующих ароА-I, таких как D-4F, может оказать благоприятные эффекты на течение таких болезней.

Следует понимать, что описанные здесь примеры и аспекты предназначены только для иллюстрации, и что компетентный специалист в данной области легко может в свете приведенной здесь информации внести в них разнообразные модификации и изменения. Все эти изменения соответствуют духу заявки и относятся к области настоящей заявки и следующей далее формулы изобретения. Все процитированные здесь публикации, патенты и патентные заявки включены сюда по ссылке во всей своей полноте для всех целей.

1. Способ улучшения структуры и/или функций артериол у млекопитающих с патологией, которая характеризуется утолщенными стенками артериол в головном мозге и почках, включающий введение указанному млекопитающему пептида с аминокислотной последовательностью, включающей последовательность D-W-F-K-A-F-Y-D-K-V-A-E-K-F-K-E-A-F (SEQ ID №5) или обратную последовательность F-A-E-K-F-K-E-A-V-K-D-Y-F-A-K-F-W-D (SEQ ID №444), в дозах, достаточных для улучшения структуры или функций артериол в указанных головном мозге или почках.

2. Способ по п.1, в котором аминокислотная последовательность указанного пептида включает последовательность D-W-F-K-A-F-Y-D-K-V-A-E-K-F-K-E-A-F (SEQ ID №5).

3. Способ по п.1, в котором аминокислотная последовательность указанного пептида включает последовательность F-A-E-K-F-K-E-A-V-K-D-Y-F-A-K-F-W-D (SEQ ID №444).

4. Способ по п.1, в котором указанный пептид является полностью "L" пептидом.

5. Способ по п.1, в котором указанный пептид является полностью "D" пептидом.

6. Способ по п.1, в котором указанный пептид содержит карбокси- и/или аминотерминальную защитную группу.

7. Способ по п.6, в котором указанный пептид содержит карбокситерминальную и аминотерминальную защитные группы.

8. Способ по п.7, в котором указанная карбокситерминальная защитная группа представляет собой амид.

9. Способ по п.7, в котором указанная аминотерминальная защитная группа представляет собой ацетил.

10. Способ по п.7, в котором указанная карбокситерминальная защитная группа представляет собой NH2 и указанная аминотерминальная защитная группа представляет собой ацетил.

11. Способ по п.1, в котором формула указанного пептида представляет собой Ac- D-W-F-K-A-F-Y-D-K-V-A-E-K-F-K-E-A-F-NH2.

12. Способ по п.1, в котором формула указанного пептида представляет собой Ac- F-A-E-K-F-K-E-A-V-K-D-Y-F-A-K-F-W-D-NH2.

13. Способ по п.1, в котором указанный пептид изготовлен в виде дозированной лекарственной формы.

14. Способ по п.13, в котором указанный пептид изготовлен для введения по маршруту, выбранному из группы, включающей пероральное, назальное, ректальное, чрескожное введение, а также внутрибрюшинные, внутрисосудистые, подкожные и внутримышечные инъекции.

15. Способ по п.1, в котором указанные артериолы представляют собой артериолы почек.

16. Способ по п.1, в котором указанные артериолы представляют собой артериолы головного мозга.

17. Способ по пп.1-16, в котором указанное млекопитающее - человек.

18. Способ по п.17, в котором указанное млекопитающее - человек с диагнозом нарушения памяти или обучаемости.

19. Способ по п.17, в котором указанное млекопитающее - человек с диагнозом нарушения функции почек.

20. Способ по п.1, в котором указанное млекопитающее - человек, которому не поставлен диагноз атеросклероз, или у которого нет риска возникновения атеросклероза.



 

Похожие патенты:

Изобретение относится к фармацевтической промышленности, а именно к лекарственной форме триметазидина дигидрохлорида с модифицированным высвобождением в виде таблетки для перорального приема.

Изобретение относится к фармацевтической промышленности, в частности к композиции для предупреждения и лечения заболеваний и состояний, связанных с агрегацией тромбоцитов и тромбозом, вызываемым тромбоцитами.

Изобретение относится к производным 5,7-дизамещенного [1,3]тиазоло[4,5-d]пиримидин-2(3Н)-она формулы (I), где R 1 представляет собой СН3 или СН3СН 2; R2 представляет собой Н, 3-CN, 2-CF3 , 2-F, 3-F, 3-CF3, 3-CONH2 или 3-SO 2CH3; R3 представляет собой Н; R 4 представляет собой Н или СН3; и R5 представляет собой Н; или, когда R4 представляет собой СН3, R5 представляет собой Н или F; и его фармацевтически приемлемым солям.
Изобретение относится к медицине, а именно к способам лечения и лекарственным композициям для лечения заболеваний, обусловленных активацией процесса перекисного окисления, а именно к препаратам на основе 2-этил-6-метил-3-гидроксипиридина сукцината, и может быть использовано при острых нарушениях мозгового кровообращения, атеросклеротических нарушениях функций головного мозга, дисциркуляторной энцефалопатии, в хирургии при острых гнойно-воспалительных процессах брюшной полости, в психиатрии для купирования абстинентного синдрома, отягощенного неврозоподобными и вегетососудистыми расстройствами, а также при острой интоксикации нейролептиками и алкоголем.

Изобретение относится к производным 4-аминокарбонилпиримидина формулы (I) и их применению в качестве антагонистов P2Y12 рецептора для лечения и/или профилактики заболеваний или болезненных состояний периферических сосудов, а также сосудов, снабжающих внутренние органы, сосудов печени и почек, при лечении и/или профилактике сердечно-сосудистых и цереброваскулярных заболеваний и состояний, связанных с агрегацией тромбоцитов, включая тромбоз у человека и млекопитающих.
Изобретение относится к медицине и фармацевтической промышленности, а именно к производству лекарственных средств, оказывающих антиангинальное действие. .

Изобретение относится к биотехнологии и представляет собой фармацевтические композиции и способ для лечения заболеваний, ассоциированных с амилоидными отложениями А в головном мозге пациента, таких как болезнь Альцгеймера.

Изобретение относится к контрастным агентам для обнаружения рецептора урокиназного активатора плазминогена (uPAR). .

Изобретение относится к медицине и касается биологически активной смесевой добавки, обладающей нейропротективной активностью, которая содержит пептидную композицию, содержащую два пептида с последовательностью 1: NMVPFPR и последовательностью 2: ASAFQGIGSTHWVYDGVGNS.

Изобретение относится к пептидным реагентам, которые взаимодействуют с прионными белками, к полинуклеотидам, кодирующим эти пептидные реагенты, к способам получения антител с использованием таких пептидных реагентов и полинуклеотидов, и к антителам, полученным с использованием этих способов.

Изобретение относится к биотехнологии. .

Изобретение относится к биотехнологии, генной и белковой инженерии, конкретно - к пептиду, обладающему способностью специфически взаимодействовать с антителами против бензо[ ]пирена и бенз[ ]антрацена.

Изобретение относится к фармацевтическим композициям для профилактики развития и лечения начальной стадии возрастной катаракты. .
Изобретение относится к медицине и касается средства для профилактики и лечения алкогольной зависимости

Изобретение относится к способу улучшения структуры иили функций артериол у млекопитающих с патологией, которая характеризуется утолщенными стенками артериол в головном мозге или почках, включающий введение указанному млекопитающему пептида с аминокислотной последовательностью D-W-F-K-A-F-Y-D-K-V-A-E-K-F-K-E-A-F или обратную последовательность F-A-E-K-F-K-E-A-V-K-D-Y-F-A-K-F-W-D, в дозах, достаточных для улучшения структуры и функции артериол

Наверх