Пептидные производные эксендина-4



Пептидные производные эксендина-4
Пептидные производные эксендина-4
Пептидные производные эксендина-4
Пептидные производные эксендина-4
Пептидные производные эксендина-4

 


Владельцы патента RU 2420536:

ФИЛИППС-УНИВЕРЗИТЕТ МАРБУРГ (DE)

Изобретение относится к биотехнологии. Описаны пептидные производные эксендина-4, модифицированные у С-конца амином и которые N-концом связываются с GLP-1-рецепторами и частично или полностью содержат аминокислотную последовательность пептида эксендина-4. Раскрыто применение пептидных производных эксендина-4 для получения средства для диагностики и терапии заболеваний, при которых играет роль экспрессия рецепторов GLP-1, для определения плотности инсулинпродуцирующих клеток в ткани, для определения экспрессии GLP-1-рецепторов или их плотности. Изобретение может быть использовано для получения средства для диагностики и терапии доброкачественных и злокачественных заболеваний, в которых играет роль экспрессия рецепторов GLP-1. 13 н. и 12 з.п. ф-лы, 3 табл.

 

Описание и введение в общую область изобретения

В топической диагностике гастроэнтеропанкреатических нейроэндокринных опухолей в качестве важного диагностического метода наряду с ультразвуком используют сцинциграфию рецепторов соматостатина (SRS). Используемый принцип состоит в специфическом отображении опухолей с помощью радиоактивно меченых пептидов, которые захватываются опухолевыми клетками. Таким образом с помощью гамма-камеры можно наглядно обнаруживать повышение радиоактивности в опухолевой ткани. Если тип опухоли обладает рецепторами, требующими SRS, например, аналог соматостатина октреотид®, определение указанных опухолей возможно без проблем. Однако если соответствующие рецепторы не экспрессируются, они не поддаются сцинциграфическому определению. Но наряду с топикальной диагностикой радиоактивно меченые пептиды также дают возможность подхода к лечению опухолей, при котором путем мечения аналога соматостатина, например, октреотида®, подходящим радионуклидом (α- или β-лучами) можно производить специфическую направленную на рецепторы радиопептидную терапию. Так как соответствующие радионуклиды химически связаны с пептидом таким образом (например, путем комплексообразования с ранее связанным с пептидом хелатирующим агентом), что хотя опухолевые клетки их поглощают, но не могут их больше выбрасывать, происходит высокое специфическое обогащение их в опухолевой ткани.

Конечно, целый ряд нейроэндокринных опухолей (NET), в том числе инсулинома и мелкоклеточный бронхогенный рак, не экспрессируют требуемых подтипов рецепторов соматостатина, которые необходимы для SRS или радиопептидной терапии с аналогом соматостатина октреотидом®. В частности, инсулинома в значительном проценте не поддается сцинциграфической диагностике. Также при мелкоклеточном бронхогенном раке SRS не представляет собой подходящего способа, так как хотя первичные опухоли часто могут быть отображены, однако метастазы нет, поскольку утрачивается экспрессия рецепторов. Таким образом, также недоступна радиотерапия, которая представляет собой интересный дополнительный или альтернативный способ лечения. Отсюда возникает потребность в подходящем пептиде, который поглощался бы указанными опухолями.

Гормон внутренней секреции глюкагон-подобный пептид-1 (GLP-1), а также его аналоги эксендин-3 и эксендин-4 (из слюны ящериц (Heloderma horridum и Heloderma suspectum)) представляют собой пептиды, для которых инсулинома и мелкоклеточный бронхогенный рак - наряду с многими другими видами опухолей - экспрессируют рецепторы. Инсулинома происходит от продуцирующих инсулин β-клеток островков Лангеранса поджелудочной железы, в котором GLP-1, а также эксендин-3 и эксендин-4 инициируют возникающую после приема пищи секрецию инсулина.

Состояние техники

Для применения глюкагон-подобных пептидов (GLP-1) в сцинциграфии требуется мечение пептидов. Способы мечения белков радионуклидами известны специалисту и представлены в многочисленных патентных описаниях (например, DE 690 18 226 T2) и научных работах. При этом описанные пептиды для использования в диагностических изображениях и для опосредования терапевтически активных молекул в патологических тканях, как правило, содержат у N-конца введенный в пептид амин. Пептиды при этом должны быть дополнительно модифицированы в смысле стабильности.

Например, использованный в патенте US 2003/0232761A1 GLP-1 и его производное GLP-1(7-37) модифицированы у N-конца амином. Таким образом, N-конец GLP-1 более не может быть использован в связывании с GLP-1-рецепторами, так что с указанными пептидами возможно только неудовлетворительное связывание и внутренние (взаимодействия) с рецепторами, указанные пептиды таким образом не подходят для применения в радиопептидной терапии инсулиномы и мелкоклеточного бронхогенного рака. Мутация, например, замена аминокислоты внутри пептидной последовательности GLP-1 и эксендина-3 или эксендина-4 и их возможных модификаций под действием лекарственного препарата или подающей сигнал молекулы, на основе опытов приводит в основном к тому, что структура пептида разрушается таким образом, что становится невозможным связывание с рецепторами.

Дополнительный метод модифицирования GLP-1 без воздействия на N-конец до настоящего времени неизвестен. Сверх того не известны меченые или немеченые производные GLP-1 для использования при радиотерапии инсулиномы и мелкоклеточного бронхогенного рака.

Задача

Задача предлагаемого изобретения состоит в том, чтобы устранить недостаток современного уровня техники и получить пептиды, которые могут быть мечеными, и также с указанным мечением могут связываться с GLP-1-рецепторами и могут вводиться для получения средства для диагностики и терапии заболеваний, при которых играет роль экспрессия рецепторов GLP-1.

Решение задачи

Указанную задачу предложено решить путем получения производных пептидов GLP-1, эксендина-3 и эксендина-4, которые модифицированы амином у С-конца, а N-концом связываются с GLP-1-рецепторами, а также химерных пептидов из GLP-1 с эксендином-3 или эксендином-4. Указанные пептиды, а также химерные пептиды, меченые или немеченые, используют для получения средства для диагностики и терапии доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия GLP-1-рецепторов.

С помощью указанных производных пептидов GLP-1, эксендина-3 и эксендина-4, а также химерных пептидов из GLP-1, эксендина-3 или экзендина-4 осуществляют получение средства для сцинциграфического применения, которое используют для диагностики и терапии опухолей, экспрессирующих GLP-1-рецепторы, в том числе NET (в частности, инсулиномы) и мелкоклеточного бронхогенного рака. Прежде всего, это возможно, так как предложенные производные пептидов модифицированы амином у С-конца и, таким образом, N-конец остается в распоряжении для связывания с GLP-1-рецепторами.

Благодаря связыванию предложенных, например, радиоактивно меченых, производных пептидов и химерных пептидов GLP-1, эксендина-3 и эксендина-4 с GLP-1-рецепторами возможно отображение опухолей, экспрессирующих GLP-1-рецепторы и вместе с тем значительное улучшение помощи пациенту. В первую очередь это (касается) гастроэнтеропанкреатических NET, таких как инсулинома, для которых в настоящее время не существует неинвазивных способов с достаточной чувствительностью, или мелкоклеточного бронхогенного рака, локализованного в области легких, при котором в настоящее время невозможно дифференцирование между воспалительными процессами и опухолями или метастазами, и также невозможны неинвазивные способы (лечения).

Далее посредством предложенных производных пептидов и химерных пептидов отображают плотность продуцирующих инсулин клеток в поджелудочной железе, а также экспрессию GLP-1-рецепторов in vivo и in vitro. Так, например, при отображении клеток, экспрессирующих GLP-1-рецепторы, при сахарном диабете отображение (происходит) in vivo, так как это клетки, которые также выделяют инсулин. Отображение плотности GLP-1-рецепторов в поджелудочной железе особенно важно для пациентов с сахарным диабетом во время и после терапии лекарственными препаратами. Дополнительно отображают распределение GLP-1-рецепторов в злокачественных и доброкачественных тканях. Постановки вопросов носят здесь как клинический, так и научный характер, так как еще не дают всеохватывающих данных in vivo для распределения GLP-1-рецепторов у человека.

Изобретение также имеет то преимущество, что производные пептидов GLP-1 (глюкагон-подобного пептида-1), эксендина-3 и эксендина-4, а также химерных пептидов из GLP-1, эксендина-3 или эксендина-4 использовали для получения средства, в частности, для направленного на рецепторы специфического отображения и терапии, в частности NET, особенно инсулиномы и мелкоклеточного бронхогенного рака.

В частности, при диагностике мелкоклеточного бронхогенного рака применима сцинциграфия GLP-1-рецепторов и, возможно в первую очередь, специфическое определение пораженных метастазами лимфатических узлов (воспалительно измененных лифатических узлов или пораженных лимфатических узлов).

Дополнительно возможно применение предложенных производных пептидов GLP-1 (глюкагон-подобного пептида-1), эксендина-3 и эксендина-4, а также химерных пептидов из GLP-1, эксендина-3 или эксендина-4 в качестве средств для диагностики и терапии всех доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия рецепторов GLP-1, в частности, в качестве контрастных средств для магниторезонансной томографии (MRT), в качестве радиоактивного средства для сцинциграфии (SPECT, компьютерной томографии единичных фотонов) или радиопептидотерапии, в РЕТ (позитронно-эмиссионной томографии), в опосредованной рецепторами химиотерапии и в оптической диагностике. Причем под оптической диагностикой понимают возбуждение флуоресцирующей молекулы волной определенной длины, которая вызывает последующую эмиссию света других длин волн. При этом определяют испускаемые длины волн.

Специалист легко может выбрать вид мечения у С-конца производных пептидов GLP-1 (глюкагон-подобного пептида-1), эксендина-3 и эксендина-4, а также химерных пептидов из GLP-1, эксендина-3 или эксендина-4 в зависимости от желаемого применения, которое состоит, например, (в использовании) для сцинциграфии или радиотерапии по радиоактивным нуклидам, для контрастных средств в магниторезонансной томографии (МRT), например, по гадолинию, для эндоскопического или научного изучения по флуоресцирующим красителям.

Под злокачественными заболеваниями предложено понимать злокачественные заболевания, при которых наблюдаются изменения соответствующих тканей, отличающие их от здоровых тканей, проявляется инвазивный рост или ткани разрываются на кровяное или лимфатическое русло. Сюда относятся все нейроэндокринные опухоли, в частности, желудочно-кишечного тракта, бронхогенный рак, рак поджелудочной железы и другие злокачественные заболевания, которые связаны со сверхэкспрессией GLP-1-рецепторов.

Под доброкачественными заболеваниями предложено понимать доброкачественные заболевания, которые отличаются тем, что соответствующие ткани не теряют своей степени дифференцировки, не проявляют инвазивного роста и не образуют метастазирования тканей в лимфатическое или кровяное русло. Сюда относятся, например, сахарный диабет, а также нарушения аппетита (Essverhaltens) или психические (расстройства).

Характеристика производных пептидов и химерных пептидов

Неожиданно было обнаружено, что производные пептидов GLP-1, эксендина-3 и эксендина-4, а также химерные пептиды из GLP-1, эксендина-3 или эксендина-4, которые модифицированы амином у С-конца, связываются через N-конец с GLP-1-рецепторами. Они даже проявляют подобно природному пептиду очень высокое сродство к GLP-1-рецепторам. Эксперименты с имеющими опухоли голыми мышами показывают специфический захват опухолевой тканью, позитивной по GLP-1-рецепторам.

Предложенные производные пептидов, а также химерные пептиды, немеченые или через хелатирующий агент меченые у С-концевого амина, вводили в качестве средства для диагностики и терапии доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия рецепторов GLP-1. Вид мечения заключался при этом, в частности, (во введении) радиоактивного металла, MRT-контрастного средства, флуоресцирующего хромофора или химиотерапевтического средства.

Процесс и способы мечения известны специалисту (например, патент DE 690 18 226 T2) и оно осуществляется, например, путем взаимодействия с радионуклидами немагнитных металлов и другими MRT-контрастными средствами или флуоресцирующими красителями таким образом, чтобы не мешать связыванию с рецепторами или интернализации предложенных производных пептидов, а также химерных пептидов и чтобы связывающие GLP-1-рецепторы N-концы оставались свободными.

Аминокислотные последовательности исходных пептидов:

GLP-1:

Эксендин-3:

Эксендин-4:

Предложены следующие полученные производные пептидов GLP-1 (1-37), эксендина-3 и эксендина-4

GLP-1(x-y)A 1-37

Эксендин-3(z-k)A 1-40

Эксендин-4(z-k)A 1-40

Причем (буквы) означают:

х=аминокислоты 1-36 аминокислотной последовательности GLP-1

y=аминокислоты 2-37 аминокислотной последовательности GLP-1

z=аминокислоты 1-38 аминокислотной последовательности эксендина-3 или эксендина-4

k=аминокислоты 2-39 аминокислотной последовательности эксендина-3 или эксендина-4

А=присоединенная группа, состоящая из одной или более аминокислот или их производных в качестве сигнальной молекулы как таковой или для связывания сигнальных молекул или для стабилизации. (Группа) А предпочтительно локализована у С-конца и представляет собой, например, амин, предпочтительно лизин или в качестве альтернативы другую аминокислоту со свободной аминогруппой, такую как, например, орнитин, или органическую группу со свободной аминогруппой, с которыми может взаимодействовать хелатирующий агент для мечения радионуклидами или MRT-контрастным средством, флуоресцирующим красителем или химиотерапевтическим средством. Хелатирующие агенты представляют собой, например, DTPA (диэтилентриаминопентауксусную кислоту, применяемый в качестве альтернативы N,N-бис(2-[бис(карбоксиметил)амино]этил)глицин), в качестве альтернативы DOTA (1,4,7,10-тетраазациклододекан-1,4,7,10-тетрауксусную кислоту), HYNIC (6-гидразинопиридин-3-карбоновую кислоту), MAG3 (меркаптоацетилглицилглицилглицин), N4 (1,4,8,11-тетраазаундекан) и известные производные всех названных хелатирующих агентов.

Верхний индекс указывает, в каком месте аминокислотной последовательности могут альтернативно находиться присоединенные группы.

GLP-1(x-y)A1-37

при этом охватывают производные GLP-1 различной длины, в которых х представляет собой число от 1 до 36, но меньше y, который может означать число от 2 до 37. А представляет собой присоединенную группу, которая стоит в любом месте, но предпочтительно у С-конца и у более высокого (положения), чем y. Присоединенная группа предпочтительно представляет собой амин лизин.

Эксендин-3(z-k)A1-40

при этом охватывают производные эксендина-3 различной длины, в которых z представляет собой число от 1 до 38, но меньше k, которое может означать число от 2 до 39. А представляет собой присоединенную группу, которая стоит в любом месте, но предпочтительно у С-конца и у более высокого (положения), чем y. Присоединенная группа предпочтительно представляет собой амин лизин.

Эксендин-4(z-k)A1-40

при этом охватывают производные эксендина-4 различной длины, в которых z представляет собой число от 1 до 38, но меньше k, которое может означать число от 2 до 39. А представляет собой присоединенную группу, которая стоит в любом месте, но предпочтительно у С-конца и у более высокого (положения), чем y. Присоединенная группа предпочтительно представляет собой амин лизин.

В частности, предпочтительны производные пептидов:

1. MC 10: (DTPA-Lys37)GLP-1(7-36)амид

2. MC 13: (DTPA-Lys40)эксендин-3 амид

3. MC 11: (DTPA-Lys40)эксендин-4 амид

Синтез осуществляли, например, через фирму Peptide Specialty Laboratories GnbH по способу Merrifield и очищали ВЭЖХ.

MC 10 (DTPA-Lys37)GLP1(7-36)амид состоит из аминокислот 7-36 GLP-1 и содержит у С-конца в качестве аминокислоты со свободной аминогруппой предпочтительно лизин в положении 37, а также хелатирующий агент DTPA.

МС 13 (DTPA-Lys40)эксендин-3 амид состоит из общей аминокислотной последовательности эксендина-3 и содержит у С-конца в качестве аминокислоты со свободной аминогруппой предпочтительно лизин в положении 40, а также хелатирующий агент DTPA.

МС 11 (DTPA-Lys40)эксендин-4 амид состоит из общей аминокислотной последовательности эксендина-4 и содержит у С-конца в качестве аминокислоты со свободной аминогруппой предпочтительно лизин в положении 39, а также хелатирующий агент DTPA.

Согласно изобретению были получены следующие химерные пептиды из GLP-1(1-37) и эксендина-3 или эксендина-4.

GLP-1(x-y)эксендин-3(z-k)A 1-75

GLP-1(x-y)эксендин-4(z-k)A 1-75

Эксендин-3(z-k)GLP-1(x-y)A 1-75

Эксендин-4(z-k)GLP-1(x-y)A 1-75

Причем (буквы) означают:

х=аминокислоты 1-36 аминокислотной последовательности GLP-1

y=аминокислоты 2-37 аминокислотной последовательности GLP-1

z=аминокислоты 1-38 аминокислотной последовательности эксендина-3 или эксендина-4

k=аминокислоты аминокислотной последовательности 2-39 эксендина-3 или эксендина-4

А=присоединенная группа, состоящая из одной или более аминокислот или их производных в качестве сигнальной молекулы как таковой, или для связывания или стабилизации. (Группа) А предпочтительно локализована у С-конца и предпочтительно представляет собой, например, лизин или, в качестве альтернативы, другую аминокислоту со свободной аминогруппой, такую как, например, орнитин, или органическую группу со свободной аминогруппой, к которой присоединяется хелатирующий агент для мечения радионуклидами или MRT-контрастным средством, флуоресцирующим красителем или химиотерапевтическим средством. Хелатирующий агент представляет собой, например, DTPA (диэтилентриаминопентауксусную кислоту, в качестве альтернативы N,N-бис(2-[бис(карбоксиметил)амино]этил)глицин), в качестве альтернативы DOTA (1,4,7,10-тетраазациклододекан-1,4,7,10-тетрауксусную кислоту, NYNIC (6-гидразинопиридин-3-карбоновую кислоту, MAG3 (меркаптоацетилглицилглицилглицин), N4 (1,4,8,11-тетраазаундекан) и известные производные всех названных хелатирующих агентов.

Верхний индекс означает, у какого положения аминокислотной последовательности альтернативно может находиться присоединенная группа.

GLP-1(x-y)эксендин-3(z-k)A 1-75

при этом охватывает химерные пептиды из GLP-1 и эксендина-3, в которых аминокислоты с 1 по 36 происходят от GLP-1 и последующие аминокислоты с 1 по 39 от эксендина-3. (Группа) А представляет собой присоединенную группу, которая стоит в любом месте, но предпочтительно у С-конца, и в большинстве случаев является аминокислотой из GLP-1 и эксендина-3, предпочтительно амином лизином.

GLP-1(x-y)эксендин-4(z-k)A 1-75

при этом охватывает химерные пептиды из GLP-1 и эксендина-4, в которых аминокислоты с 1 по 36 происходят от GLP-1 и последующие аминокислоты с 1 по 39 от эксендина-4. (Группа) А представляет собой присоединенную группу, которая стоит в любом месте, но предпочтительно у С-конца, и в большинстве случаев является аминокислотой из GLP-1 и эксендина-4, предпочтительно амином лизином.

Эксендин-3(z-k)GLP-1(x-y)A 1-75

при этом охватывает химерные пептиды из эксендина-3 и GLP-1, причем z может означать числа от 1 до 38, но меньше k, которое может означать число от 2 до 39. (Группа) А представляет собой присоединенную группу, которая стоит в любом месте, но предпочтительно у С-конца, и в большинстве случаев выше y. Присоединенная группа предпочтительно представляет собой амин лизин.

Эксендин-4(z-k)GLP-1(x-y)A 1-75

при этом охватывает химерные пептиды из эксендина-4 и GLP-1, причем z может означать числа от 1 до 38, но меньше k, которое может означать число от 2 до 39. (Группа) А представляет собой присоединенную группу, которая стоит в любом месте, но предпочтительно у С-конца, и в большинстве случаев выше y. Присоединенная группа предпочтительно представляет собой амин лизин.

Например, химерный пептид GLP-1(x-y)эксендин-3(z-k)A1-75 или GLP-1(х-y)эксендин-4(z-k)A1-75 представляет собой пептид МС12, состоящий из GLP-1(7-36)эксендин(33-39)Lys-амида (синтез на фирме Specialty Laboratories GmbH по способу Merrifield и очистка ВЭЖХ).

МС12: (Ser37,Gly38,Ala39,Pro40,Pro41,Pro42,Ser43,DTPA-Lys44-амид)GLP1(7-36)

МС12 состоит из всей аминокислотной последовательности GLP-1(7-36) и у С-конца содержит амин, предпочтительно лизин, в положении 44, а также хелатирующий агент DTPA, а также дополнительную цепь из 7 аминокислот от эксендина(33-39)Lys- амида. Этим представлен химерный пептид GLP-1(7-36)эксендин(33-39)Lys-амид.

Специалисту очевидно, что при этом (могут быть) представлены производные пептидов из GLP-1, эксендина-3 и эксендина-4, а также химерные пептиды различной длины из GLP-1, эксендина-3 и эксендина-4, в основе которых лежат различные комбинации аминокислотных последовательностей из GLP-1, эксендина-3 и эксендина-4.

Предложенные производные пептидов GLP-1, эксендина-3 и эксендина-4, а также химерные пептиды из GLP-1, эксендина-3 и эксендина-4, которые модифицированы амином у С-конца, а N-концом могут связываться с GLP-1-рецептором, включают в себя также молекулы, аминокислотные последовательности которых отличаются от описанных пептидов GLP-1, эксендина-3 и эксендина-4 по одному или нескольким положениям и имеют более высокую степень гомологии указанных последовательностей. Гомология означает при этом идентичность последовательностей по меньшей мере на 40%, в частности, идентичность по меньшей мере на 60%, предпочтительно на 80% и особенно предпочтительно на 90%. Отклонения от вышеописанных аминокислотных последовательностей при этом могут возникнуть в результате удаления, замещения и/или внедрения.

Сверх того были получены предложенные химерные пептиды из GLP-1, эксендина-3 или эксендина-4 также без модифицирования С-конца и при этом найдено их применение, особенно при получении средства для терапии диабета.

GLP-1(x-y)эксендин-3(z-k)

GLP-1(x-y)эксендин-4(z-k)

Эксендин-3(z-k)GLP-1(x-y)

Эксендин-4(z-k)GLP-1(x-y)

MC20:(Ser33,Gly34,Ala35,Pro36,Pro37,Pro38,Ser39)эксендинGLP-1(7-36)

МС20 состоит из всей аминокислотной последовательности GLP-1(7-36) и содержит у С-конца цепь из 7 аминокислот эксендина (33-39). При этом представлен не модифицированный химерный пептид GLP-1(7-36)эксендин(33-39).

Мечение производных пептидов и химерных пептидов

Предложенные производные пептидов и химерные пептиды для получения средства для диагностики и терапии доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия рецепторов GLP-1, растворяли в подходящем стабилизирующем буферном растворе, например, для стабилизации металла, предпочтительно в 0,5 М ацетате натрия, рН 5,4, в концентрации около 10-3 М. В качестве альтернативы для стабилизации флуоресцирующих красителей предпочтителен буферный раствор из ацетата аммония, для стабилизации химиотерапевтических средств и контрастных средств физиологический буферный раствор.

Мечение осуществляют взаимодействием присоединенной группы А с радионуклидами, контрастными средствами MRT, флуоресцирующими красителями или химиотерапевтическими средствами. При этом для каждого вида применения in vitro или in vivo используют различные варианты.

В качестве радионуклидов для ковалентного или комплексного связывания использовали:

Нуклид Способ применения t1/2[ч] Испускаемые лучи Энергия [keV] Вид связывания
F-18 PET 1,8 в+ 634 Ковалентное
Cu-64 PET 12,7 в+ 1673 Комплексное
Cu-67 Терапия 61,8 в- 391 Комплексное
г 184
Ga-67 SPECT 79,2 г 93/184/300 комплексное
Ga-68 PET 1,1 в+ 2921 комплексное
Y-86 PET 14,8 в+ 1220 комплексное
г 1076/1153
Y-90 Терапия 64,1 в- 2280 комплексное
To-99m SPECT 6 г 140 комплексное
In-111 SPECT 67,2 г 171/245 комплексное
I-123 SPECT 13,2 г 158 ковалентное
I-124 PET 101 в+ 2137/1534 ковалентное
г 602
I-131 Терапия 192 г 364 ковалентное
в- 606
Lu-177 Терапия 158 г 208 комплексное
в- 112/208
Re-186 Терапия 88,8 г 137 комплексное
в- 1071
Re-188 Терапия 17 г 155/477/632 комплексное
в- 1965/2120
Pt-193m Терапия 104 г 135 комплексное
оже-е-
Pt-195m Терапия 96 г 98 комплексное
оже-е-
Ас-225 Терапия 240 г 99, 150 комплексное
б
At-211 Терапия 7,2 г 687 комплексное
оже-е- ковалентное
Bi-213 Терапия 0,76 440 комплексное
б
Sm-153 Терапия 46 г 103 комплексное
в-
Er-169 Терапия 226 в- 100 комплексное

РЕТ (позитронная эмиссионная томография), SPECT (компьютерная томография единичных протонов)

В качестве флуоресцирующего красителя/хромофора использовали, например: флуоресцеин, родамин, кумарин, пирен (каскадный синий (cascadblau)), люцифер желтый (lucifergelb), фикобилипротеин (phycobiliprotein), цианин, алексафтор (alexafluoro), орегон зеленый (oregongruen), тексафирин красный (texasrot), кумарин и их производные.

Хелатирующими агентами являются, например, DTPA (диэтилентриаминпентауксусная кислота, N,N-бис(2-[бис(карбоксиметил)амино]этил)глицин), DOTA (1,4,7,10-тетраазациклододекан-1,4,7,10-тетрауксусная кислота), HYNIC (6-гидразинопиридин-3-карбоновая кислота), MAG3 (меркаптоацетилглицилглицилглицин), N4 (1,4,8,11-тетраазаундекан) или производные всех указанных хелатирующих агентов.

Контрастными средствами MRT являются, например, гадолиний, марганец, европий, медь, никель, хром, празеодим, диспрозий или гольмий или их соединения, а также отрицательные MRT-контрастные средства, такие как, например, перфторуглероды, а также, например, изотопы для MRT-спектроскопии, такие как F-19, H-1, P-31, Na-19.

Отрицательные MRT-контрастные средства представляют собой котрастные средства, которые гасят или сильно ослабляют, но не усиливают сигналы MRT.

Химиотерапевтические средства представляют собой, в частности, аддукторы алкила (Alkylanzien), интеркаляторы, антиметаболиты, ингибиторы ферментов и митотические яды (например, алкилсульфонаты, производные этилиминонитрозомочевины, утратившие азот, аналоги фолиевой кислоты, аналоги пурина, аналоги пиримидина, аналоги подофиллина, таксаны, алкалоиды барвинка, антрациклины, прочие цитостатические антибиотики, соединения платины, производные камптотецина, различные гормоны, факторы роста, интерфероны или интерлейкины), кроме того химиотерапевтические средства, описанные в “Onkologie 2004/05” авторами Preiss, Dornhoff, Hagmann, Schmieder в Zuckschwerdtverlag на стр. 230-267, а также другие цитостатически или цитотоксично действующие вещества.

В зависимости от рода применения предложенных производных белков и химерных белков и от полученных из них средств для диагностики и терапии доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия рецепторов GLP-1, реакцию мечения проводили в двух вариантах.

Мечение для применения in vitro в радиотерапии

3 мкл раствора предложенного производного пептида или химерного пептида в подходящем стабилизирующем буфере, предпочтительно 0,5 М ацетате натрия, рН 5,4, с концентрацией около 10-3 М для мечения прибавляли к 500 мкл 0,5 М ацетата натрия, рН 5,4. При этом рН находился при 3-6. Туда же прибавляли 185 MBq 111InCl3 (Tyco, Petten, Нидерланды) в 500 мл 0,1 М HCl и инкубировали в течение 30 минут при 37°С. Для насыщения всех участков связывания снова прибавляли 3 мкл раствора natInCl3 и инкубировали еще в течение 30 минут.

Контроль качества проводили ВЭЖХ на колонке:

Колонка: СС 250/4,6 Nucleosil 120-5 C18(Machery-Nagel, Oenisingen, Швейцария)

Градиент: 0→5 мин 100% 0,05М NH4OOCCH3, рН 5,4 (буферный раствор А); 5→25 мин 100% буферный раствор А→50% буферного раствора А/50% ацетонитрила.

Контроль качества для применения in vitro выполняли при выходе мечения более 98%.

Таким образом получали в распоряжение радиоактивное меченое средство для диагностики и терапии доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия рецепторов GLP-1, такое как, например, вводимое в клеточные и тканевые культуры поджелудочной железы.

Мечение для применения in vivo при радиотерапии

3 мкл раствора предложенного производного пептида или химерного пептида в подходящем стабилизирующем буфере, предпочтительно 0,5 М ацетате натрия, рН 5,4, с концентрацией около 10-3 М для мечения прибавляли к 500 мкл 0,5 М ацетата натрия, рН 5,4. По окончании туда же прибавляли 185 MBq 111InCl3 (Tyco, Petten, Нидерланды) в 500 мл 0,1 М HCl и инкубировали в течение 30 минут при 37°С. Контроль качества проводили ВЭЖХ на колонке:

Колонка: СС 250/4,6 Nucleosil 120-5 C18(Machery-Nagel, Oenisingen, Швейцария)

Градиент: 0→5 мин 100% 0,05М NH4OOCCH3, рН 5,4 (буферный раствор А); 5→25 мин 100% буферный раствор А→50% буферного раствора А/50% ацетонитрила.

Контроль качества для применения in vivo выполняли при выходе мечения более 98%.

Таким образом получали радиоактивное меченое средство для диагностики и терапии доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия рецепторов GLP-1, например, для определения опухолей у пациента.

Понятие пациент означает здесь равным образом человека и позвоночное животное. Таким образом, средство применимо в медицине и ветеринарии. Терапевтически и диагностически действующие средства по изобретению вводят пациенту как часть фармацевтически приемлемой композиции либо перорально, ректально, парентерально, внутривенно/внутриартериально, внутримышечно, внутрисосудисто, местно (порошок, мазь или капли), либо в виде спрея. Соответствующая дозировка в каждом случае применения для диагностики и терапии доброкачественных и злокачественных заболеваний, при которых играет роль экспрессия рецепторов GLP-1, устанавливается врачом.

Изучение интернализации

Изучение интернализации показывает, например, перенос радиоактивно меченых in vitro предложенных производных пептидов и химерных белков в клетки.

В 6-луночный планшет высевали 100000 СНО-клеток, трансфицированных GLP-1-рецепторами. Клетки выращивали до сливания. Были образованы 4 группы:

Группа 1: общее связывание, промывание PBS

К 2 мл среды прибавляли меченый 100000 cpm 111In пептид (10-15 моль) и инкубировали в течение 1 ч при 37°С. Затем трижды промывали PBS и отделяли клетки 20 мМ MOPS (3-морфолинопропансульфокислотой)+0,1% тритон-Х-100 (рН 7,4). Захват в клетки измеряли на γ-счетчике. Число клеток измеряли по содержанию белка при помощи набора для определения белка из Bio-Rad (Мюнхен, Германия) на основе способа Bradford'a. Результат выражали в cpm/мкг белка.

Группа 2: неспецифическое связывание, промывание PBS

К 2 мл среды прибавляли 20 мкл 10-3 М раствора GLP-1 и меченый 100000 cpm 111In пептид и инкубировали в течение 1 ч при 37°С. Затем трижды промывали PBS и отделяли клетки 20 мМ MOPS (3-морфолинопропансульфокислотой)+0,1% тритон-Х-100 (рН 7,4). Захват в клетки измеряли на γ-счетчике. Число клеток измеряли по содержанию белка при помощи набора для определения белка из Bio-Rad (Мюнхен, Германия) на основе способа Bradford'a. Результат выражали в cpm/мкг белка.

Группа 3: общее связывание, промывание кислотой

К 2 мл среды прибавляли 20 мкл 10-3 М раствора GLP-1 и меченый 100000 cpm 111In пептид и инкубировали в течение 1 ч при 37°С. Затем промывали 1 раз 0,1 М буферным раствором ацетата натрия, рН 4, и дважды PBS и отделяли клетки 20 мМ MOPS (3-морфолинопропансульфокислотой)+0,1% тритон-Х-100 (рН 7,4). Захват в клетки измеряли на γ-счетчике. Число клеток измеряли по содержанию белка при помощи набора для определения белка из Bio-Rad (Мюнхен, Германия) на основе способа Bradford'a. Результат выражали в cpm/мкг белка.

Группа 4: неспецифическое связывание, промывание кислотой

К 2 мл среды прибавляли 20 мкл 10-4 М раствора GLP-1 и меченый 100000 cpm 111In пептид и инкубировали в течение 1 ч при 37°С. Затем промывали 1 раз 0,1 М буферным раствором ацетата натрия, рН 4, и дважды PBS и отделяли клетки 20 мМ MOPS (3-морфолинопропансульфокислотой)+0,1% тритон-Х-100 (рН 7,4). Захват в клетки измеряли на γ-счетчике. Число клеток измеряли по содержанию белка при помощи набора для определения белка из Bio-Rad (Мюнхен, Германия) на основе способа Bradford'a. Результат выражали в cpm/мкг белка.

%IdsB=% внедрения специфического связывания

%IdsB
MC10 75±5
MC11 70±7
MC12 73±9

Результаты показывают, что происходит хороший перенос в клетки.

Изучение связывания

Изучение связывания показывает специфическое связывание радиоактивно меченых in vivo предложенных производных пептидов и химерных белков с GLP-1-рецепторами.

В 6-луночный планшет высевали 100000 СНО-клеток, трансфицированных GLP-1-рецепторами. Клетки выращивали до сливания. Затем прибавляли в 2 мл маркированного 100000 cpm111In пептида. Для определения связывание блокировали 20 мкл 10-3 М раствора GLP-1.

% блокирования
МС10 80±3
МС11 85±3
МС12 77±6

Биораспределение in vivo получали на грызунах, например, на голых мышах. Для этого впрыскивали трансфицированные GLP-1 СНО-клетки голым мышам. Через 3-5 недель опухоли вырастали до величины около 300 мг. Мышам впрыскивали предложенный меченый 37 MBq 111In пептид через хвостовую вену и через 4 ч измеряли мышей в γ-камере.

При этом происходило быстрое очищение через почки и поглощение почками. Более высокое поглощение происходило равным образом в опухолевой ткани, позитивной по рецепторам GLP-1, в то время как опухолевые ткани, негативные по рецепторам GLP-1, едва проявляли поглощение. Легкое поглощение также наблюдали в поджелудочной железе, другие органы не проявляли видимого поглощения.

Изучение биораспределения ex vivo проводили в группах по 4 мыши, при котором впрыскивали 555 kBq In-111 в хвостовую вену. Через 1, 4 и 24 ч после впрыскивания мышей убивали и извлекали органы.

Измеряли поглощение радиоактивности и органы взвешивали.

Рассчитывали % впрыснутой дозы на грамм массы органа (%i.D./г).

Результаты выглядели следующим образом:

Орган 1 ч Станд. отклонение 4 ч Станд. отклонение 24 ч Станд. отклонение
Кровь 0,01 0,00 0,00 0,00 0,00 0,00
Печень 0,03 0,01 0,01 0,01 0,01 0,00
Желудок 0,14 0,10 0,13 0,07 0,07 0,06
Селезенка 0,02 0,02 0,01 0,00 0,01 0,00
Поджелудоч-ная железа 0,58 0,50 0,62 0,28 0,37 0,27
Почки 7,90 3,62 7,41 3,56 4,85 3,05
Кишечник 0,12 0,06 0,07 0,06 0,04 0,03
Легкие 0,80 0,56 0,36 0,17 0,22 0,07
Сердце 0,02 0,01 0,01 0,01 0,00 0,00
Кости 0,02 0,04 0,01 0,00 0,01 0,01
Мышцы 0,01 0,00 0,00 0,00 0,00 0,00
Опухоль - 0,03 0,03 0,02 0,01 0,01 0,00
Опухоль + 0,42 0,19 0,31 0,30 0,20 0,16

Средние значения биораспределения для 4 мышей в группе в %i.D./г. Станд. отклонение: стандартное отклонение.

1. Пептидные производные эксендина-4 в качестве средства для диагностики и терапии заболеваний, в которых играет роль экспрессия рецепторов GLP-1, отличающиеся тем, что они модифицированы у С-конца амином и N-концом связываются с GLP-1-рецепторами и частично или полностью содержат аминокислотную последовательность пептида эксендина-4:
,
отличающиеся тем, что они построены из эксендина-4(z-k)А1-40,
причем z представляет собой аминокислоты 1-38 аминокислотных последовательностей эксендина-3 или эксендина-4,
k представляет собой аминокислоты 2-39 аминокислотных последовательностей эксендина-3 или эксендина-4 и А означает присоединенную группу, состоящую из одной или более аминокислот или их производных в качестве сигнальной молекулы как таковой или для связывания сигнальных молекул или для стабилизации, причем верхние индексы показывают, в каком положении аминокислотной последовательности находятся присоединенные группы.

2. Пептидные производные эксендина-4 по п.1, отличающиеся тем, что присоединенные группы А предпочтительно локализованы у С-концов и представляют собой амин.

3. Пептидные производные эксендина-4 по п.1, отличающиеся тем, что присоединенная группа предпочтительно представляет собой лизин.

4. Пептидные производные эксендина-4 по п.2, отличающиеся тем, что присоединенная группа представляет собой аминокислоту со свободной аминогруппой, такую как орнитин, или органическую группу со свободной аминогруппой.

5. Пептидные производные эксендина-4 по п.1, отличающиеся тем, что к присоединенной группе А присоединен хелатирующий агент для мечения радионуклидами или MRT-контрастным средством, флуоресцирующим красителем или химиотерапевтическим средством.

6. Пептидные производные эксендина-4 по п.5, отличающиеся тем, что хелатирующий агент представляет собой N,N-бис(2-[бис(карбоксиметил)амино]этил)глицин, DOTA (1,4,7,10-тетраазадодекан-1,4,7,10-тетрауксусную кислоту), NYNIC (6-гидразинопиридин-3-карбоновую кислоту), MAG3 (меркаптоацетилглицилглицилглицин), N4(1,4,8,11-тетраазадекан) и их известные производные, предпочтительно DTPA (диэтилентриаминопентауксусную кислоту).

7. Пептидные производные эксендина-4 по п.5, отличающиеся тем, что мечение является взаимодействием с радионуклидом, MRT-контрастным средством, флуоресцирующим красителем и/или химиотерапевтическим средством.

8. Пептидные производные эксендина-4 по п.5, отличающиеся тем, что флуоресцирующий краситель выбран, в частности, из группы флуоресцеина, родамина, кумарина, BODYPY, пирена (каскадного синего), люцифера желтого, фикобилипротеина, цианина, алексафтора, орегонового зеленого, тексафирина красного, кумарина и их производных.

9. Пептидные производные эксендина-4 по п.5, отличающиеся тем, что радионуклид выбран, в частности, из группы F-18, Сu-64, Сu-67, Ga-67, Ga-68, Y-86, Y-90, Tc-99m, In-111, I-123, I-124, I-131, Lu-177, Re-186, Re-188, Pt-193m, Pt-195m, Ac-225, At-211, Bi-213, Sm-153 или Er-169.

10. Пептидные производные эксендина-4 по п.5, отличающиеся тем, что MRT-контрастное средство представляет собой гадолиний, марганец, железо, европий, медь, никель, хром, празеодим, диспрозий или гольмий или их соединения или перфторуглероды или F-19, H-1, P-31, Na-19.

11. Пептидные производные эксендина-4 по п.5, отличающиеся тем, что химиотерапевтический агент выбран, в частности, из группы алкилсульфонатов, производных этилиминонитрозомочевины, утративших азот, аналогов фолиевой кислоты, аналогов пурина, аналогов пиридина, производных подофиллина, таксанов, алкалоидов барвинка, антрациклинов, прочих цитостатических антибиотиков, соединений платины, производных камптотецина, гормонов, факторов роста, интерферонов или интерлейкинов или цитостатически, или цитотоксично действующих веществ.

12. Пептидные производные эксендина-4 по п.5, отличающиеся тем, что осуществляют мечение путем взаимодействия с радионуклидами для применения in vitro насыщением мест связи natInCl3.

13. Применение пептидных производных эксендина-4 по п.1 для получения средства для диагностики и терапии заболеваний, при которых играет роль экспрессия рецепторов GLP-1.

14. Применение пептидных производных эксендина-4 по п.1 для определения плотности инсулин-продуцирующих клеток в ткани.

15. Применение пептидных производных эксендина-4 по п.1 для определения экспрессии GLP-1-рецепторов или их плотности.

16. Средство для диагностики заболеваний, при которых играет роль экспрессия рецепторов GLP-1, отличающееся тем, что оно содержит меченые пептидные производные эксендина-4 по п.1.

17. Средство для терапии заболеваний, при которых играет роль экспрессия рецепторов GLP-1, отличающееся тем, что оно содержит меченые пептидные производные эксендина-4 по п.1.

18. Средство для диагностики заболеваний, при которых играет роль экспрессия рецепторов GLP-1, отличающееся тем, что оно содержит немеченые пептидные производные эксендина-4 по п.1.

19. Средство для терапии заболеваний, при которых играет роль экспрессия рецепторов GLP-1, отличающееся тем, что оно содержит немеченые пептидные производные эксендина-4 по п.1.

20. Средство по п.16, отличающееся тем, что мечение состоит во взаимодействии с радионуклидами, MRT-контрастными средствами, флуоресцирующими красителями и/или химиотерапевтическими средствами.

21. Применение средства по п.16 для диагностики и терапии заболеваний, при которых играет роль экспрессия рецепторов GLP-1.

22. Применение средства по п.16 для диагностики и терапии нейроэндокринных опухолей (NET), в частности инсулиномы и мелкоклеточного бронхогенного рака.

23. Применение средства по п.16 в сцинциграфии, PET, SPECT, MRT, оптической диагностике, опосредованной рецепторами химиотерапии, опосредованной рецепторами цитостатической и цитотоксической терапии и радиопептидной терапии.

24. Применение средства по п.18 для диагностики и терапии заболеваний, при которых играет роль экспрессия рецепторов GLP-1.

25. Применение средства по п.18 для диагностики и терапии нейроэндокринных опухолей (NET), в частности инсулиномы и мелкоклеточного бронхогенного рака.



 

Похожие патенты:

Изобретение относится к новым производным глюкагон-подобного пептида (GLP-1), которые имеют пролонгированный профиль действия, их фармацевтическим композициям и применению соединений для приготовления лекарственного средства для лечения или предотвращения гипергликемии, диабета 2 типа или ожирения.

Изобретение относится к производным GLP-1 родительского пептида, имеющим один или два липофильных заместителя, которые присоединены необязательно через аминокислоту или дипептидный спейсер к аминокислотному остатку, который не является N-концевым или С-концевым аминокислотным остатком, где родительский пептид имеет последовательность: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, или имеет в сумме до десяти аминокислотных остатков, замененный на любой -аминокислотный остаток, который может быть кодирован с помощью генетического кода.

Изобретение относится к пептидным аналогам глюкагонподобного пептида-1 формулы (R2R3)-A7-A8-A9-A10-A11-A12-A13-A14-A15-A16-A17-A18-A19-A20-A21-A22-А23-А24-А25-А26-А27-А28-А29-А30-А31-А32-А33-А34-А35-А36-А37-А38-А39-R1, значения радикалов указаны в формуле изобретения.

Изобретение относится к соединениям формулы (R2R3)-А7-А8-А9-А10-А11-А12-А13-А14-А15-А16-А17-А18-А19-А20-А21-А22-А23-А24-А25-А26-А27-А28-А29-А30-А31-А32-А33-А34-А35-А36-А37-R1, где А7-А37 представляют собой различные аминокислотные остатки, значения радикалов см.

Изобретение относится к области биотехнологии. .

Изобретение относится к области медицины и касается стимулятора регенерации панкреатических бета-клеток и продуцирования инсулина в панкреатических бета-клетках.

Изобретение относится к агонистам рецептора нейропептида-2 формулы (I): а также к их фармацевтически приемлемым солям, производным и фрагментам, в которых заместители имеют значения, указанные в описании.

Изобретение относится к области биотехнологии, конкретно к получению новых полипептидов, участвующих в регуляции углеводного обмена, и может быть использовано в медицине.
Изобретение относится к биотехнологии. .

Изобретение относится к пептидильным аналогам грелина, активным при GHS-рецепторе. .

Изобретение относится к дерматологии и представляет собой терапевтическое средство для лечения кожных повреждений, содержащее в качестве активного ингредиента вещество, которое воздействует на рецептор, стимулирующий секрецию гормона роста, или его фармацевтически приемлемую соль, где вещество представляет собой пептид, выбранный из группы, состоящей из: (i) пептидного соединения с аминокислотной последовательностью, представленной любой из последовательностей SEQ ID NO:1-21, где остаток аминокислоты в положении 3, считая от аминоконца, представляет собой модифицированный аминокислотный остаток, в гидроксильную группу боковой цепи которого введена жирная кислота; и (ii) пептидного соединения с аминокислотной последовательностью, представленной любой из последовательностей SEQ ID NO:1-21, где одна или несколько аминокислот в положении 5, считая от аминоконца к карбоксиконцу, удалены, замещены и/или добавлены, при этом третий аминокислотный остаток, считая с аминоконца, представляет собой модифицированный аминокислотный остаток, в боковую цепь которого введена жирная кислота; и (iii) GHRP-6; при этом терапевтическое средство содержит активный ингредиент в количестве от 0,001 мг до 100 мг на единицу состава.
Наверх