Способы лечения диабета и снижения массы тела



Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела
Способы лечения диабета и снижения массы тела

 


Владельцы патента RU 2421237:

АМИЛИН ФАРМАСЬЮТИКАЛЗ, ИНК. (US)

Изобретение относится к медицине и касается способа снижения массы тела, лечения диабета, снижения уровня HbA1C или снижения уровня глюкозы в плазме натощак посредством использования эксендина или аналога агониста эксендина. Изобретение обеспечивает достижение конкретного уровня (от 170 пг/мл до 290 пг/мл) содержания эксендина или аналога агониста эксендина в плазме в течение по меньшей мере 1 месяца. 2 н. и 17 з.п. ф-лы, 3 ил., 3 табл.

 

ПЕРЕКРЕСТНАЯ ССЫЛКА НА РОДСТВЕННЫЕ ЗАЯВКИ

В настоящей заявке испрашивается приоритет по условной заявке США №60/709604,

зарегистрированной 19 августа 2005 года, и условной заявке США №60/779216, зарегистрированной 3 марта 2006 года, которые приведены здесь в полном объеме в качестве ссылки.

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Настоящее изобретение относится к областям медицины, здравоохранения и питания. Более конкретно, настоящее изобретение относится к способам и композициям для лечения диабета и снижения массы тела или изменения состава тканей организма индивида.

УРОВЕНЬ ТЕХНИКИ

Ожирение представляет собой состояние, поражающее миллионы американцев. По оценкам последних статистических данных из Центра по контролю заболеваемости ("CDC") приблизительно 65% всех американцев имеют избыточную массу или страдают ожирением, и, в целом, предполагают, что эти цифры возрастают. Страдание ожирением или обладание избыточной массой могут значительно увеличивать риск заболеваемости гипертензией; дислипидемией; диабетом типа 2; ишемической болезнью сердца; инсультом; заболеванием желчного пузыря; остеоартритом; апноэ во время сна и дыхательными затруднениями; а также раком эндометрия, молочной железы, предстательной железы и толстой кишки. Также повышенная масса тела связана с возрастанием общей смертности. Кроме того, страдание ожирением или обладание избыточной массой могут служить причиной того, что индивид имеет отрицательное представление о своем образе.

В случае человека пациентами с избыточной массой или ожирением считают тех, кто обладает значением индекса массы тела (BMI), равным или превышающим 25. BMI

представляет собой общепринятую оценку, выражающую взаимосвязь (или отношение) массы к росту. Она представляет собой математическую формулу, по которой массу тела индивида в килограммах делят на квадрат величины его или ее роста в метрах (т.е. масса/(рост)2). Индивидов с BMI от 25 до 29,9 считают обладающими избыточной массой, тогда как индивидов с BMI 30 или выше считают страдающими ожирением.

Согласно клиническому руководству NIH по выявлению, оценке и лечению избыточной массы и ожирения у взрослого человека, всех взрослых (в возрасте 18 лет или старше), которые имеют BMI 25 или выше, считают обладающими риском преждевременной смерти и инвалидности как результата наличия избыточного веса или ожирения. Эти риски для здоровья возрастают еще больше по мере увеличения ожирения индивида.

По этим причинам существует очень большой интерес к лечению ожирения. Существующие в настоящее время варианты лечения включают в себя общепринятые диеты и упражнения, очень низкокалорийные диеты, поведенческую терапию, фармакотерапию, включающую в себя средства, подавляющие аппетит, термогенные лекарственные средства, ингибиторы всасывания пищи, механические устройства, такие как фиксаторы челюстей, пояса и баллоны для талии, а также хирургическое вмешательство, такое как обходной желудочный анастамоз. Jung and Chong, Clinical Endocrinology, 35:11-20 (1991); Bray, Am. J. Clin. Nutr., 55:538S-544S (1992). Однако по-прежнему требуются дополнительные способы снижения массы или лечения ожирения.

Однако в целом желательна потеря жировой компоненты организма, а потеря сухой массы тела и, в частности, белка нежелательна. Сухая масса тела включает в себя мускулатуру, жизненно важные органы, кости, соединительную ткань и другие не содержащие жира ткани организма. Сухая масса тела состоит из 50-60 мас.% мышц, с преобладанием среди мышц скелетной мускулатуры. Сухая масса тела высоко активна, метаболически и физиологически, и предполагают, что потеря сухой массы тела вредна для здоровья индивида. Увеличение сухой массы тела способствует возрастанию метаболизма в организме и, таким образом, способствует потере массы и поддержанию какого-либо снижения массы. Таким образом, в ходе процесса потери массы желательны предотвращение или минимизация потери сухой массы тела.

Ограничение калорий вне зависимости от его вида часто связано с катаболизмом белков организма, приводящим к отрицательному балансу азота и потере сухой массы тела. В качестве средств уменьшения потерь азота в ходе ограничения калорий использовали диеты, дополненные белками. Было указано, что модифицированное голодание, щадящее в отношении белка, является эффективным для потери массы у подростков; однако эти диеты могут приводить только к умеренному удержанию азота. Lee et al., Clin. Pediatr., 31:234-236, 1992.

Сахарный диабет представляет собой тяжелое метаболическое заболевание, которое определяют по наличию хронически повышенных уровней глюкозы в крови (гипергликемия). Это состояние гипергликемии является результатом относительного или абсолютного отсутствия активности пептидного гормона инсулина. Инсулин продуцируется и секретируется β-клетками поджелудочной железы. Установлено, что инсулин способствует утилизации глюкозы, синтезу белков и формированию и запасу энергии углеводов в виде гликогена. Глюкоза запасается в организме в виде гликогена, полимерной формы глюкозы, которая может быть преобразована обратно в глюкозу для удовлетворения потребностей метаболизма. В обычных условиях инсулин секретируется как на исходном уровне, так и на повышенном уровне после стимуляции глюкозой, все для поддержания гомеостаза метаболизма посредством преобразования глюкозы в гликоген.

Термин "сахарный диабет" включает в себя несколько различных состояний гипергликемии. Эти состояния включают в себя диабет типа I (инсулинозависимый сахарный диабет или IDDM) и типа II (инсулиннезависимый сахарный диабет или NIDDM). Гипергликемия, присутствующая у индивидов с диабетом типа I, связана с недостаточными, сниженными или отсутствующими уровнями инсулина, которые недостаточны для поддержания уровней глюкозы в крови в пределах физиологического диапазона. Лечение диабета типа I включает в себя введение возмещающих доз инсулина, как правило, парентеральным способом. Гипергликемия, присутствующая у индивидов с диабетом типа II, исходно связана с нормальными или повышенными уровнями инсулина; однако эти индивиды неспособны поддерживать гомеостаз метаболизма вследствие состояния резистентности к инсулину в периферических тканях и печени и, по мере развития заболевания, вследствие прогрессирующего разрушения β-клеток поджелудочной железы, ответственных за секрецию инсулина. Таким образом, первоначальное лечение диабета типа II может быть основано на диете и изменениях образа жизни, дополняемых терапией гипогликемическими средствами для перорального применения, такими как сульфонилмочевины. Для осуществления определенного контроля над гипергликемией и минимизации осложнений заболевания часто бывает необходимо лечение инсулином, при этом особенно на поздних стадиях заболевания.

Эксендины представляют собой пептиды, обнаруживаемые в слюне ящерицы-ядозуба, которая является эндогенной для Аризоны ящерицей, а также мексиканской ящерицы-ядозуба. Эксендин-3 присутствует в слюне Heloderma horridum, а эксендин-4 присутствует в слюне Heloderma suspectum (Eng, J., et al., J. Biol. Chem., 265:20259-62, 1990; Eng., J., et al., J. Biol. Chem., 267:7402-05, 1992). Эксендины обладают определенным сходством аминокислотной последовательности с некоторыми членами семейства глюкагоноподобных пептидов, при наивысшем совпадении аминокислот 53% для GLP-1 (Goke, et al., J. Biol. Chem., 268:19650-55, 1993).

Эксендин-4 является эффективным агонистом рецептора GLP-1 in vitro. Также пептид стимулирует высвобождение соматостатина и ингибирует высвобождение гастрина в изолированных желудках (Goke, et al., J. Biol. Chem., 268:19650-55, 1993; Schepp, et al., Eur. J. Pharmacol., 69:183-91, 1994; Eissele, et al., Life Sci., 55:629-34, 1994). Было обнаружено, что эксендин-3 и эксендин-4 являются агонистами рецептора GLP-1 при стимуляции продукции цАМФ в ацинарных клетках поджелудочной железы и высвобождении из них амилазы (Malhotra, R., et al., Regulatory Peptides, 41:149-56, 1992; Raufman, et al., J. Biol. Chem., 267:21432-37, 1992; Singh, et al., Regulatory Peptides., 53:47-59, 1994). Для лечения сахарного диабета и профилактики гипергликемии было предложено использование инсулинотропной активности эксендина-3 и эксендина-4 (Eng, патент США №5424286). Было предложено введение эксендинов два раза в сутки, а также продолжительное введение (патент США №6924264 и патентная заявка США №20040053819).

Таким образом, существует необходимость в способах снижения массы тела, в частности снижения массы у индивидов, страдающих диабетом. Особый интерес представляют собой способы снижения массы тела, щадящие сухую массу тела. В настоящей заявке описаны способы, удовлетворяющие этим потребностям.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Один из вариантов осуществления относится к способу снижения массы тела, включающему в себя введение индивиду, которому необходимо снизить массу тела, или индивиду, желающему снизить массу своего тела, препарата, который содержит по меньшей мере один эксендин, агонист эксендина или аналог агониста эксендина в количестве, достаточном для поддержания средней концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет приблизительно от 25 пг/мл до приблизительно 600 пг/мл, приблизительно от 170 пг/мл до приблизительно 600 пг/мл или приблизительно от 170 пг/мл до приблизительно 350 пг/мл. В дополнительных вариантах осуществления средняя концентрация в плазме составляет по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 85 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 300 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В других вариантах осуществления индивид страдает диабетом или нарушенной толерантностью к глюкозе.

Другой вариант осуществления относится к способу снижения массы тела у индивида, включающему в себя введение индивиду, которому необходимо снизить массу тела или который желает снизить массу тела, препарата, содержащего по меньшей мере один эксендин, аналог эксендина или аналог агониста эксендина, в количестве, которого достаточно для поддержания минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В дополнительных вариантах осуществления концентрацию по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме поддерживают на уровне, превышающем или равном приблизительно 25 пг/мл, превышающем или равном приблизительно 65 пг/мл, превышающем или равном приблизительно 75 пг/мл, превышающем или равном приблизительно 85 пг/мл, превышающем или равном приблизительно 100 пг/мл, превышающем или равном приблизительно 150 пг/мл, превышающем или равном приблизительно 170 пг/мл, превышающем или равном приблизительно 175 пг/мл, превышающем или равном приблизительно 200 пг/мл, превышающем или равном приблизительно 225 пг/мл, превышающем или равном приблизительно 250 пг/мл, превышающем или равном приблизительно 300 пг/мл, превышающем или равном приблизительно 350 пг/мл, превышающем или равном приблизительно 400 пг/мл, превышающем или равном приблизительно 450 пг/мл, превышающем или равном приблизительно 500 пг/мл, превышающем или равном приблизительно 550 пг/мл или превышающем или равном приблизительно 600 пг/мл. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналогов агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В других вариантах осуществления индивид страдает диабетом или нарушенной толерантностью к глюкозе.

Другие варианты осуществления относятся к способу изменения состава тканей организма, например снижению у индивида соотношения жировой ткани организма и не содержащей жира ткани, где способ включает в себя введение индивиду, которому необходимо изменить состав тканей организма или который желает изменить состав тканей организма, препарата, содержащего по меньшей мере один эксендин, аналог эксендина или аналог агониста эксендина в количестве, которое достаточно для поддержания средней или минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В дополнительных вариантах осуществления средняя или минимальная концентрация по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, приблизительно 75 пг/мл, приблизительно 85 пг/мл, приблизительно 100 пг/мл, приблизительно 150 пг/мл, приблизительно 170 пг/мл, приблизительно 175 пг/мл, приблизительно 200 пг/мл, приблизительно 225 пг/мл, приблизительно 250 пг/мл, приблизительно 300 пг/мл, приблизительно 350 пг/мл, приблизительно 400 пг/мл, приблизительно 450 пг/мл, приблизительно 500 пг/мл, приблизительно 550 пг/мл или приблизительно 600 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например изменению состава тканей организма, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В других вариантах осуществления индивид страдает диабетом или нарушенной толерантностью к глюкозе.

Дополнительные варианты осуществления относятся к способу лечения диабета, например, типа I, типа II или диабета, обусловленного беременностью, у индивида при необходимости этого, где способ включает в себя введение указанному индивиду препарата, содержащего по меньшей мере один эксендин, аналог эксендина или аналог агониста эксендина, в количестве, которое достаточно для поддержания средней или минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В одном из вариантов осуществления индивид в случае этой необходимости также страдает ожирением или желает, или нуждается в снижении массы тела. В дополнительных вариантах осуществления средняя или минимальная концентрация по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, приблизительно 75 пг/мл, приблизительно 85 пг/мл, приблизительно 100 пг/мл, приблизительно 150 пг/мл, приблизительно 170 пг/мл, приблизительно 175 пг/мл, приблизительно 200 пг/мл, приблизительно 225 пг/мл, приблизительно 250 пг/мл, приблизительно 300 пг/мл, приблизительно 350 пг/мл, приблизительно 400 пг/мл, приблизительно 450 пг/мл, приблизительно 500 пг/мл, приблизительно 550 пг/мл или приблизительно 600 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, снижению уровня глюкозы натощак, снижению отклонений уровня глюкозы после приема пищи и т.д., где эффект эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

Еще один вариант осуществления относится к способу снижения гемоглобина A1C (HbA1C) у индивида при необходимости этого, где способ включает в себя введение указанному индивиду препарата, содержащего по меньшей мере один эксендин, аналог эксендина или аналог агониста эксендина, в количестве, которое достаточно для поддержания средней или минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В одном из вариантов осуществления индивид в случае этой необходимости также страдает ожирением или желает, или нуждается в снижении массы тела. В дополнительных вариантах осуществления средняя или поддерживаемая концентрация по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, приблизительно 75 пг/мл, приблизительно 85 пг/мл, приблизительно 100 пг/мл, приблизительно 150 пг/мл, приблизительно 170 пг/мл, приблизительно 175 пг/мл, приблизительно 200 пг/мл, приблизительно 225 пг/мл, приблизительно 250 пг/мл, приблизительно 300 пг/мл, приблизительно 350 пг/мл, приблизительно 400 пг/мл, приблизительно 450 пг/мл, приблизительно 500 пг/мл, приблизительно 550 пг/мл или приблизительно 600 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению HbA1c, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

Другой вариант осуществления относится к способам уменьшения возрастания уровня глюкозы в крови после приема пищи в сравнении с уровнями глюкозы в крови до приема пищи или натощак у индивидов при необходимости этого, например у индивидов с диабетом типа I, типа II или обусловленным беременностью, или в сравнении с индивидами, на которых не воздействуют описанными в настоящей заявке способами, препаратами или лекарственными средствами, где способ включает в себя введение указанному индивиду препарата или лекарственного средства, содержащего по меньшей мере один эксендин, аналог эксендина или аналог агониста эксендина, в количестве, которое достаточно для поддержания средней или минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В дополнительных вариантах осуществления средняя или минимальная концентрация по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет по меньшей мере приблизительно 25 пг/мл, приблизительно 65 пг/мл, приблизительно 75 пг/мл, приблизительно 85 пг/мл, приблизительно 100 пг/мл, приблизительно 150 пг/мл, приблизительно 170 пг/мл, приблизительно 175 пг/мл, приблизительно 200 пг/мл, приблизительно 225 пг/мл, приблизительно 250 пг/мл, приблизительно 300 пг/мл, приблизительно 350 пг/мл, приблизительно 400 пг/мл, приблизительно 450 пг/мл, приблизительно 500 пг/мл, приблизительно 550 пг/мл или приблизительно 600 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления индивид в случае этой необходимости страдает ожирением или желает, или нуждается в снижении массы тела. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например, снижению отклонений уровня циркулирующей глюкозы после приема пищи, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

Другой вариант осуществления относится к способу снижения общей средней суточной концентрации глюкозы в крови у индивида при необходимости этого, например у индивида с диабетом типа I, типа II или обусловленным беременностью, где способ включает в себя введение указанному индивиду препарата или лекарственного средства, содержащего по меньшей мере один эксендин, аналог эксендина или аналог агониста эксендина, в количестве, которое достаточно для поддержания средней или минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В дополнительных вариантах осуществления средняя или минимальная концентрация по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 85 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 300 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления индивид в случае этой необходимости страдает ожирением или желает, или нуждается в снижении массы тела. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению средних суточных концентраций глюкозы в крови, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

В других вариантах осуществления любую из указанных выше средних или минимальных концентраций по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме поддерживают приблизительно от 12 часов, одних суток, одной недели или одного месяца до приблизительно одного года. В других вариантах осуществления любую из указанных выше средних или поддерживаемых концентраций в плазме обеспечивают в течение по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 5 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно одного месяца, по меньшей мере приблизительно 2 месяцев, по меньшей мере приблизительно 3 месяцев, по меньшей мере приблизительно 4 месяцев, по меньшей мере приблизительно 5 месяцев, по меньшей мере приблизительно 6 месяцев, по меньшей мере приблизительно 7 месяцев, по меньшей мере приблизительно 8 месяцев, по меньшей мере приблизительно 9 месяцев, по меньшей мере приблизительно 10 месяцев, по меньшей мере приблизительно 11 месяцев или по меньшей мере приблизительно одного года.

Описанные в настоящей заявке препараты можно вводить любыми приемлемыми способами, известными в данной области, например внутривенным введением, введением через слизистую, интраназальным, пероральным, внутримышечным, подкожным, трансдермальным введением, посредством ингаляции или введением через легкие. В одном из вариантов осуществления препарат представляет собой препарат с замедленным высвобождением или продолжительным действием, т.е. препарат высвобождает в организм по меньшей мере один эксендин, агонист эксендина или аналог агониста эксендина в течение заданного периода времени, например в течение приблизительно 1 суток, приблизительно 1 недели или приблизительно 1 месяца. В других вариантах осуществления препарат вводят один раз в сутки, раз в двое суток, раз в неделю, раз в две недели, раз в три недели, раз в месяц, раз в два месяца или раз в три месяца. В других вариантах осуществления препарат дополнительно содержит биосовместимый полимер и сахар, например сахарозу. В одном из конкретных вариантов осуществления препарат представляет собой препарат длительного действия, содержащий 5% (мас./мас.) по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина, где препарат вводят раз в неделю в дозе 2,0 мг. В другом конкретном варианте осуществления препарат представляет собой препарат длительного действия, содержащий 5% (мас./мас.) по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина, где препарат вводят раз в неделю в дозе 0,8 мг. Можно использовать любой препарат для замедленного высвобождения эксендина, агониста эксендина или аналога агониста эксендина, включая, но ими не ограничиваясь, патент США №6828303; публикации патентных заявок США №20060084604, 20060034923, 20060034889 и 20050171503; европейскую публикацию патентной заявки EP 1512395 A1; и международные публикации патентных заявок WO2006041538, WO2006017852, WO2005041873, WO2005112633 и WO2005040195.

В других вариантах осуществления любой из описанных в настоящей заявке способов или лекарственных средств приводит к снижению массы тела индивида по меньшей мере на 1%, по меньшей мере на 5%, по меньшей мере на 10%, по меньшей мере на 20%, по меньшей мере на 30%, по меньшей мере на 40% или по меньшей мере на 50%. В дополнительных вариантах осуществления любой из описанных в настоящей заявке способов приводит к снижению массы тела индивида по меньшей мере приблизительно на 5 фунтов или 2 кг, по меньшей мере приблизительно на 10 фунтов или 5 кг, по меньшей мере приблизительно на 20 фунтов или 10 кг, по меньшей мере приблизительно на 30 фунтов или 15 кг, по меньшей мере приблизительно на 40 фунтов или 20 кг, по меньшей мере приблизительно на 50 фунтов или 25 кг, по меньшей мере приблизительно на 75 фунтов или 35 кг, по меньшей мере приблизительно на 100 фунтов или 50 кг, по меньшей мере приблизительно на 125 фунтов или 55 кг, по меньшей мере приблизительно на 150 фунтов или 75 кг, по меньшей мере приблизительно на 175 фунтов или 80 кг или по меньшей мере приблизительно на 200 фунтов или 100 кг. В других вариантах осуществления практическое осуществление любого из описанных в настоящей заявке способов приводит к снижению массы, где приблизительно менее чем 40%, приблизительно менее чем 20%, приблизительно менее чем 10%, приблизительно менее чем 5%, приблизительно менее чем 2%, приблизительно менее чем 1% или 0% потери массы происходит вследствие потери средней массы тела.

В других вариантах осуществления количество HbA1c снижают по меньшей мере на 0,5%, по меньшей мере на 1,0%, по меньшей мере на 1,5%, по меньшей мере на 2,0%, по меньшей мере на 2,5% или по меньшей мере на 3,0%. В других вариантах осуществления количество HbA1c снижают менее чем на 7,5%, менее чем на 7,0%, менее чем на 6,5%, менее чем на 6,0%, менее чем на 5,5%, менее чем на 5,0%, менее чем на 4,5% или менее чем на 4,0%. В другом варианте осуществления средние уровни глюкозы после приема пищи не превышают 175 мг/дл, 170 мг/дл, 165 мг/дл, 160 мг/дл, 155 мг/дл или 150 мг/дл. В другом варианте осуществления общая средняя суточная концентрация глюкозы в крови составляет менее чем 175 мг/дл, менее чем 165 мг/дл, менее чем 160 мг/дл, менее чем 155 мг/дл, менее чем 150 мг/дл, менее чем 145 мг/дл, менее чем 140 мг/дл, менее чем 135 мг/дл, менее чем 130 мг/дл, менее чем 125 мг/дл, менее чем 120 мг/дл, менее чем 110 мг/дл или менее чем 100 мг/дл. В еще одном варианте осуществления уровни глюкозы натощак снижают до менее чем 200 мг/дл, менее чем 190 мг/дл, менее чем 180 мг/дл, менее чем 170 мг/дл, менее чем 160 мг/дл, менее чем 150 мг/дл, менее чем 140 мг/дл, менее чем 130 мг/дл, менее чем 120 мг/дл, менее чем 110 мг/дл, менее чем 100 мг/дл, менее чем 90 мг/дл или менее чем 80 мг/дл.

В дополнительных вариантах осуществления эксендин, аналог эксендина или аналог агониста эксендина представляет собой один или несколько из эксендина-3, эксендина-4 или аналога агониста эксендина. В некоторых вариантах осуществления эксендин, аналог эксендина или аналог агониста эксендина не является эксендином-3 или эксендином-4. В других вариантах осуществления аналоги агониста эксендина представляют собой агонисты, описанные посредством какой-либо из SEQ ID №3-22. В других вариантах осуществления индивид обладает избыточной массой или страдает ожирением. В некоторых вариантах осуществления описанные в настоящей заявке способы дополнительно включают в себя совместное введение эксендина, аналога эксендина или аналога агониста эксендина вместе с одним или несколькими средствами против диабета для перорального применения. Такие средства включают в себя, но ими не ограничиваются, метформин, сульфонилмочевину (SU), тиазолидиндион (TZD) или любое их сочетание.

В дополнительных вариантах осуществления индивид, которому необходимо снизить массу тела, имеет индекс массы тела (BMI), превышающий или приблизительно равный 25, тогда как в других вариантах осуществления индивид имеет BMI, превышающий или приблизительно равный 30. В других вариантах осуществления индивид, которому необходимо или который желает снизить массу тела, страдает диабетом, резистентностью к инсулину или нарушенной толерантностью к глюкозе, тогда как в других вариантах осуществления индивид не страдает диабетом, резистентностью к инсулину или нарушенной толерантностью к глюкозе. В любом из описанных в настоящей заявке вариантов осуществления индивид может представлять собой человека или животное, например млекопитающее, в частности домашнее животное. В других вариантах осуществления домашнее животное является животным-компаньоном, таким как собака, кошка и т.д., тогда как в других вариантах осуществления домашнее животное представляет собой домашний скот, такой как овцы, крупный рогатый скот, свиньи, лошади, буйволы, домашняя птица и т.д.

Один из конкретных вариантов осуществления относится к способу снижения массы тела, включающему в себя введение индивиду, которому необходимо или который желает снизить массу, еженедельных подкожных инъекций препарата с длительным действием или замедленным высвобождением, содержащего по меньшей мере одно соединение, которое выбирают из группы, состоящей из эксендина, агониста эксендина и аналога агониста эксендина, в количестве, достаточном для поддержания средней концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В другом варианте осуществления средняя концентрация в плазме составляет приблизительно от 25 пг/мл до приблизительно 600 пг/мл, приблизительно от 100 пг/мл до приблизительно 600 пг/мл, приблизительно от 170 пг/мл до приблизительно 600 пг/мл, приблизительно от 200 пг/мл до приблизительно 600 пг/мл, а также приблизительно от 225 пг/мл до приблизительно 600 пг/мл. В дополнительных вариантах осуществления средняя концентрация по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет по меньшей мере приблизительно 25 пг/мл, приблизительно 65 пг/мл, приблизительно 75 пг/мл, приблизительно 85 пг/мл, приблизительно 100 пг/мл, приблизительно 150 пг/мл, приблизительно 170 пг/мл, приблизительно 175 пг/мл, приблизительно 200 пг/мл, приблизительно 225 пг/мл, приблизительно 250 пг/мл, приблизительно 300 пг/мл, приблизительно 350 пг/мл, приблизительно 400 пг/мл, приблизительно 450 пг/мл, приблизительно 500 пг/мл, приблизительно 550 пг/мл или приблизительно 600 пг/мл. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

Другой конкретный вариант осуществления относится к способу снижения массы тела, включающему в себя введение индивиду, которому необходимо или который желает снизить массу, еженедельных подкожных инъекций препарата с длительным действием или замедленным высвобождением, содержащего по меньшей мере одно соединение, которое выбирают из группы, состоящей из эксендина, агониста эксендина и аналога агониста эксендина, в количестве, достаточном для поддержания минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере 50 пг/мл в течение по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В другом варианте осуществления минимальная концентрация в плазме составляет приблизительно от 25 пг/мл до приблизительно 600 пг/мл, приблизительно от 100 пг/мл до приблизительно 600 пг/мл, приблизительно от 170 пг/мл до приблизительно 600 пг/мл, приблизительно от 200 пг/мл до приблизительно 600 пг/мл, а также приблизительно от 225 пг/мл до приблизительно 600 пг/мл. В дополнительных вариантах осуществления минимальная концентрация по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет по меньшей мере приблизительно 25 пг/мл, приблизительно 65 пг/мл, приблизительно 75 пг/мл, приблизительно 85 пг/мл, приблизительно 100 пг/мл, приблизительно 150 пг/мл, приблизительно 170 пг/мл, приблизительно 175 пг/мл, приблизительно 200 пг/мл, приблизительно 225 пг/мл, приблизительно 250 пг/мл, приблизительно 300 пг/мл, приблизительно 350 пг/мл, приблизительно 400 пг/мл, приблизительно 450 пг/мл, приблизительно 500 пг/мл, приблизительно 550 пг/мл или приблизительно 600 пг/мл. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В других вариантах осуществления индивид страдает диабетом или нарушенной толерантностью к глюкозе.

Кроме того, настоящая заявка относится к использованию препарата, содержащего по меньшей мере один эксендин, агонист эксендина или аналог агониста эксендина в количестве, достаточном для опосредования эффектов или лечения заболеваний или нарушений, которые описаны в настоящей заявке. Также представлено использование по меньшей мере одного эксендина, агониста эксендина или аналога агониста эксендина для получения лекарственного средства для опосредования эффектов или лечения заболеваний или нарушений, которые описаны в настоящей заявке.

КРАТКОЕ ОПИСАНИЕ РИСУНКОВ

Фигура 1. Концентрации эксенатида в плазме (среднее значение + SD) с течением времени у индивидов, которые получают эксенатид LAR (N = 31). Следует отметить, что последнюю инъекцию проводили в неделю 14. У четырех пациентов измеренные концентрации эксенатида были намного ниже, чем средние, что, возможно, обусловлено помехами в анализе. = 0,8 мг эксенатида LAR, N=16, ● = 2,0 мг эксенатида LAR, N=15.

Фигура 2. Характеристики гликемии. (A) Концентрации глюкозы в плазме натощак относительно исходного уровня с течением времени (ITT, N = 45; среднее значение +- SE). ○ = плацебо LAR, N=14, исходный уровень 184 мг/дл, = 0,8 мг эксенатида LAR, N=16, исходный уровень 186 мг/дл, ● = 2,0 мг эксенатида LAR, N=15, исходный уровень 167 мг/дл. (B) Измеряемые самим индивидом профили концентрации глюкозы в крови на исходном уровне и в неделю 15 (поддается оценке, N=43; среднее значение ± SE). Уровень глюкозы перед приемом пищи измеряли в течение 15 минут до каждого приема пищи, уровень глюкозы после приема пищи - через 1,5-2 часа после каждого приема пищи, а также проводили дополнительно измерение уровня глюкозы в 0300 часа. Как для исходного уровня, так и для недели 15 измерения регистрировали на трое отдельных суток. ○ = плацебо LAR, N=12, = 0,8 мг эксенатида LAR, N=16, ● = 2,0 мг эксенатида LAR, N=15. (C) Уровень гликозилированного гемоглобина (%) с течением времени (ITT, N=45; среднее значение ± SE). ○ = плацебо LAR, N=14, исходный уровень 8,6%, = 0,8 мг эксенатида LAR, N=16, исходный уровень 8,6%, ● = 2,0 мг эксенатида LAR, N=15, исходный уровень 8,3%. (D) Доля поддающихся оценке индивидов с измерением уровня гликозилированного гемоглобина в неделю 15, которые имели исходный уровень гликозилированного гемоглобина >7% (N=41), достигая в неделю 15 уровня гликозилированного гемоглобина <7%. * указывает статистически значимые результаты (в сравнении с плацебо).

Фигура 3. Изменение массы тела относительно исходного уровня с течением времени (ITT, N=45; среднее значение ± SE). * указывает статистически значимые результаты (в сравнении с плацебо). ○ = плацебо LAR, N=14, исходный уровень 101,2 кг, ■ = 0,8 мг эксенатида LAR, N=16, исходный уровень 106,6 кг, ● = 2,0 мг эксенатида LAR, N=15, исходный уровень 109,7 кг.

ПОДРОБНОЕ ОПИСАНИЕ

Следующее ниже подробное описание предоставлено для способствования специалистам в данной области в осуществлении настоящего изобретения на практике. Тем не менее, это подробное описание не предназначено чрезмерным образом ограничивать настоящее изобретение, поскольку специалисты в данной области могут осуществлять модификации и изменения описанных в настоящей заявке вариантов осуществления без утраты объема настоящего изобретения.

Все цитируемые в этой заявке публикации, патенты, патентные заявки и другие ссылки включены сюда в полном объеме в качестве ссылки, как если бы каждая отдельная публикация, патент, патентная заявка или другая ссылка была конкретно и отдельно указана для включения в качестве ссылки.

Настоящее описание относится к композициям, лекарственным средствам и способам снижения массы тела, поддержания массы тела, снижения прибавления массы тела, изменения состава тканей организма, лечения диабета, снижения уровня глюкозы натощак, снижения уровня HbA1c, снижения среднего суточного уровня глюкозы в крови или снижения уровня глюкозы после приема пищи у индивида при необходимости или желании этого посредством длительного введения эксендина, агониста эксендина или аналога агониста эксендина. Способы включают в себя постоянное или продолжительное введение индивиду эффективного количества эксендина, агониста эксендина или аналога агониста эксендина для достижения желаемых результатов, как описано в настоящей заявке.

Вводимый эксендин, агонист эксендина или аналог агониста эксендина может находиться в виде пептида, пролекарства или в виде их фармацевтической соли или солей. Термин "пролекарство" относится к соединению, представляющему собой предшественник лекарственного средства, который после введения высвобождает лекарственное средство in vivo в результате определенного химического или физиологического процесса, например протеолитического расщепления, или после достижения определенной величины pH окружающей среды.

Описанные способы можно использовать для любого индивида, для которого необходимы такие способы, или для индивидов, для которых желательно осуществление способов на практике. Эти индивиды могут представлять собой любое млекопитающее, включающее в себя, но ими не ограничивающееся, людей, собак, лошадей, коров, свиней и других коммерчески ценных животных или животных-компаньонов.

В одном из вариантов осуществления настоящая заявка относится к способам снижения массы у индивида, который желает или которому необходимо это, где способ включает в себя введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, эффективном для обуславливания снижения массы индивида.

В другом варианте осуществления способ включает в себя постоянное или продолжительное введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, эффективном для обуславливания снижения массы индивида. В еще одном варианте осуществления снижение массы обусловлено уменьшением жира или жировой ткани организма в отсутствие снижения сухой массы тела или мышечной массы. В другом варианте осуществления снижение массы тела вследствие потери жировой ткани организма превышает снижение массы вследствие потери сухой массы тела или мышечной массы. В одном из вариантов осуществления уменьшение жировой ткани организма в сравнении с сухой тканью или мускулатурой основано на принципе абсолютной массы, тогда как в другом варианте осуществления это основано на принципе процента потери массы. В одном из вариантов осуществления потеря висцеральной жировой ткани превышает потерю невисцеральной жировой ткани. В другом варианте осуществления потеря невисцеральной жировой ткани превышает потерю висцеральной жировой ткани. В еще одном варианте осуществления заявка относится к способам изменения состава тканей организма, например уменьшению соотношения жировой и не содержащей жира тканей, снижению процента жировой ткани организма или увеличению процента не содержащей жира ткани у индивида.

В рамках настоящей заявки "снижение массы" относится к снижению массы тела индивида. В одном из вариантов осуществления снижение массы тела происходит в результате предпочтительного уменьшения жировой ткани организма индивида. В одном из вариантов осуществления потеря висцеральной жировой ткани превышает потерю невисцеральной жировой ткани. В другом варианте осуществления потеря невисцеральной жировой ткани превышает потерю висцеральной жировой ткани. Хотя изобретение не зависит от какого-либо конкретного снижения массы индивида, описанные в настоящей заявке способы при различных вариантах осуществления приводят к снижению массы индивида по меньшей мере приблизительно на 1%, по меньшей мере приблизительно на 2%, по меньшей мере приблизительно на 3%, по меньшей мере приблизительно на 4%, по меньшей мере приблизительно на 5%, по меньшей мере приблизительно на 10%, по меньшей мере приблизительно на 15, по меньшей мере приблизительно на 20%, по меньшей мере приблизительно на 30%, по меньшей мере приблизительно на 40%, по меньшей мере приблизительно на 50%, по меньшей мере приблизительно на 60%, или по меньшей мере приблизительно на 70% в сравнении с массой тела индивида до использования описанных в настоящей заявке способов. В различных вариантах осуществления снижение массы происходит в течение периода, составляющего приблизительно 1 неделю, приблизительно 2 недели, приблизительно 3 недели, приблизительно 1 месяц, приблизительно 2 месяца, приблизительно 3 месяца, приблизительно 4 месяца, приблизительно 5 месяцев, приблизительно 6 месяцев, приблизительно 7 месяцев, приблизительно 8 месяцев, приблизительно 9 месяцев, приблизительно 10 месяцев, приблизительно 11 месяцев, приблизительно 1 год или более. В других вариантах осуществления индивид может терять приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 15, приблизительно 20, приблизительно 25, приблизительно 30, приблизительно 35, приблизительно 40, приблизительно 45, приблизительно 50, приблизительно 100, приблизительно 125, приблизительно 150, приблизительно 175, приблизительно 200 фунтов или более. Снижение массы можно измерять с использованием воспроизводимых способов измерения. В одном из вариантов осуществления снижение массы можно измерять вычислением индекса массы тела индивида и сравнением этого BMI индивида в течение определенного периода времени. Индекс массы тела можно вычислять с использованием любого доступного способа, например с использованием номограммы или сходного устройства.

В некоторых вариантах осуществления эксендин, агонист эксендина или аналоги агониста эксендина вводят на основе постоянного введения. В рамках настоящей заявки "постоянное введение" относится к введению средства(в) непрерывным способом в отличие от способа срочного введения, что таким образом поддерживает концентрацию в плазме, необходимую для достижения желаемого терапевтического эффекта (активности) в течение продолжительного периода времени. В одном из аспектов "постоянное введение" относится к введению эксендина или агониста эксендина непрерывным способом так, чтобы поддерживать концентрацию в плазме на уровне или выше уровня терапевтически эффективного или желаемого количества. В одном из вариантов осуществления такое постоянное введение поддерживает среднюю концентрацию эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 50 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 85 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 300 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл в течение продолжительного периода времени. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, снижению уровня глюкозы, изменению состава тканей организма и т.д., который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

В другом варианте осуществления такое постоянное введение поддерживает минимальную концентрацию эксендина, агониста эксендина или аналога агониста эксендина в плазме на уровне, равном или превышающем приблизительно 25 пг/мл, равном или превышающем приблизительно 50 пг/мл, равном или превышающем приблизительно 65 пг/мл, равном или превышающем приблизительно 75 пг/мл, равном или превышающем приблизительно 85 пг/мл, равном или превышающем приблизительно 100 пг/мл, равном или превышающем приблизительно 150 пг/мл, равном или превышающем приблизительно 170 пг/мл, равном или превышающем приблизительно 175 пг/мл, равном или превышающем приблизительно 200 пг/мл, равном или превышающем приблизительно 225 пг/мл, равном или превышающем приблизительно 250 пг/мл, равном или превышающем приблизительно 300 пг/мл, равном или превышающем приблизительно 350 пг/мл, равном или превышающем приблизительно 400 пг/мл, равном или превышающем приблизительно 450 пг/мл, равном или превышающем приблизительно 500 пг/мл, равном или превышающем приблизительно 550 пг/мл или равном или превышающем приблизительно 600 пг/мл в течение продолжительного периода времени. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, снижению уровня глюкозы, изменению состава тканей организма и т.д., который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

В еще одном варианте осуществления постоянное введение поддерживает среднюю или минимальную концентрацию эксендина, агониста эксендина или аналога агониста эксендина в плазме в течение периода, составляющего по меньшей мере приблизительно 12 часов или по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6 или по меньшей мере приблизительно 7 суток. В другом варианте осуществления постоянное введение поддерживает концентрацию эксендина, агониста эксендина или аналога агониста эксендина в плазме в течение по меньшей мере 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3 или по меньшей мере приблизительно 4 недель или по меньшей мере приблизительно 1, по меньшей мере приблизительно 2 или по меньшей мере приблизительно 3 месяцев. В других вариантах осуществления эксендин, агонист эксендина или аналог агониста эксендина вводят непрерывным способом. В рамках настоящей заявки "непрерывный способ" относится к введению эксендина, агониста эксендина или аналога агониста эксендина в организм, например в кровообращение, а не к средствам для введения. Таким образом, постоянное введение непрерывным способом можно осуществлять в результате непрерывной инфузии, внутривенной или подкожной; с использованием помпы или системы дозирования, имплантируемой или внешней, для непрерывной или периодической доставки; или с использованием препарата с продолжительным высвобождением, замедленным высвобождением, длительным высвобождением или продолжительным действием, который вводят, например, один раз в сутки, дважды в неделю, раз в неделю, дважды в месяц, раз в месяц, раз в два месяца или раз в три месяца. Следует понимать, что достижение среднего или минимального уровня в плазме сразу после введения препарата не является необходимым, и для достижения может требоваться период, величиной приблизительно от часов до суток и до недель. После достижения среднюю или минимальную концентрацию в плазме поддерживают затем в течение желаемого периода времени для достижения ее терапевтического эффекта.

В рамках настоящей заявки в контексте снижения массы или изменения состава тканей организма "индивид, которому необходимо это" представляет собой индивида, обладающего избыточной массой или страдающего ожирением. В рамках настоящей заявки в контексте снижения массы или изменения состава тканей организма "желающий" индивид представляет собой индивида, желающего снизить свою массу тела или изменить состав тканей своего организма, например, посредством уменьшения соотношения своей жировой ткани и ткани, не содержащей жира. В одном из вариантов осуществления индивид представляет собой индивида, страдающего ожирением или обладающего избыточной массой. В примерах вариантов осуществления "индивид с избыточной массой" относится к индивиду с индексом массы тела (BMI), превышающим 25, или с BMI от 25 до 30. Однако следует понимать, что определение избыточной массы не ограничивается индивидами с BMI, превышающим 25, но и также относится к любому индивиду, для которого желательна или показана потеря массы по медицинским или косметическим основаниям. Хотя "ожирение" обычно определяют как значение индекса массы тела, превышающее 30, в целях этого описания в объем термина "ожирение" включают в себя любого индивида, которому необходимо или который желает уменьшить массу тела. В одном из вариантов осуществления этот способ может оказать благоприятное воздействие на индивидов с резистентностью к инсулину, отсутствием толерантности к глюкозе или любым типом сахарного диабета (например, типом 1, 2 или диабетом, обусловленным беременностью). В другом варианте осуществления пациент при необходимости этого страдает ожирением. Однако следует отметить, что описанный в настоящей заявке способ можно использовать для индивидов, которые не обладают и/или у которых не диагностировали нарушенную толерантность к глюкозе, резистентность к инсулину или сахарный диабет.

В рамках настоящей заявки в контексте лечения диабета, снижения уровня HbA1c, контроля уровня глюкозы в крови после приема пищи, снижения уровня глюкозы натощак и снижения общей суточной концентрации глюкозы в крови индивид при необходимости этого может включать в себя индивидов с диабетом, нарушенной толерантностью к глюкозе, резистентностью к инсулину или индивидов, неспособных к саморегуляции уровня глюкозы в крови.

HbA1c или A1c, или гликированный гемоглобин, или гликогемоглобин, как обычно используют в данной области, относится к гликозилированному гемоглобину.

Один из вариантов осуществления относится к способам снижения массы тела, снижения соотношения жировой ткани и ткани, не содержащей жира, или снижения BMI, где способ включает в себя постоянное введение определенного количества эксендина, агониста эксендина или аналога агониста эксендина индивиду, которому необходимо это. В одном из вариантов осуществления потеря массы, обусловленная потерей жира или жировой ткани, превышает потерю массы, обусловленную не содержащей жира тканью. В другом варианте осуществления процент снижения массы вследствие потери сухой массы тела составляет приблизительно менее чем 40%, приблизительно менее чем 30%, приблизительно менее чем 20%, приблизительно менее чем 10%, приблизительно менее чем 5%, приблизительно менее чем 2%, приблизительно менее чем 1% или 0% от общего снижения массы. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина вводят в препарате с продолжительным высвобождением, замедленным высвобождением, длительным высвобождением или продолжительным действием. В одном из вариантов осуществления эксендин или агонист эксендина вводят в препарате на основе полимера с длительным высвобождением. Такие препараты на основе полимера с длительным высвобождением описаны, например, в патентной заявке США с серийным номером №09/942631, зарегистрированной 31 августа 2001 года (в настоящее время патент США №6824822), и связанной заявке с серийным номером №11/312371, зарегистрированной 21 декабря 2005 года; условной заявке США №60/419388, зарегистрированной 17 октября 2002 года, и связанных патентных заявках США с серийными номерами №10/688786 и 10/688059, зарегистрированными 17 октября 2003 года; условной заявке США №60/757258, зарегистрированной 9 января 2006 года; условной заявке США с серийным номером №60/563245, зарегистрированной 15 апреля 2004 года, и связанной патентной заявке США №11/104877, зарегистрированной 13 апреля 2005 года; а также патентной заявке США с серийным номером №11/107550, зарегистрированной 15 апреля 2005 года, которые приведены здесь полностью в качестве ссылки.

Эксендин, агонист эксендина или аналог агониста эксендина можно вводить любым доступным способом. В одном из вариантов осуществления эксендин или агонист эксендина вводят подкожно.

Также представлены способы снижения массы тела, включающие в себя введение эксендина или агониста эксендина в количестве, достаточном для достижения среднего или минимального циркулирующего в плазме крови уровня эксендина, агониста эксендина или аналога агониста эксендина, составляющего по меньшей мере приблизительно 50 пг/мл в течение периода по меньшей мере приблизительно 12 часов, 1 суток, 2 суток, 3 суток, 1 недели, 2 недель, 3 недель, 1 месяца, 3 месяцев или 6 месяцев. В одном из вариантов осуществления способы включают в себя введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, достаточном для достижения средней или минимальной циркулирующей в плазме крови концентрации по меньшей мере приблизительно 50 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл эксендина, агониста эксендина или аналога агониста эксендина. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В одном из вариантов осуществления средних или минимальных циркулирующих в плазме крови концентраций достигают в течение периода приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6 или приблизительно 7 суток. В другом варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 1, приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11, приблизительно 12, приблизительно 13, приблизительно 14, приблизительно 15 или приблизительно 16 недель. В еще одном варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11 или приблизительно 12 месяцев. Вместе с заявляемыми способами можно использовать любой способ определения циркулирующих в крови концентраций эксендина или агониста эксендина.

Также представлены способы снижения лечения диабета, например, типа I, типа II или диабета, обусловленного беременностью, где способы включают в себя введение эксендина или агониста эксендина в количестве, достаточном для достижения среднего или минимального циркулирующего в плазме крови уровня эксендина, агониста эксендина или аналога агониста эксендина, который составляет по меньшей мере приблизительно 50 пг/мл в течение периода по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В одном из вариантов осуществления способы включают в себя введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, достаточном для достижения средней или минимальной циркулирующей в плазме крови концентрации по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 50 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл эксендина, агониста эксендина или аналога агониста эксендина. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению уровня глюкозы натощак, снижению отклонений уровня глюкозы после приема пищи, снижению уровня HbA1c и т.д., где этот эффект эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

Другой вариант осуществления относится к способу снижения циркулирующих уровней глюкозы, в частности уровня глюкозы натощак, в отсутствие индукции потери массы, снижения аппетита, замедления опорожнения желудка, снижения уровней глюкозы после приема пищи или любому их сочетанию посредством введения эксендина, агониста эксендина или аналога агониста эксендина для поддержания среднего или минимального уровня эксендина, агониста эксендина или аналога агониста эксендина в плазме крови приблизительно от 25 пг/мл до приблизительно 100 пг/мл или приблизительно от 50 пг/мл до приблизительно 100 пг/мл. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению уровня глюкозы, особенно уровня глюкозы натощак, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В одном из вариантов осуществления средних или минимальных циркулирующих в плазме крови концентраций достигают в течение периода приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6 или приблизительно 7 суток. В другом варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 1, приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11, приблизительно 12, приблизительно 13, приблизительно 14, приблизительно 15 или приблизительно 16 недель. В еще одном варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11 или приблизительно 12 месяцев. В альтернативных вариантах осуществления введение эксендина, агониста эксендина или аналога агониста эксендина, как описано в настоящей заявке, приводит к снижению уровней глюкозы натощак, уровней глюкозы после приема пищи или и тех, и других. Вместе с заявляемыми способами можно использовать любой способ определения циркулирующих в крови концентраций эксендина или агониста эксендина.

Дополнительные варианты осуществления относятся к способам снижения уровня HbA1c, общей средней суточной концентрации глюкозы в крови, уровня глюкозы в крови натощак и/или уровня глюкозы в крови после приема пищи посредством введения, например, индивиду, которому необходимо снижение уровня HbA1c, среднего суточного уровня глюкозы в крови или уровня глюкозы натощак, эксендина или агониста эксендина в количестве, достаточном для достижения среднего или минимального циркулирующего в плазме крови уровня эксендина, агониста эксендина или аналога агониста эксендина по меньшей мере приблизительно 50 пг/мл в течение периода по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В одном из вариантов осуществления способы включают в себя введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, достаточном для достижения средней или минимальной циркулирующей в плазме крови концентрации по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл эксендина, агониста эксендина или аналога агониста эксендина. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению уровня HbA1c, который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В одном из вариантов осуществления средних или минимальных циркулирующих в плазме крови концентраций достигают в течение периода приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6 или приблизительно 7 суток. В другом варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 1, приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11, приблизительно 12, приблизительно 13, приблизительно 14, приблизительно 15 или приблизительно 16 недель. В еще одном варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11 или приблизительно 12 месяцев. Вместе с заявляемыми способами можно использовать любой способ определения циркулирующих в крови концентраций эксендина или агониста эксендина. В других вариантах осуществления индивиду необходимо или он желает снизить массу тела.

Кроме того, представлен способ уменьшения возрастания концентрации глюкозы в крови после приема пищи в сравнении с концентрацией глюкозы в крови до приема пищи таким образом, что снижается разница между концентрациями глюкозы в крови до и после приема пищи. Это приводит к уменьшению колебаний концентрации глюкозы в крови в течение суток, как определялось, например, посредством самоопределения уровня глюкозы в крови в 7 моментов времени, как описано в настоящей заявке. Этот способ включает в себя введение эксендина или агониста эксендина в количестве, достаточном для достижения среднего или минимального циркулирующего в плазме крови уровня эксендина, агониста эксендина или аналога агониста эксендина, который составляет по меньшей мере приблизительно 50 пг/мл в течение периода по меньшей мере приблизительно 12 часов, по меньшей мере приблизительно 1 суток, по меньшей мере приблизительно 2 суток, по меньшей мере приблизительно 3 суток, по меньшей мере приблизительно 1 недели, по меньшей мере приблизительно 2 недель, по меньшей мере приблизительно 3 недель, по меньшей мере приблизительно 1 месяца, по меньшей мере приблизительно 3 месяцев или по меньшей мере приблизительно 6 месяцев. В одном из вариантов осуществления способы включают в себя введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, достаточном для достижения средней или минимальной циркулирующей в плазме крови концентрации по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл эксендина, агониста эксендина или аналога агониста эксендина. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя или минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению отклонений уровня глюкозы в крови после приема пищи, среднего суточного уровня глюкозы в крови и т.д., где эффект эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В одном из вариантов осуществления средних или минимальных циркулирующих в плазме крови концентраций достигают в течение периода приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6 или приблизительно 7 суток. В другом варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 1, приблизительно 2, приблизительно 3, приблизительно 4, приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11, приблизительно 12, приблизительно 13, приблизительно 14, приблизительно 15 или приблизительно 16 недель. В еще одном варианте осуществления средних или минимальных концентраций в плазме достигают в течение периода приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11 или приблизительно 12 месяцев. Вместе с заявляемыми способами можно использовать любой способ определения циркулирующих в крови концентраций эксендина или агониста эксендина.

В любом из описанных в настоящей заявке вариантов осуществления или способов циркулирующие в плазме концентрации эксендина, агониста эксендина или аналога агониста эксендина можно поддерживать на уровне средней заданной концентрации в плазме или в пределах приблизительно 10%, приблизительно 15%, приблизительно 20%

или приблизительно 25% от средней заданной концентрации в плазме. В других вариантах осуществления циркулирующие в плазме концентрации поддерживают на уровне средней заданной концентрации или на уровне приблизительно 98%, приблизительно 97%, приблизительно 96%, приблизительно 95%, приблизительно 90%, приблизительно 80%, приблизительно 70% или приблизительно 60% от средней заданной концентрации. Концентрации эксендина или агониста эксендина в плазме можно измерять с использованием любого доступного специалисту в данной области способа.

В любом из описанных в настоящей заявке вариантов осуществления или способов введение эксендина, агониста эксендина или аналога агониста эксендина эффективно для поддержания минимального циркулирующего в плазме уровня эксендина, агониста эксендина или аналога агониста эксендина по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12, приблизительно 24 или приблизительно 48 часов. В других вариантах осуществления способы включают в себя введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, достаточном для поддержания минимальной циркулирующей в плазме концентрации по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл эксендина, агониста эксендина или аналога агониста эксендина. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, снижению уровня глюкозы, изменению состава тканей организма и т.д., где эффект эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В определенных вариантах осуществления минимальную концентрацию эксендина, агониста эксендина или аналога агониста эксендина поддерживают в течение периода по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6 или по меньшей мере приблизительно 7 суток. В различных вариантах осуществления минимальные циркулирующие в плазме концентрации поддерживают в течение по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11, по меньшей мере приблизительно 12, по меньшей мере приблизительно 13, по меньшей мере приблизительно 14, по меньшей мере приблизительно 15 или по меньшей мере приблизительно 16 недель. В других вариантах осуществления минимальные циркулирующие в плазме уровни поддерживают в течение по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11 или по меньшей мере приблизительно 12 месяцев. Концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме можно измерять с использованием любого доступного специалисту в данной области способа.

В любом из описанных в настоящей заявке вариантов осуществления или способов введение эксендина, агониста эксендина или аналога агониста эксендина эффективно для поддержания средних концентраций эксендина, агониста эксендина или аналога агониста эксендина в плазме по меньшей мере приблизительно 50 пг/мл в течение по меньшей мере приблизительно 12, по меньшей мере приблизительно 24 или по меньшей мере приблизительно 48 часов. В других вариантах осуществления способы включают в себя введение эксендина, агониста эксендина или аналога агониста эксендина в количестве, достаточном для поддержания средней циркулирующей в плазме концентрации по меньшей мере приблизительно 25 пг/мл, по меньшей мере приблизительно 65 пг/мл, по меньшей мере приблизительно 75 пг/мл, по меньшей мере приблизительно 100 пг/мл, по меньшей мере приблизительно 150 пг/мл, по меньшей мере приблизительно 170 пг/мл, по меньшей мере приблизительно 175 пг/мл, по меньшей мере приблизительно 200 пг/мл, по меньшей мере приблизительно 225 пг/мл, по меньшей мере приблизительно 250 пг/мл, по меньшей мере приблизительно 350 пг/мл, по меньшей мере приблизительно 400 пг/мл, по меньшей мере приблизительно 450 пг/мл, по меньшей мере приблизительно 500 пг/мл, по меньшей мере приблизительно 550 пг/мл или по меньшей мере приблизительно 600 пг/мл эксендина, агониста эксендина или аналога агониста эксендина. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме превышает 40 пмоль/литр, превышает 50 пмоль/литр, превышает 60 пмоль/литр, превышает 70 пмоль/литр, превышает 80 пмоль/литр, превышает 90 пмоль/литр, превышает 100 пмоль/литр, превышает 110 пмоль/литр, превышает 120 пмоль/литр, превышает 130 пмоль/литр, превышает 140 пмоль/литр или превышает 150 пмоль/литр. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, снижению уровня глюкозы, изменению состава тканей организма и т.д., где эффект эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. В определенных вариантах осуществления среднюю концентрацию эксендина, агониста эксендина или аналога агониста эксендина поддерживают в течение периода по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6 или по меньшей мере приблизительно 7 суток. В различных вариантах осуществления средние циркулирующие в плазме концентрации поддерживают в течение по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11, по меньшей мере приблизительно 12, по меньшей мере приблизительно 13, по меньшей мере приблизительно 14, по меньшей мере приблизительно 15 или по меньшей мере приблизительно 16 недель. В других вариантах осуществления средние циркулирующие в плазме уровни поддерживают в течение по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11 или по меньшей мере приблизительно 12 месяцев. Концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме можно измерять с использованием любого доступного специалисту в данной области способа.

Также предусмотрено, что описанные в настоящей заявке способы эффективны для поддержания уровней эксендина, агониста эксендина или аналога эксендина, контролирующих уровень глюкозы в крови натощак при ограниченных эффектах на, в отсутствие выявляемых эффектов на или в отсутствие индукции потери массы, снижения аппетита, уменьшения опорожнения желудка или воздействия на контроль уровня глюкозы после приема пищи. В частности, описанные в настоящей заявке способы эффективны для контроля уровней глюкозы в крови натощак в отсутствие индукции потери массы. Группы пациентов, на которых оказывают благоприятный эффект контролируемые уровни глюкозы в крови натощак, не сопровождающиеся потерей массы, включают в себя, но ими не ограничиваются, пожилых пациентов, пациентов, инфицированных вирусом иммунодефицита человека (HIV), или других пациентов, для которых противопоказана потеря массы. В одном из вариантов осуществления описанные в настоящей заявке способы эффективны для поддержания количества эксендина, агониста эксендина или аналога эксендина на средних или минимальных уровнях, составляющих от 10 пг/мл до 150 пг/мл, от 10 пг/мл до 100 пг/мл, от 50 пг/мл до 100 пг/мл или от 50 пг/мл до 150 пг/мл, для контроля уровня глюкозы в крови натощак в отсутствие индукции потери массы. В одном из вариантов осуществления описанные в настоящей заявке способы эффективны для поддержания количества эксендина, агониста эксендина или аналога эксендина на средних или минимальных уровнях, составляющих от 10 пг/мл до 150 пг/мл, от 10 пг/мл до 100 пг/мл, от 50 пг/мл до 100 пг/мл или от 50 пг/мл до 150 пг/мл, для контроля уровня глюкозы в крови натощак в отсутствие выявляемых эффектов на или в отсутствие индукции потери массы, снижения аппетита, уменьшения опорожнения желудка и/или воздействия на контроль уровня глюкозы после приема пищи. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению уровня глюкозы, в частности уровня глюкозы натощак, где эффект эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4.

В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина вводят непрерывно. В другом варианте осуществления эксендин, агонист эксендина или аналог агониста эксендина вводят в препарате с замедленным высвобождением, продолжительным высвобождением, длительным высвобождением или продолжительным действием. В любом из предшествующих вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина можно вводить раз в сутки, раз в двое суток, три раза в неделю, два раза в неделю, один раз в неделю, два раза в месяц, раз в месяц, раз в два месяца или раз в три месяца. Кроме того, продолжительность общего времени введения эксендина, агониста эксендина или аналога агониста эксендина можно определять по желаемой величине снижения массы. Таким образом, эксендин, агонист эксендина или аналог агониста эксендина можно вводить в соответствии с описанными в настоящей заявке способами в течение периода, достаточного для достижения определенной намеченной массы, BMI или состава тканей организма, после чего введение можно прекращать. Альтернативно, после достижения намеченной массы, BMI или состава тканей организма дозу эксендина, агониста эксендина или аналога агониста эксендина можно снижать до уровня, поддерживающего желаемую намеченную величину. Кроме того, если после достижения намеченной массы индивид снова набирает массу, то количество эксендина, агониста эксендина или аналога агониста эксендина можно увеличивать или можно повторно начать введение, если оно было ранее прекращено.

Так же, как в области контроля гликемии, эксендин, агонист эксендина или аналог агониста эксендина можно вводить в соответствии с описанными в настоящей заявке способами в течение периода, достаточного для достижения намеченного уровня HbA1c, намеченного уровня глюкозы натощак, намеченной общей суточной концентрации глюкозы в крови и т.д., после чего концентрацию эксендина, агониста эксендина или аналога агониста эксендина в плазме можно снижать до поддерживающего уровня или прекращать введение. В случае прекращения введение при необходимости можно возобновлять впоследствии. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина вводят в соответствии с описанными в настоящей заявке способами в течение периода, достаточного для снижения или стабилизации уровней глюкозы натощак, снижения или устранения высоких или превышающих желаемые уровней глюкозы натощак.

В некоторых вариантах осуществления описанные в настоящей заявке способы дополнительно относятся к совместному введению эксендина, аналога эксендина или аналога агониста эксендина вместе с одним или несколькими средствами против диабета для перорального применения. Такие средства включают в себя, но ими не ограничиваются, метформин, сульфонилмочевину (SU), тиазолидиндион (TZD) или любое их сочетание. Примеры средств включают в себя пиоглитазон, росиглитазон, глибенкламид, гликлазид, глимепирид, глипизид, гликвидон, хлорпропамид и толбутамид. Эксендин, агонист эксендина или аналог агониста эксендина можно также вводить совместно с инсулином. Совместное введение можно осуществлять с использованием любых приемлемых способов или схем введения доз.

В одном из вариантов осуществления представлены способы снижения частоты возникновения и/или тяжести эффектов на желудочно-кишечный тракт, связанных с введением эксендина, агониста эксендина или аналога агониста эксендина, где способы включают в себя постоянное введение эксендина, агониста эксендина или аналога агониста эксендина любыми описанными в настоящей заявке способами. В некоторых случаях введение, которое начинают с низких или пониженных доз, можно вызвать толерантность к вводимому эксендину, агонисту эксендина или аналогу агониста эксендина таким образом, что индивиду можно вводить высокие дозы, которые обычно вызывают неприемлемую частоту возникновения и/или тяжесть эффектов на желудочно-кишечный тракт, при ослаблении или отсутствии эффектов на желудочно-кишечный тракт. Таким образом, подразумевают, что постоянное введение может быть начато с введения субоптимальных доз эксендина, агониста эксендина или аналога агониста эксендина с использованием, например, препарата, высвобождающего вводимый эксендин, агонист эксендина или аналог агониста эксендина в течение определенного периода времени, где препарат вводят раз в неделю. В течение периода, составляющего недели, уровни вводимого эксендина, агониста эксендина или аналога агониста эксендина в плазме повышаются и в итоге достигают стабильной концентрации. В некоторых вариантах осуществления этот стабильный уровень составляет концентрацию, которую нельзя выносить вследствие неблагоприятных эффектов на желудочно-кишечный тракт при введении в виде разовой или начальной дозы. Для достижения эффекта стабильного уровня можно использовать любой приемлемый препарат с длительным высвобождением и схему введения.

Соответственно в одном из вариантов осуществления многократные дозы с длительным высвобождением предоставлены таким образом, что каждая последующая доза повышает концентрацию средства или средств у пациента, где у пациента достигается терапевтически эффективная концентрация средства или средств. В еще одном варианте осуществления каждую последующую дозу с длительным высвобождением вводят таким образом, что ее фаза длительного высвобождения перекрывается с фазой длительного высвобождения для предыдущей дозы.

Термин "эксендин" включает в себя природные пептиды эксендина, находящиеся в выделениях слюнных желез ящерицы-ядозуба. Представляющие особый интерес эксендины включают в себя эксендин-3 [SEQ ID №:2], присутствующий в выделениях слюнных желез Heloderma horridum, и эксендин-4 [SEQ ID №:1], пептид из 39 аминокислот, который в природе присутствует в выделениях слюнных желез Heloderma suspectum (Eng, J., et al., J. Biol Chem., 265:20259-62, 1990; Eng., J., et al., J. Biol. Chem., 267:7402-05, 1992). При тестировании эксендина-4 на животных было показано, что его способность снижать уровень глюкозы в крови сохраняется в течение нескольких часов. Эксендин-4, в том виде, в каком он находится в выделениях слюнных желез ящерицы-ядозуба, представляет собой амидированный пептид. Однако следует понимать, что эксендины, агонисты эксендина или аналоги агониста эксендина для использования в описанных в настоящей заявке способах не ограничены амидированными формами, но включают в себя кислую форму или любую другую физиологически активную форму молекулы.

Сначала предполагали, что эксендин-4 является компонентом яда. В настоящее время полагают, что эксендин-4 не обладает токсичностью, и что он, наоборот, продуцируется в слюнных железах ящерицы-ядозуба. Эксендины обладают определенным сходством аминокислотной последовательности с некоторыми членами семейства глюкагоноподобных пептидов при наивысшем совпадении аминокислот, 53%, в случае GLP-1[7-36]NH2 (Goke, et al., J. Biol. Chem., 268:19650-55, 1993).

В рамках настоящей заявки "активность агониста" обозначает обладание биологической активностью эксендина, однако понимают, что активность агониста может быть менее эффективной или более эффективной, чем природного эксендина. Другие агонисты эксендина включают в себя, например, химические соединения, специально сконструированные для активации рецептора или рецепторов, через которые эксендин оказывает свое воздействие на массу тела, состав тканей организма, уровень глюкозы в крови и т.д.

В рамках настоящей заявки термин "аналог агониста эксендина" относится к аналогу эксендина, обладающему активностью агониста.

В рамках настоящей заявки термин "инсулинотропный" относится к способности стимулировать высвобождение инсулина в кровоток.

В рамках настоящей заявки термин "резистентность к инсулину" характеризует недостаточную биологическую реакцию на заданную концентрацию инсулина (т.е. сниженный транспорт глюкозы через клеточную мембрану в ответ на инсулин).

В рамках настоящей заявки термин "фармацевтически приемлемый носитель или адъювант" относится к нетоксичному носителю или адъюванту, которые можно вводить пациенту вместе с соединением согласно изобретению и которые не устраняют его фармакологической активности.

Термины "терапевтически или фармацевтически эффективный" или "терапевтически или фармацевтически эффективное количество или концентрация" относятся к количеству описанного в настоящей заявке соединения, которое необходимо для снижения массы тела, лечения ожирения, изменения состава тканей организма, лечения диабета, лечения нарушенной толерантности к глюкозе, снижения уровня глюкозы натощак, снижения уровней глюкозы после приема пищи, снижения уровня HbA1c или снижения среднего суточного уровня глюкозы в крови у индивида.

Как определено в настоящей заявке и в данной области, агонисты эксендина или аналоги агониста эксендина могут обладать биологической активностью, которая является более высокой или более низкой, чем у контрольного эксендина, такого как эксендин-4. Таким образом, в определенных вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина соотнесена с контрольным эксендином. Т.е. концентрация представляет собой концентрацию контрольного эксендина или концентрацию агониста эксендина или аналога агониста эксендина, необходимую для достижения биологического или терапевтического эффекта, который эквивалентен контрольному эксендину. В определенных вариантах осуществления контрольный эксендин представляет собой эксендин-4. В определенных вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой количество эксендина, агонистов эксендина или аналога эксендина, необходимое для достижения заданного эффекта, такого как потеря массы, изменение состава тканей организма или снижение уровня глюкозы или HbA1c в крови, который достигается с использованием заданной дозы эксендина-4.

Термины "фармацевтически" и "фармацевтически приемлемый" относятся к молекулярным веществам и композициям, не приводящим к побочным, аллергическим или другим неблагоприятным реакциям при введении животному или человеку. В рамках настоящей заявки "фармацевтически приемлемый носитель" включает в себя все без исключения такие растворители, дисперсные среды, покрытия, противобактериальные и противогрибковые средства, изотонические средства или средства, задерживающие всасывание, и т.п. Использование таких сред и средств для фармацевтически активных веществ хорошо известно в данной области. До тех пор, пока какие-либо общепринятые среды или средство не являются несовместимыми с активным ингредиентом, их использование предусмотрено в терапевтических композициях. Также в композиции можно включать дополнительные активные ингредиенты.

В рамках настоящей заявки термин "сахарный диабет типа 2" относится к заболеванию, также известному как инсулиннезависимый сахарный диабет (NIDDM) или сахарный диабет, возникающий во взрослом возрасте (AODM), при котором у пациента наблюдают повышенные концентрации сахара в крови.

В таблице 1 определенные последовательности эксендина сравнены с последовательностью GLP-1.

ТАБЛИЦА 1
a. HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR(NH2)
b. HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS(NH2)
c. DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS(NH2)
d. HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS(NH2)
e. HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
f. HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS
g. HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP(NH2)
h. HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP(NH2)
a = GLP-1(7-36)(NH2) [SEQ ID №:3].
b = эксендин 3(NH2) [SEQ ID №:2].
c = эксендин 4(9-39)(NH2) [SEQ ID №:4].
d = эксендин 4(NH2) [SEQ ID №:1].
e = гелоспектин I [SEQ ID №:5].
f = гелоспектин II [SEQ ID №:6].
g = гелодермин(NH2) [SEQ ID №:7].
h = Q8, Q9 гелодермин(NH2) [SEQ ID №:8].

В рамках этого описания "агонист эксендина" обозначает соединение, достигающее биологической активности контрольного пептида эксендина, предпочтительно обладающее более хорошей эффективностью, чем контрольный пептид эксендина, или эффективностью в пределах пяти порядков величины (плюс или минус) эффективности, сопоставимой с контрольным пептидом эксендина, например 4, 3, 2 или 1 порядка величины, при оценке с использованием известных в данной области измерений, таких как исследования связывания/конкурирования с рецептором. В одном из вариантов осуществления термин относится к соединению, вызывающему биологический эффект, сходный с эффектом контрольного пептида эксендина, например к соединению (1), которое обладает активностью в анализах снижения уровня глюкозы и/или потери массы, сходной с контрольным пептидом эксендина, и к соединению (2), которое, необязательно, специфически связывается в анализе контрольного рецептора или в анализе конкурентного связывания с меченым контрольным пептидом эксендина. Предпочтительно в таких анализах агонисты связываются с аффинностью менее чем 1 мкМ, а более предпочтительно - с аффинностью менее чем 1-5 нМ. Такие агонисты могут содержать полипептид, включающий в себя активный фрагмент контрольного пептида или небольшую химическую молекулу. В одном из вариантов осуществления агонист эксендина представляет собой пептид. В другом варианте осуществления агонисты эксендина не включают в себя GLP-1 и его варианты, аналоги и производные. В другом варианте осуществления контрольный пептид представляет собой эксендин-4.

Зависимость активности от структуры (SAR) эксендина была исследована на предмет структур, которые могут иметь отношение к активности эксендина, на предмет его стабильности в метаболизме и на предмет улучшения его физических характеристик, особенно что относится к стабильности пептида и приемлемости для альтернативных систем доставки, и были изобретены различные соединения пептидных аналогов агониста эксендина. Аналоги агониста эксендина включают в себя аналоги эксендина с активностью агониста, у которых одна или несколько природных аминокислот вставлены, удалены или заменены другой аминокислотой(ами). Примерами аналогов эксендина являются пептидные аналоги эксендина-4. В одном из аспектов способы снижения массы тела, снижения BMI, изменения состава тканей организма, лечения диабета, снижения уровня глюкозы натощак или снижения уровня глюкозы после приема пищи включают в себя постоянное введение аналога эксендина, предпочтительно аналога с активностью агониста, индивиду при необходимости.

Аналоги эксендина включают в себя пептиды, кодируемые полинуклеотидами, которые экспрессируют биологически активные аналоги эксендина с активностью агониста, как определено в настоящей заявке. Например, аналоги эксендина могут представлять собой пептиды, содержащие одну или несколько аминокислотных замен, добавлений или делеций в сравнении с контрольным эксендином, например эксендином-4. В одном из вариантов осуществления количество замен, делеций или добавлений составляет 30 аминокислот или менее, 25 аминокислот или менее, 20 аминокислот или менее, 15 аминокислот или менее, 10 аминокислот или менее, 5 аминокислот или менее или любое целое число от 30 до 1 включительно. В одном из аспектов изобретения замены включают в себя одну или несколько консервативных замен. "Консервативная" замена обозначает замену остатка аминокислоты другим, биологически активным сходным остатком. Примеры консервативных замен включают в себя замену одного гидрофобного остатка, такого как изолейцин, валин, лейцин или метионин, другим или замену одного полярного остатка другим, например замену аргинина лизином, глутаминовой кислоты аспарагиновой кислотой или глутамина аспарагином и т.п. В следующей ниже таблице приведены в качестве иллюстрации, но не ограничения, консервативные аминокислотные замены.

ТАБЛИЦА 2
Исходный остаток Примеры замен
ALA SER, THR
ARG LYS
ASN HIS, SER
ASP GLU, ASN
CYS SER
GLN ASN, HIS
GLU ASP
GLY ALA, SER
HIS ASN, GLN
ILE LEU, VAL, THR
LEU ILE, VAL
LYS ARG, GLN, GLU, THR
MET LEU, ILE, VAL
PHE LEU, TYR
SER THR, ALA, ASN
THR SER, ALA
TRP ARG, SER
TYR PHE
VAL ILE, LEU, ALA
PRO ALA

Кроме того, понимают, что аналоги эксендина включают в себя описанные в настоящей заявке пептиды, которые были химически дериватизированы или изменены, например пептиды с искусственными аминокислотными остатками (например, таурин, β- и γ-аминокислотные остатки и D-аминокислотные остатки), модификации C-концевых функциональных групп, такие как амиды, сложные эфиры, а также модификации C-концевых кетонов и модификации N-концевых функциональных групп, такие как ацилированные амины, основания Шиффа, или образование кольца, что встречается, например, у пироглутаминовой аминокислоты.

Такие дериватизированные пептиды включают в себя эксендины, агонисты эксендина и аналоги агониста эксендина, конъюгированные с одной или несколькими полимерными молекулами, такими как полиэтиленгликоль ("PEG") или цепи жирных кислот различной длины (например, стеарил, пальмитоил, октаноил и т.д.), или получаемые посредством добавления полиаминокислот, таких как полигистидин, полиаргинин, полилизин и полиаланин. Также модификации эксендинов, агонистов эксендина и аналогов агониста эксендина могут включать заместители в виде небольших молекул, таких как алкилы с короткой цепью или ограниченные алкилы (например, разветвленные, циклические, слитые, содержащие адамантил), а также ароматические группы. Как правило, молекулярная масса полимерных молекул находится в диапазоне приблизительно от 500 до приблизительно 20000 дальтон.

Такие конъюгации с полимерами и модификации заместителями в виде небольших молекул можно осуществлять в единственном числе на N- или C-концевом участке или на боковых цепях аминокислотных остатков в пределах последовательностей полипептидов. Альтернативно, в гибридном полипептиде может быть много участков дериватизации. Дополнительные участки дериватизации можно обеспечивать заменой одной или нескольких аминокислот лизином, аспарагиновой кислотой, глутаминовой кислотой или цистеином. См., например, патенты США №5824784 и 5824778. В одном из вариантов осуществления полипептиды можно конъюгировать с одной, двумя или тремя полимерными молекулами.

Полимерные молекулы можно присоединять к амино-, карбоксильной или тиольной группе, а также их можно присоединять посредством N- или С-концевого участка или к боковым цепям лизина, аспарагиновой кислоты, глутаминовой кислоты или цистеина. Альтернативно, полимерные молекулы можно присоединять с использованием диамино- и дикарбоксильных групп. В одном из вариантов осуществления полипептиды конъюгируют с одной, двумя или тремя молекулами PEG посредством эпсилон-аминогруппы на аминокислоте лизин.

Также в настоящее изобретение включены последовательности аналога эксендина, обладающие сходством последовательности более чем на 50%, обладающие сходством последовательности более чем на 60%, обладающие сходством последовательности более чем на 70%, обладающие сходством последовательности более чем на 80%, обладающие сходством последовательности более чем на 90%, обладающие сходством последовательности более чем на 95%, обладающие сходством последовательности более чем на 97% или любым процентом сходства от 50% до 97% в отношении контрольного пептида эксендина, например (1) SEQ ID №№:1 и 2; а также (2) в отношении его усеченных последовательностей, где указанные усеченные последовательности содержат по меньшей мере 10 аминокислот, по меньшей мере 20 аминокислот, по меньшей мере 25 аминокислот, по меньшей мере 30 аминокислот, по меньшей мере 35 аминокислот, по меньшей мере 38 аминокислот или N-1 аминокислот, где N равно числу аминокислот в полноразмерном или контрольном пептиде или белке. В рамках настоящей заявки совпадение последовательностей относится к сравнению, проводимому для двух молекул с использованием общепринятых алгоритмов, которые хорошо известны в данной области. В одном из вариантов осуществления алгоритм для вычисления совпадения последовательностей согласно настоящему изобретению представляет собой алгоритм Смита-Вотермана, где эксендин, например SEQ ID №:1 [т.е. эксендин-4], используют в качестве контрольной последовательности для определения процента совпадения сравниваемого пептида на всем его протяжении. Выбор значений параметров для совпадений, несоответствий, а также вставок или делеций предоставлен на собственное усмотрение, хотя было открыто, что некоторые значения параметров приводят к более биологически правдоподобным результатам, чем другие. В одном из вариантов осуществления набор значений параметров для алгоритма Смита-Вотермана предложен с использованием способа "участков с максимальным сходством", в котором применяют значение 1 для совпадающего остатка и -⅓ для несовпадающего остатка (остатка, который представляет собой один нуклеотид или одну аминокислоту). Waterman, Bull. Math. Biol. 46; 473 (1984). Вставкам и делециям (вставки/делеции), x, приписывают весовые коэффициенты в виде xk = 1 + ⅓k, где k представляет собой число остатков в заданной вставке или делеции. Id.

Новые аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US98/16387, зарегистрированной 6 августа 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №10/181102, по которой испрашивается приоритет по патентной заявке США с серийным номером №60/055404, зарегистрированной 8 августа 1997 года, которые приведены здесь полностью в качестве ссылки.

Другие новые аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US98/24210, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554533, по которой испрашивается приоритет по условной заявке США №60/065442, зарегистрированной 14 ноября 1997 года, которые приведены здесь полностью в качестве ссылки.

Другие новые аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US98/24273, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554531, по которой испрашивается приоритет по условной заявке США №60/066029, зарегистрированной 14 ноября 1997 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US97/14199, зарегистрированной 8 августа 1997 года, которая озаглавлена "Methods for Regulating Gastrointestinal Activity", патентной заявке США №08/908867, которая является частичным продолжением патентной заявки США с серийным номером №08/694954, зарегистрированной 8 августа 1996 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US98/00449, зарегистрированной 7 января 1998 года, которая озаглавлена "Use of Exendins and Agonists Thereof for the Reduction of Food Intake", патентной заявке США №09/003869, по которой испрашивается приоритет по условной заявке США №60/03490, зарегистрированной 7 января 1997 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US01/00719, зарегистрированной 9 января 2001 года, которая озаглавлена "Use of Exendins and Agonists Thereof for Modulation of Triglyceride Levels and Treatment of Dyslipidemia", патентной заявке США №09/756690, по которой испрашивается приоритет по условной заявке США №60/175365, зарегистрированной 10 января 2000 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US00/00902, зарегистрированной 14 января 2000 года, которая озаглавлена "Novel Exendin Agonist Formulations and Methods of Administration Thereof", патентной заявке США №09/889330, по которой испрашивается приоритет по условной заявке США №60/116380, зарегистрированной 14 января 1999 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US03/16699, зарегистрированной 28 мая 2003 года, которая озаглавлена "Novel Exendin Agonist Formulations and Methods of Administration Thereof", патентной заявке США №10/522103, по которой испрашивается приоритет по заявке США №10/157224, зарегистрированной 28 мая 2002 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US00/00942, зарегистрированной 14 января 2000 года, которая озаглавлена "Methods of Glucagon Suppression", патентной заявке США №09/889331, по которой испрашивается приоритет по условной заявке США №60/132017, зарегистрированной 30 апреля 1999 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US00/14231, зарегистрированной 23 мая 2000 года, которая озаглавлена "Use of Exendins and Agonists Thereof for the Treatment of Gestational Diabetes Mellitus", по которой испрашивается приоритет по заявке США №09/323867, зарегистрированной 1 июня 1999 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US99/02554, зарегистрированной 5 февраля 1999 года, которая озаглавлена "Inotropic and Diuretic Effects of Exendin and GLP-1", патентной заявке США №09/622105, по которой испрашивается приоритет по условной заявке США №60/075122, зарегистрированной 13 февраля 1998 года, которые приведены здесь полностью в качестве ссылки.

Другие аналоги эксендина с активностью агониста включают в себя аналоги, описанные в находящейся в общем владении заявке PCT с серийным номером №PCT/US05/04178, зарегистрированной 11 февраля 2005 года, которая озаглавлена "Hybrid Polypeptides with Selectable Properties", патентной заявке США №11/055093, которые приведены здесь полностью в качестве ссылки.

Активность агонистов эксендина и аналога агониста эксендина можно указывать, например, с использованием активности в описанных в настоящей заявке анализах. Эффекты эксендинов или агонистов эксендина на массу тела и состав тканей организма можно выявлять, оценивать или отбирать с использованием способов, описанных в настоящей заявке, или других известных в данной области или эквивалентных способов для определения эффекта на массу тела, BMI, состав тканей организма, уровень глюкозы в крови, уровень HbA1c и т.д.

Некоторые примеры аналогов эксендина с активностью агониста включают в себя: эксендин-4 (1-30) [SEQ ID №:9: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly]; амид эксендина-4 (1-30) [SEQ ID №:10: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly-NH2]; амид эксендина-4 (1-28) [SEQ ID №:11: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn-NH2]; амид 14Leu,25Phe-эксендина-4 [SEQ ID №:12: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Leu Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Phe Leu Lys Asn Gly Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser-NH2]; амид 14Leu,25Phe-эксендина-4 (1-28) [SEQ ID №:13: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Leu Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Phe Leu Lys Asn-NH2]; и амид 14Leu,22Ala,25Phe-эксендина-4 (1-28) [SEQ ID №:14: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Leu Glu Glu Glu Ala Val Arg Leu Ala Ile Glu Phe Leu Lys Asn-NH2].

Также в объем настоящего изобретения включены фармацевтически приемлемые соли соединений формул I-VIII и фармацевтические композиции, которые содержат указанные соединения и их соли.

ФОРМУЛА I

Также аналоги эксендина с активностью агониста включают в себя аналоги, которые описаны в условной заявке США №60/065442, являющейся в настоящее время патентной заявкой США №09/554533, включая соединения формулы (I) [SEQ ID №:15]:

Xaa1 Xaa2 Xaa3 Gly Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19 Xaa20

Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1;

где

Xaa1 представляет собой His, Arg или Tyr;

Xaa2 представляет собой Ser, Gly, Ala или Thr;

Xaa3 представляет собой Ala, Asp или Glu;

Xaa5 представляет собой Ala или Thr;

Xaa6 представляет собой Ala, Phe, Tyr или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ala, Ser или Thr;

Xaa9 представляет собой Asp или Glu;

Xaa10 представляет собой Ala, Leu, Ile, Val, пентилглицин или Met;

Xaa11 представляет собой Ala или Ser;

Xaa12 представляет собой Ala или Lys;

Xaa13 представляет собой Ala или Gln;

Xaa14 представляет собой Ala, Leu, Ile, пентилглицин, Val или Met;

Xaa15 представляет собой Ala или Glu;

Xaa16 представляет собой Ala или Glu;

Xaa17 представляет собой Ala или Glu;

Xaa19 представляет собой Ala или Val;

Xaa20 представляет собой Ala или Arg;

Xaa21 представляет собой Ala или Leu;

Xaa22 представляет собой Ala, Phe, Tyr или нафтилаланин;

Xaa23 представляет собой Ile, Val, Leu, пентилглицин, трет-бутилглицин или Met;

Xaa24 представляет собой Ala, Glu или Asp;

Xaa25 представляет собой Ala, Trp, Phe, Tyr или нафтилаланин;

Xaa26 представляет собой Ala или Leu;

Xaa27 представляет собой Ala или Lys;

Xaa28 представляет собой Ala или Asn;

Z1 представляет собой -OH,

-NH2

Gly-Z2,

Gly Gly-Z2,

Gly Gly Xaa31-Z2,

Gly Gly Xaa31 Ser-Z2,

Gly Gly Xaa31 Ser Ser-Z2,

Gly Gly Xaa31 Ser Ser Gly-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2 или

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, 3Hyp, 4Hyp, тиопролин, N-алкилглицин, N-алкилпентилглицин или N-алкилаланин; и

Z2 представляет собой -OH или -NH2;

при условии, что не более чем три из Xaa3, Xaa5, Xaa6, Xaa8, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26, Xaa27 и Xaa28 представляют собой Ala.

Примеры N-алкильных групп для N-алкилглицина, N-алкилпентилглицина и N-алкилаланина включают в себя низшие алкильные группы, например, содержащие от 1 до приблизительно 6 атомов углерода или от 1 до 4 атомов углерода.

Примеры аналогов эксендина включают в себя аналоги, у которых Xaa1 представляет собой His или Tyr. Более предпочтительно, Xaa1 представляет собой His.

Предоставлены такие соединения, где Xaa2 представляет собой Gly.

Предоставлены такие соединения, где Xaa14 представляет собой Leu, пентилглицин или Met.

Примеры соединений представляют собой соединения, где Xaa25 представляет собой Trp или Phe.

Примеры соединений представляют собой соединения, где Xaa6 представляет собой Phe или нафтилаланин; Xaa22 представляет собой Phe или нафтилаланин, а Xaa23 представляет собой Ile или Val.

Предоставлены соединения, где Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина и N-алкилаланина.

Предпочтительно Z1 представляет собой -NH2.

Предпочтительно Z2 представляет собой -NH2.

Согласно одному из вариантов осуществления предоставлены соединения формулы (I), где Xaa1 представляет собой His или Tyr, более предпочтительно His; Xaa2 представляет собой Gly; Xaa6 представляет собой Phe или нафтилаланин; Xaa14 представляет собой Leu, пентилглицин или Met; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile или Val; Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина или N-алкилаланина. Более предпочтительно Z1 представляет собой -NH2.

Согласно одному из вариантов осуществления примеры соединений включают в себя соединения формулы (I), где: Xaa1 представляет собой His или Arg; Xaa2 представляет собой Gly или Ala; Xaa3 представляет собой Asp или Glu; Xaa5 представляет собой Ala или Thr; Xaa6 представляет собой Ala, Phe или нафтилаланин; Xaa7 представляет собой Thr или Ser; Xaa8 представляет собой Ala, Ser или Thr; Xaa9 представляет собой Asp или Glu; Xaa10 представляет собой Ala, Leu или пентилглицин; Xaa11 представляет собой Ala или Ser; Xaa12 представляет собой Ala или Lys; Xaa13 представляет собой Ala или Gln; Xaa14 представляет собой Ala, Leu или пентилглицин; Xaa15 представляет собой Ala или Glu; Xaa16 представляет собой Ala или Glu; Xaa17 представляет собой Ala или Glu; Xaa19 представляет собой Ala или Val; Xaa20 представляет собой Ala или Arg; Xaa21 представляет собой Ala или Leu; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile, Val или трет-бутилглицин; Xaa24 представляет собой Ala, Glu или Asp; Xaa25 представляет собой Ala, Trp или Phe; Xaa26 представляет собой Ala или Leu; Xaa27 представляет собой Ala или Lys; Xaa28 представляет собой Ala или Asn; Z1 представляет собой -OH, -NH2, Gly-Z2, Gly Gly-Z2, Gly Gly Xaa31-Z2, Gly Gly Xaa31 Ser-Z2, Gly Gly Xaa31 Ser Ser-Z2, Gly Gly Xaa31 Ser Ser Gly-Z2, Gly Gly Xaa31 Ser Ser Gly Ala-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2; Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, тиопролин или N-метилаланин; а Z2 представляет собой -OH или -NH2; при условии, что не более чем три из Xaa3, Xaa5, Xaa6, Xaa8, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26, Xaa27 и Xaa28 представляют собой Ala. Другие примеры соединений включают в себя соединения, указанные в заявке PCT с серийным номером №PCT/US98/24210, зарегистрированной 13 ноября 1998 года, озаглавленной "Novel Exendin Agonist Compounds", в которой соединения обозначены как соединения 2-23.

Другой вариант осуществления относится к соединениям, где Xaa14 представляет собой Leu, Ile, Val или пентилглицин, более предпочтительно Leu или пентилглицин, а Xaa25 представляет собой Phe, Tyr или нафтилаланин, более предпочтительно Phe или нафтилаланин. Эти соединения менее подвержены окислительному разрушению как in vitro, так и in vivo, а также в ходе синтеза соединения.

ФОРМУЛА II

Также аналоги эксендина с активностью агониста включают в себя аналоги, описанные в условной заявке США №60/066029, которая в настоящее время является патентной заявкой США №09/554531, включая соединения формулы (II) [SEQ ID №:16]:

Xaa1 Xaa2 Xaa3 Xaa4 Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19 Xaa20

Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1;

где:

Xaa1 представляет собой His, Arg, Tyr, Ala, Norval, Val или Norleu;

Xaa2 представляет собой Ser, Gly, Ala или Thr;

Xaa3 представляет собой Ala, Asp или Glu;

Xaa4 представляет собой Ala, Norval, Val, Norleu или Gly;

Xaa5 представляет собой Ala или Thr;

Xaa6 представляет собой Ala, Phe, Tyr или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ala, Ser или Thr;

Xaa9 представляет собой Ala, Norval, Val, Norleu, Asp или Glu;

Xaa10 представляет собой Ala, Leu, Ile, Val, пентилглицин или Met;

Xaa11 представляет собой Ala или Ser;

Xaa12 представляет собой Ala или Lys;

Xaa13 представляет собой Ala или Gln;

Xaa14 представляет собой Ala, Leu, Ile, пентилглицин, Val или Met;

Xaa15 представляет собой Ala или Glu;

Xaa16 представляет собой Ala или Glu;

Xaa17 представляет собой Ala или Glu;

Xaa19 представляет собой Ala или Val;

Xaa20 представляет собой Ala или Arg;

Xaa21 представляет собой Ala или Leu;

Xaa22 представляет собой Phe, Tyr или нафтилаланин;

Xaa23 представляет собой Ile, Val, Leu, пентилглицин, трет-бутилглицин или Met;

Xaa24 представляет собой Ala, Glu или Asp;

Xaa25 представляет собой Ala, Trp, Phe, Tyr или нафтилаланин;

Xaa26 представляет собой Ala или Leu;

Xaa27 представляет собой Ala или Lys;

Xaa28 представляет собой Ala или Asn;

Z1 представляет собой -OH,

-NH2,

Gly-Z2,

Gly Gly-Z2,

Gly Gly Xaa31-Z2,

Gly Gly Xaa31 Ser-Z2,

Gly Gly Xaa31 Ser Ser-Z2,

Gly Gly Xaa31 Ser Ser Gly-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2 или

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38 Xaa39-Z2;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, 3Hyp, 4Hyp, тиопролин, N-алкилглицин, N-алкилпентилглицин или N-алкилаланин;

Xaa39 представляет собой Ser или Tyr; и

Z2 представляет собой -OH или -NH2;

при условии, что не более чем три из Xaa3, Xaa4, Xaa5, Xaa6, Xaa8, Xaa9, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26, Xaa27 и Xaa28 представляют собой Ala; и также при условии, что если Xaa1 представляет собой His, Arg или Tyr, то по меньшей мере один из Xaa3, Xaa4 и Xaa9 является Ala.

Примеры N-алкильных групп для N-алкилглицина, N-алкилпентилглицина и N-алкилаланина включают в себя низшие алкильные группы, например, содержащие от 1 до приблизительно 6 атомов углерода или от 1 до 4 атомов углерода. Приемлемые соединения формулы (II) включают в себя соединения, описанные в заявке с серийным номером №PCT/US98/24273, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554531.

В одном из вариантов осуществления такие аналоги эксендина включают в себя аналоги, в которых Xaa1 представляет собой His, Ala или Norval. Более предпочтительно Xaa1 представляет собой His или Ala. Более предпочтительно Xaa1 представляет собой His.

Предоставлены такие соединения формулы (II), где Xaa2 представляет собой Gly.

Предоставлены такие соединения формулы (II), где Xaa3 представляет собой Ala.

Предоставлены такие соединения формулы (II), где Xaa4 представляет собой Ala.

Предоставлены такие соединения формулы (II), где Xaa9 представляет собой Ala.

Предоставлены такие соединения формулы (II), где Xaa14 представляет собой Leu, пентилглицин или Met.

Примерами соединений формулы (II) являются соединения, где Xaa25 представляет собой Trp или Phe.

Примерами соединений формулы (II) являются соединения, где Xaa6 представляет собой Ala, Phe или нафтилаланин; Xaa22 представляет собой Phe или нафтилаланин; а Xaa23 представляет собой Ile или Val.

Предоставлены соединения формулы (II), где Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина и N-алкилаланина.

Предпочтительно Z1 представляет собой -NH2.

Предпочтительно Z2 представляет собой -NH2.

Один из вариантов осуществления относится к соединениям формулы (II), где Xaa1 представляет собой Ala, His или Tyr, более предпочтительно Ala или His; Xaa2 представляет собой Ala или Gly; Xaa6 представляет собой Phe или нафтилаланин; Xaa14 представляет собой Ala, Leu, пентилглицин или Met; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile или Val; Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина или N-алкилаланина; а Xaa39 представляет собой Ser или Tyr, более предпочтительно Ser. Более предпочтительно Z1 представляет собой -NH2.

Согласно другому варианту осуществления примеры соединений включают в себя соединения формулы (II), где: Xaa1 представляет собой His или Ala; Xaa2 представляет собой Gly или Ala; Xaa3 представляет собой Ala, Asp или Glu; Xaa4 представляет собой Ala или Gly; Xaa5 представляет собой Ala или Thr; Xaa6 представляет собой Phe или нафтилаланин; Xaa7 представляет собой Thr или Ser; Xaa8 представляет собой Ala, Ser или Thr; Xaa9 представляет собой Ala, Asp или Glu; Xaa10 представляет собой Ala, Leu или пентилглицин; Xaa11 представляет собой Ala или Ser; Xaa12 представляет собой Ala или Lys; Xaa13 представляет собой Ala или Gln; Xaa14 представляет собой Ala, Leu, Met или пентилглицин; Xaa15 представляет собой Ala или Glu; Xaa16 представляет собой Ala или Glu; Xaa17 представляет собой Ala или Glu; Xaa19 представляет собой Ala или Val; Xaa20 представляет собой Ala или Arg; Xaa21 представляет собой Ala или Leu; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile, Val или трет-бутилглицин; Xaa24 представляет собой Ala, Glu или Asp; Xaa25 представляет собой Ala, Trp или Phe; Xaa26 представляет собой Ala или Leu; Xaa27 представляет собой Ala или Lys; Xaa28 представляет собой Ala или Asn; Z1 представляет собой -OH, -NH2, Gly-Z2, Gly Gly-Z2, Gly Gly Xaa31-Z2, Gly Gly Xaa31 Ser-Z2, Gly Gly Xaa31 Ser Ser-Z2, Gly Gly Xaa31 Ser Ser Gly-Z2, Gly Gly Xaa31 Ser Ser Gly Ala-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2 или Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38 Xaa39-Z2; Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, тиопролин или N-метилаланин; а Z2 представляет собой -OH или -NH2; при условии, что не более чем три из Xaa3, Xaa5, Xaa6, Xaa8, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26, Xaa27 и Xaa28 представляют собой Ala; и также при условии, что если Xaa1 представляет собой His, Arg или Tyr, то по меньшей мере один из Xaa3, Xaa4 и Xaa9 представляет собой Ala. Примеры соединений формулы (II) включают в себя соединения, описанные в заявке с серийным номером №PCT/US98/24273, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", где соединения имеют аминокислотную последовательность из указанных там SEQ ID №№:5-93, которые приведены здесь полностью в качестве ссылки.

Еще один из вариантов осуществления относится к соединениям формулы (II), где Xaa14 представляет собой Ala, Leu, Ile, Val или пентилглицин, более предпочтительно Leu или пентилглицин, а Xaa25 представляет собой Ala, Phe, Tyr или нафтилаланин, более предпочтительно Phe или нафтилаланин. Эти соединения менее подвержены окислительному разрушению как in vitro, так и in vivo, а также в ходе синтеза соединения.

ФОРМУЛА III

Кроме того, настоящее изобретение включает в себя более ограниченный тип соединений, описанных в заявке PCT с серийным номером №PCT/US98/24210, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554533, и где соединения имеют специфические последовательности аминокислот, например соединения формулы (III) [SEQ ID №:17]:

Xaa1 Xaa2 Xaa3 Gly Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19

Xaa20 Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1;

где:

Xaa1 представляет собой His или Arg;

Xaa2 представляет собой Gly или Ala;

Xaa3 представляет собой Ala, Asp или Glu;

Xaa5 представляет собой Ala или Thr;

Xaa6 представляет собой Ala, Phe или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ala, Ser или Thr;

Xaa9 представляет собой Asp или Glu;

Xaa10 представляет собой Ala, Leu или пентилглицин;

Xaa11 представляет собой Ala или Ser;

Xaa12 представляет собой Ala или Lys;

Xaa13 представляет собой Ala или Gln;

Xaa14 представляет собой Ala, Leu или пентилглицин;

Xaa15 представляет собой Ala или Glu;

Xaa16 представляет собой Ala или Glu;

Xaa17 представляет собой Ala или Glu;

Xaa19 представляет собой Ala или Val;

Xaa20 представляет собой Ala или Arg;

Xaa21 представляет собой Ala или Leu;

Xaa22 представляет собой Phe или нафтилаланин;

Xaa23 представляет собой Ile, Val или трет-бутилглицин;

Xaa24 представляет собой Ala, Glu или Asp;

Xaa25 представляет собой Ala, Trp, или Phe;

Xaa26 представляет собой Ala или Leu;

Xaa27 представляет собой Ala или Lys;

Xaa28 представляет собой Ala или Asn;

Z1 представляет собой -OH,

-NH2,

Gly-Z2,

Gly Gly-Z2,

Gly Gly Xaa31-Z2,

Gly Gly Xaa31 Ser-Z2,

Gly Gly Xaa31 Ser Ser-Z2,

Gly Gly Xaa31 Ser Ser Gly-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2 или

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из группы, состоящей из Pro, гомопролина, тиопролина и N-метилаланина; и

Z2 представляет собой -OH или -NH2;

при условии, что не более чем три из Xaa3, Xaa5, Xaa6, Xaa8, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26, Xaa27 и Xaa28 представляют собой Ala; а также их фармацевтически приемлемые соли.

ФОРМУЛА IV

Кроме того, настоящее изобретение включает в себя более ограниченный тип соединений, описанных в заявке PCT с серийным номером №PCT/US98/24273, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554531, и где соединения имеют специфические последовательности аминокислот, например соединения формулы (IV) [SEQ ID №:18]:

Xaa1 Xaa2 Xaa3 Xaa5 Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19

Xaa20 Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1;

где:

Xaa1 представляет собой His или Ala;

Xaa2 представляет собой Gly или Ala;

Xaa3 представляет собой Ala, Asp или Glu;

Xaa4 представляет собой Ala или Gly;

Xaa5 представляет собой Ala или Thr;

Xaa6 представляет собой Ala, Phe или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ala, Ser или Thr;

Xaa9 представляет собой Ala, Asp или Glu;

Xaa10 представляет собой Ala, Leu или пентилглицин;

Xaa11 представляет собой Ala или Ser;

Xaa12 представляет собой Ala или Lys;

Xaa13 представляет собой Ala или Gln;

Xaa14 представляет собой Ala, Leu, Met или пентилглицин;

Xaa15 представляет собой Ala или Glu;

Xaa16 представляет собой Ala или Glu;

Xaa17 представляет собой Ala или Glu;

Xaa19 представляет собой Ala или Val;

Xaa20 представляет собой Ala или Arg;

Xaa21 представляет собой Ala или Leu;

Xaa22 представляет собой Phe или нафтилаланин;

Xaa23 представляет собой Ile, Val или трет-бутилглицин;

Xaa24 представляет собой Ala, Glu или Asp;

Xaa25 представляет собой Ala, Trp или Phe;

Xaa26 представляет собой Ala или Leu;

Xaa27 представляет собой Ala или Lys;

Xaa28 представляет собой Ala или Asn;

Z1 представляет собой -OH,

-NH2,

Gly-Z2,

Gly Gly-Z2

Gly Gly Xaa31-Z2,

Gly Gly Xaa31 Ser-Z2,

Gly Gly Xaa31 Ser Ser-Z2,

Gly Gly Xaa31 Ser Ser Gly-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38 Ser-Z2;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, тиопролин или N-метилаланин; и

Z2 представляет собой -OH или -NH2;

при условии, что не более чем три из Xaa3, Xaa5, Xaa6, Xaa8, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26, Xaa27 и Xaa28 представляют собой Ala; и при условии что, если Xaa1 представляет собой His, Arg или Tyr, то по меньшей мере один из Xaa3, Xaa4 и Xaa9 представляет собой Ala; а также их фармацевтически приемлемые соли.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa1 представляет собой His или Ala. Предпочтительно Xaa1 представляет собой His.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa2 представляет собой Gly.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa4 представляет собой Ala.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa9 представляет собой Ala.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa14 представляет собой Leu, пентилглицин или Met.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa25 представляет собой Trp или Phe.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa6 представляет собой Ala, Phe или нафтилаланин; Xaa22 представляет собой Phe или нафтилаланин; а Xaa23 представляет собой Ile или Val.

Примеры соединений формулы (IV) включают в себя соединения, где Z1 представляет собой -NH2.

Примеры соединений формулы (IV) включают в себя соединения, где Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из группы, состоящей из Pro, гомопролина, тиопролина и N-алкилаланина.

Примеры соединений формулы (IV) включают в себя соединения, где Z2 представляет собой -NH2.

Примеры соединений формулы (IV) включают в себя соединения, где Z1 представляет собой -NH2.

ФОРМУЛА V

Также предоставлены соединения, описанные в заявке PCT №PCT/US98/24210, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554533, включая соединения формулы (V) [SEQ ID №:19]:

Xaa1 Xaa2 Xaa3 Gly Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19 Xaa20

Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1;

где

Xaa1 представляет собой His, Arg или Tyr или 4-имидазопропионил;

Xaa2 представляет собой Ser, Gly, Ala или Thr;

Xaa3 представляет собой Ala, Asp или Glu;

Xaa5 представляет собой Ala или Thr;

Xaa6 представляет собой Ala, Phe, Tyr или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ala, Ser или Thr;

Xaa9 представляет собой Asp или Glu;

Xaa10 представляет собой Ala, Leu, Ile, Val, пентилглицин или Met;

Xaa11 представляет собой Ala или Ser,

Xaa12 представляет собой Ala или Lys;

Xaa13 представляет собой Ala или Gln;

Xaa14 представляет собой Ala, Leu, Ile, пентилглицин, Val или Met;

Xaa15 представляет собой Ala или Glu;

Xaa16 представляет собой Ala или Glu;

Xaa17 представляет собой Ala или Glu;

Xaa19 представляет собой Ala или Val;

Xaa20 представляет собой Ala или Arg;

Xaa21 представляет собой Ala, Leu или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил или циклоалкилалканоил;

Xaa22 представляет собой Phe, Tyr или нафтилаланин;

Xaa23 представляет собой Ile, Val, Leu, пентилглицин, трет-бутилглицин или Met;

Xaa24 представляет собой Ala, Glu или Asp;

Xaa25 представляет собой Ala, Trp, Phe, Tyr или нафтилаланин;

Xaa26 представляет собой Ala или Leu;

Xaa27 представляет собой Lys, Asn, Ala или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил или циклоалкилалканоил;

X28 представляет собой Lys, Asn, Ala или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил или циклоалкилалканоил;

Z1 представляет собой -OH,

-NH2,

Gly-Z2,

Gly Gly-Z2,

Gly Gly Xaa31-Z2,

Gly Gly Xaa31 Ser-Z2,

Gly Gly Xaa31 Ser Ser-Z2,

Gly Gly Xaa31 Ser Ser Gly-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2 или

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из группы, состоящей из Pro, гомопролина, 3Hyp, 4Hyp, тиопролина, N-алкилглицина, N-алкилпентилглицина и N-алкилаланина; и

Z2 представляет собой -OH или -NH2; при условии, что не более чем три из Xaa3, Xaa5, Xaa6, Xaa8, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25 и Xaa26 представляют собой Ala. Также в объем настоящего изобретения входят фармацевтически приемлемые соли соединения формулы (V) и фармацевтические композиции, содержащие указанные соединения и их соли.

Примеры аналогов эксендина формулы (V) включают в себя аналоги, где Xaa1 представляет собой His, Tyr или 4-имидазопропионил. Более предпочтительно Xaa1 представляет собой His.

Предоставлены такие соединения формулы (V), где Xaa1 представляет собой 4-имидазопропионил.

Предоставлены такие соединения формулы (V), где Xaa2 представляет собой Gly.

Примерами соединений формулы (V) являются соединения, где Xaa14 представляет собой Leu, пентилглицин или Met.

Примерами соединений формулы (V) являются соединения, где Xaa25 представляет собой Trp или Phe.

Один из вариантов осуществления относится к соединениям формулы (V), где Xaa6 представляет собой Phe или нафтилаланин; и Xaa22 представляет собой Phe или нафтилаланин; а Xaa23 представляет собой Ile или Val. Более предпочтительно Z1 представляет собой -NH2. Один из вариантов осуществления относится к соединениям формулы (V), где Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из группы, состоящей из Pro, гомопролина, тиопролина и N-алкилаланина. Предпочтительно Z2 представляет собой -NH2.

Примеры соединений формулы (V) включают в себя соединения, где X27 представляет собой Lys или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил, а Xaa28 представляет собой Asn или Ala. Предпочтительно соединения формулы (V) включают в себя соединения, описанные в заявке PCT с серийным номером №PCT/US98/24210, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554533, и где соединения обозначены как соединения №№62-69.

Предоставлены аналоги эксендина, включающие в себя соединения, в которых Xaa1 представляет собой His.

Предоставлены такие соединения формулы (V), где Xaa2 представляет собой Gly.

Предоставлены такие соединения формулы (V), где Xaa3 представляет собой Ala.

Предоставлены такие соединения формулы (V), где Xaa14 представляет собой Leu, пентилглицин или Met.

Предоставлены такие соединения формулы (V), где Xaa25 представляет собой Trp или Phe.

Примерами соединений формулы (V) являются соединения, где Xaa6 представляет собой Ala, Phe или нафтилаланин; Xaa22 представляет собой Phe или нафтилаланин; а Xaa23 представляет собой Ile или Val.

Предоставлены соединения формулы (V), где Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина и N-алкилаланина.

Предпочтительно Z1 представляет собой -NH2.

Предпочтительно Z2 представляет собой -NH2.

Один из вариантов осуществления относится к соединениям формулы (V), где Xaa1 представляет собой His или Tyr, более предпочтительно His; Xaa2 представляет собой Ala или Gly; Xaa6 представляет собой Phe или нафтилаланин; Xaa14 представляет собой Ala, Leu, пентилглицин или Met; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile или Val; Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина или N-алкилаланина; а Xaa39 представляет собой Ser или Tyr, более предпочтительно Ser. Более предпочтительно Z1 представляет собой -NH2.

Один из вариантов осуществления относится к соединениям, которые включают в себя соединения формулы (V), где: Xaa1 представляет собой His; Xaa2 представляет собой Gly или Ala; Xaa3 представляет собой Ala, Asp или Glu; Xaa4 представляет собой Gly; Xaa5 представляет собой Ala или Thr; Xaa6 представляет собой Phe или нафтилаланин; Xaa7 представляет собой Thr или Ser; Xaa8 представляет собой Ala, Ser или Thr; Xaa9 представляет собой Asp или Glu; Xaa10 представляет собой Ala, Leu или пентилглицин; Xaa11 представляет собой Ala или Ser; Xaa12 представляет собой Ala или Lys; Xaa13 представляет собой Ala или Gln; Xaa14 представляет собой Ala, Leu, Met или пентилглицин; Xaa15 представляет собой Ala или Glu; Xaa16 представляет собой Ala или Glu; Xaa17 представляет собой Ala или Glu; Xaa19 представляет собой Ala или Val; Xaa20 представляет собой Ala или Arg; Xaa21 представляет собой Ala или Leu; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile, Val или трет-бутилглицин; Xaa24 представляет собой Ala, Glu или Asp; Xaa25 представляет собой Ala, Trp или Phe; Xaa26 представляет собой Ala или Leu; Xaa27 представляет собой Ala или Lys; Xaa28 представляет собой Ala или Asn; Z1 представляет собой -OH, -NH2, Gly-Z2, Gly Gly-Z2, Gly Gly Xaa31-Z2, Gly Gly Xaa31 Ser-Z2, Gly Gly Xaa31 Ser Ser-Z2, Gly Gly Xaa31 Ser Ser Gly-Z2, Gly Gly Xaa31 Ser Ser Gly Ala-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2, Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2 или Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38 Xaa39-Z2; Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, тиопролин или N-метилаланин; а Z2 представляет собой -OH или -NH2; при условии, что не более чем три из Xaa3, Xaa5, Xaa6, Xaa8, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26, Xaa27 и Xaa28 представляют собой Ala; а также при условии, что если Xaa1 представляет собой His, Arg или Tyr, то по меньшей мере один из Xaa3 и Xaa4 представляет собой Ala. Конкретные соединения формулы (V) включают в себя соединения, описанные в заявке PCT с серийным номером №PCT/US98/24210, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", где соединения имеют аминокислотные последовательности, обозначенные в ней как SEQ ID №№:5-65 и 67-74, в настоящей заявке SEQ ID №№:23-91.

Один из вариантов осуществления относится к соединениям формулы (V), где Xaa14 представляет собой Ala, Leu, Ile, Val или пентилглицин, более предпочтительно Leu или пентилглицин, а Xaa25 представляет собой Ala, Phe, Tyr или нафтилаланин, более предпочтительно Phe или нафтилаланин. Эти соединения менее подвержены окислительному разрушению как in vitro, так и in vivo, а также в ходе синтеза соединения.

ФОРМУЛА VI

Также предоставлены пептидные соединения, описанные в заявке PCT с серийным номером №PCT/US98/24273, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №09/554531, в том числе соединения формулы (VI) [SEQ ID №:20]:

Xaa1 Xaa2 Xaa3 Xaa4 Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19 Xaa20

Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1;

где

Xaa1 представляет собой His, Arg, Tyr, Ala, Norval, Val, Norleu или 4-имидазопропионил;

Xaa2 представляет собой Ser, Gly, Ala или Thr;

Xaa3 представляет собой Ala, Asp или Glu;

Xaa4 представляет собой Ala, Norval, Val, Norleu или Gly;

Xaa5 представляет собой Ala или Thr;

Xaa6 представляет собой Ala, Phe, Tyr или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ala, Ser или Thr;

Xaa9 представляет собой Ala, Norval, Val, Norleu, Asp или Glu;

Xaa10 представляет собой Ala, Leu, Ile, Val, пентилглицин или Met;

Xaa11 представляет собой Ala или Ser;

Xaa12 представляет собой Ala или Lys;

Xaa13 представляет собой Ala или Gln;

Xaa14 представляет собой Ala, Leu, Ile, пентилглицин, Val или Met;

Xaa15 представляет собой Ala или Glu;

Xaa16 представляет собой Ala или Glu;

Xaa17 представляет собой Ala или Glu;

Xaa19 представляет собой Ala или Val;

Xaa20 представляет собой Ala или Arg;

Xaa21 представляет собой Ala, Leu или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-10 или разветвленный алканоил или циклоалкилалканоил;

Xaa22 представляет собой Phe, Tyr или нафтилаланин;

Xaa23 представляет собой Ile, Val, Leu, пентилглицин, трет-бутилглицин или Met;

Xaa24 представляет собой Ala, Glu или Asp;

Xaa25 представляет собой Ala, Trp, Phe, Tyr или нафтилаланин;

Xaa26 представляет собой Ala или Leu;

Xaa27 представляет собой Lys, Asn, Lys-NHε-R или Ala, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил или циклоалкилалканоил;

Xaa28 представляет собой Lys, Asn, Lys-NHε-R или Ala, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил или циклоалкилалканоил;

Z1 представляет собой -OH,

-NH2,

Gly-Z2,

Gly Gly-Z2,

Gly Gly Xaa31-Z2,

Gly Gly Xaa31 Ser-Z2,

Gly Gly Xaa31 Ser Ser-Z2,

Gly Gly Xaa31 Ser Ser Gly-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36-Z2,

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37-Z2

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38-Z2 или

Gly Gly Xaa31 Ser Ser Gly Ala Xaa36 Xaa37 Xaa38 Xaa39-Z2;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из группы, состоящей из Pro, гомопролина, 3Hyp, 4Hyp, тиопролина, N-алкилглицина, N-алкилпентилглицина и N-алкилаланина;

Xaa39 представляет собой Ser или Tyr;

Z2 представляет собой -OH или -NH2;

при условии, что не более чем три из Xaa3, Xaa4, Xaa5, Xaa6, Xaa8, Xaa9, Xaa10, Xaa11, Xaa12, Xaa13, Xaa14, Xaa15, Xaa16, Xaa17, Xaa19, Xaa20, Xaa21, Xaa24, Xaa25, Xaa26 представляют собой Ala; а также при условии, что если Xaa1 представляет собой His, Arg, Tyr или 4-имидазопропионил, то по меньшей мере один из Xaa3, Xaa4 и Xaa9 представляет собой Ala.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa1 представляет собой His, Ala, Norval или 4-имидазопропионил. Предпочтительно Xaa1 представляет собой His, или 4-имидазопропионил, или Ala, более предпочтительно His или 4-имидазопропионил.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa2 представляет собой Gly.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa4 представляет собой Ala.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa9 представляет собой Ala.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa14 представляет собой Leu, пентилглицин или Met.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa25 представляет собой Trp или Phe.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa6 представляет собой Ala, Phe или нафтилаланин; Xaa22 представляет собой Phe или нафтилаланин; а Xaa23 представляет собой Ile или Val.

Примеры соединений формулы (VI) включают в себя соединения, где Z1 представляет собой -NH2.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из группы, состоящей из Pro, гомопролина, тиопролина и N-алкилаланина.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa39 представляет собой Ser.

Примеры соединений формулы (VI) включают в себя соединения, где Z2 представляет собой -NH2.

Примеры соединений формулы (VI) включают в себя соединения 42, где Z1 представляет собой -NH2.

Примеры соединений формулы (VI) включают в себя соединения, где Xaa21 представляет собой Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил.

Примеры соединений формулы (VI) включают в себя соединения, где X27 представляет собой Lys или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил, а X28 представляет собой Asn или Ala.

Другие соединения формулы (VI) включают в себя соединения, описанные в заявке PCT с серийным номером №PCT/US98/24273, зарегистрированной 13 ноября 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", где соединения имеют аминокислотную последовательность, выбранную из последовательностей, которые обозначены в той заявке как SEQ ID №№:95-110, а в настоящей заявке обозначены как SEQ ID №№:92-107.

ФОРМУЛА VII

Особенно эффективные согласно настоящему изобретению соединения представляют собой аналоги эксендина с активностью агониста, описанные в патентной заявке США с серийным номером №09/003869, зарегистрированной 7 января 1998 года, которая озаглавлена "Use of Exendins And Agonists Thereof For The Reduction of Food Intake", патентной заявке США №09/554531, включая соединения формулы (VII) [SEQ ID №:21]:

Xaa1 Xaa2 Xaa3 Gly Thr Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Ser Lys Gln Xaa14 Glu Glu Glu Ala Val Arg Leu

Xaa22 Xaa23 Xaa24 Xaa25 Leu Lys Asn Gly Gly Xaa31

Ser Ser Gly Ala Xaa36 Xaa37 Xaa38 Xaa39-Z

где:

Xaa1 представляет собой His, Arg или Tyr;

Xaa2 представляет собой Ser, Gly, Ala или Thr;

Xaa3 представляет собой Asp или Glu;

Xaa6 представляет собой Phe, Tyr или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ser или Thr;

Xaa9 представляет собой Asp или Glu;

Xaa10 представляет собой Leu, Ile, Val, пентилглицин или Met;

Xaa14 представляет собой Leu, Ile, пентилглицин, Val или Met;

Xaa22 представляет собой Phe, Tyr или нафтилаланин;

Xaa23 представляет собой Ile, Val, Leu, пентилглицин, трет-бутилглицин или Met;

Xaa24 представляет собой Glu или Asp;

Xaa25 представляет собой Trp, Phe, Tyr или нафтилаланин;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, 3Hyp, 4Hyp, тиопролин, N-алкилглицин, N-алкилпентилглицин или N-алкилаланин;

Xaa39 представляет собой Ser, Thr или Tyr; а Z представляет собой -OH или -NH2;

при условии, что соединение не имеет формулу из SEQ ID №№:1 или 2. Предпочтительно N-алкильные группы для N-алкилглицина, N-алкилпентилглицина и N-алкилаланина включают в себя низшие алкильные группы, предпочтительно - содержащие от 1 до приблизительно 6 атомов углерода, более предпочтительно - от 1 до 4 атомов углерода. Также согласно настоящему изобретению являются эффективными фармацевтически приемлемые соли соединений формулы (VII).

Примеры аналогов эксендина включают в себя аналоги, где Xaa1 представляет собой His или Tyr. Более предпочтительно Xaa1 представляет собой His.

Предоставлены такие соединения, где Xaa2 представляет собой Gly.

Предоставлены такие соединения, где Xaa14 представляет собой Leu, пентилглицин или Met.

Примеры соединений включают в себя соединения, где Xaa25 представляет собой Trp или Phe.

Также предоставлены соединения, где Xaa6 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile или Val, а Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина или N-алкилаланина. Предпочтительно N-алкилаланин содержит N-алкильную группу, длиной от 1 до приблизительно 6 атомов углерода.

В соответствии с одним из вариантов осуществления Xaa36, Xaa37 и Xaa38 представляют собой одни и те же аминокислотные остатки.

Предоставлены соединения, где Xaa39 представляет собой Ser или Tyr, более предпочтительно Ser.

Предпочтительно Z представляет собой -NH2.

Один из вариантов осуществления относится к соединениям формулы (VII), где Xaa1 представляет собой His или Tyr, предпочтительно His; Xaa2 представляет собой Gly; Xaa6 представляет собой Phe или нафтилаланин; Xaa14 представляет собой Leu, пентилглицин или Met; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile или Val; Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина или N-алкилаланина; а Xaa39 представляет собой Ser или Tyr, более предпочтительно Ser. Более предпочтительно Z представляет собой -NH2.

Согласно другому варианту изобретения примеры соединений включают в себя соединения формулы (VII), где: Xaa1 представляет собой His или Arg; Xaa2 представляет собой Gly; Xaa3 представляет собой Asp или Glu; Xaa6 представляет собой Phe или нафтилаланин; Xaa7 представляет собой Thr или Ser; Xaa8 представляет собой Ser или Thr; Xaa9 представляет собой Asp или Glu; Xaa10 представляет собой Leu или пентилглицин; Xaa14 представляет собой Leu или пентилглицин; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile, Val или трет-бутилглицин; Xaa24 представляет собой Glu или Asp; Xaa25 представляет собой Trp или Phe; Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, тиопролин или N-метилаланин; Xaa39 представляет собой Ser или Tyr: а Z представляет собой -OH или -NH2; при условии, что соединение не имеет формулу из SEQ ID №:1 или 2. Более предпочтительно Z представляет собой -NH2.

Другой вариант осуществления относится к соединениям, где Xaa14 представляет собой Leu, Ile, Val или пентилглицин, более предпочтительно Leu или пентилглицин, а Xaa25 представляет собой Phe, Tyr или нафтилаланин, более предпочтительно Phe или нафтилаланин. Предполагают, что эти соединения обладают эффективной продолжительностью действия и менее подвержены окислительному разрушению как in vitro, так и in vivo, а также в ходе синтеза соединения.

ФОРМУЛА VIII

Также предоставлены соединения, описанные в заявке PCT с серийным номером №PCT/US98/16387, зарегистрированной 6 августа 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №10/181102, в том числе соединения формулы (VIII) [SEQ ID №:22]:

Xaa1 Xaa2 Xaa3 Gly Thr Xaa6 Xaa7 Xaa8 Xaa9 Xaa10

Ser Lys Gln Xaa14 Glu Glu Glu Ala Val Arg Leu

Xaa22 Xaa23 Xaa24 Xaa25 Leu Xaa27 Xaa28 Gly Gly Xaa31

Ser Ser Gly Ala Xaa36 Xaa37 Xaa38 Xaa39-Z

где:

Xaa1 представляет собой His, Arg, Tyr или 4-имидазопропионил;

Xaa2 представляет собой Ser, Gly, Ala или Thr;

Xaa3 представляет собой Asp или Glu;

Xaa6 представляет собой Phe, Tyr или нафтилаланин;

Xaa7 представляет собой Thr или Ser;

Xaa8 представляет собой Ser или Thr;

Xaa9 представляет собой Asp или Glu;

Xaa10 представляет собой Leu, Ile, Val, пентилглицин или Met;

Xaa14 представляет собой Leu, Ile, пентилглицин, Val или Met;

Xaa22 представляет собой Phe, Tyr или нафтилаланин;

Xaa23 представляет собой Ile, Val, Leu, пентилглицин, трет-бутилглицин или Met;

Xaa24 представляет собой Glu или Asp;

Xaa25 представляет собой Trp, Phe, Tyr или нафтилаланин;

Xaa27 представляет собой Lys, Asn или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил или циклоалкилалканоил;

Xaa28 представляет собой Lys, Asn, или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил или циклоалкилалканоил;

Xaa31, Xaa36, Xaa37 и Xaa38 независимо представляют собой Pro, гомопролин, 3Hyp, 4Hyp, тиопролин, N-алкилглицин, N-алкилпентилглицин или N-алкилаланин;

Xaa39 представляет собой Ser, Thr или Tyr; и

Z представляет собой -OH или -NH2;

при условии, что соединение не имеет формулу из SEQ ID №№:1 или 2. Приемлемые соединения формулы (VIII) включают в себя соединения, описанные в заявке PCT с серийным номером №PCT/US98/16387, зарегистрированной 6 августа 1998 года, которая озаглавлена "Novel Exendin Agonist Compounds", патентной заявке США №10/181102, где соединения имеют аминокислотные последовательности, указанные там как SEQ ID №№:5-39, в настоящей заявке они указаны как SEQ ID №№:108-142.

Примеры аналогов эксендина формулы (VIII) включают в себя аналоги, где Xaa1 представляет собой His, Tyr или 4-имидазопропионил. Более предпочтительно, Xaa1 представляет собой His или 4-имидазопропионил.

Предоставлены такие соединения формулы (VIII), где Xaa2 представляет собой Gly.

Предоставлены такие соединения формулы (VIII), где Xaa14 представляет собой Leu, пентилглицин или Met.

Предоставлены такие соединения формулы (VIII), где Xaa25 представляет собой Trp или Phe.

Предоставлены такие соединения формулы (VIII), где Xaa27 представляет собой Lys или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил, а Xaa28 представляет собой Asn.

Также предоставлены соединения формулы (VIII), где Xaa6 представляет собой Phe или нафтилаланин; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile или Val, а Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина или N-алкилаланина. В одном из враиантов осуществления Xaa39 представляет собой Ser или Tyr. Предоставлены соединения, где Xaa39 представляет собой Ser. Предпочтительно Z представляет собой -NH2.

Один из вариантов осуществления относится к соединениям формулы (VIII), где Xaa6 представляет собой Phe или нафтилаланин; Xaa22 представляет собой Phe или нафтилаланин; Xaa23 представляет собой Ile или Val; Xaa27 представляет собой Lys или Lys-NHε-R, где R представляет собой Lys, Arg, неразветвленную цепь C1-C10 или разветвленный алканоил, а Xaa28 представляет собой Asn; а Xaa31, Xaa36, Xaa37 и Xaa38 независимо выбирают из Pro, гомопролина, тиопролина или N-алкилаланина.

В другом варианте осуществления эксендины и аналоги эксендина согласно изобретению не включают в себя пептиды из SEQ ID №№:3-14. В одном из вариантов осуществления аналоги эксендина включают в себя аналоги формул (I-VIII) при условии, что аналоги не включают в себя пептилы из SEQ ID №№:1-2.

Также эффективными согласно объему настоящего изобретения являются более ограниченные виды соединений описанных формул, например формул I-VIII, которые содержат пептиды различной длины, например вид соединений, не включающий в себя пептиды с длиной, которая превышает 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37 или 38 аминокислотных остатков.

Эксендины, аналоги агониста эксендина и агонисты эксендина, которые представляют собой описанные в настоящей заявке пептиды, можно получать очисткой пептидов, как описано, например, в Eng, et al., J. Biol. Chem. 265:20259-62, 1990; и Eng, et al, J. Biol. Chem. 267:7402-05, 1992, которые приведены здесь полностью в качестве ссылки. Альтернативно, эксендины, агонисты пептида эксендина и аналоги агониста эксендина можно получать известными специалистам в данной области способами, например, как описано в Raufman, et al., J. Biol. Chem. 267:21432-37, 1992), приведенном здесь полностью в качестве ссылки, с использованием общепринятых способов твердофазного синтеза пептидов, например с использованием автоматического или полуавтоматического синтезатора пептидов. Как правило, с использованием таких способов защищенную α-N-карбамоилом аминокислоту и аминокислоту, присоединенную к удлиняющейся пептидной цепи в смоле, связывают при комнатной температуре в инертном растворителе, таком как диметилформамид, N-метилпирролидон или дихлорметан, в присутствии связывающих средств, таких как дициклогексилкарбодиимид и 1-гидроксибензотриазол, в присутствии такого основания, как диизопропилэтиламин. α-N-карбамоильную защитную группу удаляют из получаемого пептида-смолы с использованием такого реагента, как трифторуксусная кислота или пиперидин, а реакцию связывания повторяют со следующей желаемой N-защищенной аминокислотой, которая подлежит добавлению к пептидной цепи. Приемлемые N-защитные группы хорошо известны в данной области, например t-бутилоксикарбонил (tBoc) и флуоренилметоксикарбонил (Fmoc).

Растворители, производные аминокислот и смолу из 4-метилбензидриламина, которые используют в синтезаторе пептидов, можно покупать в Applied Biosystems Inc. (Foster City, CA). В Applied Biosystems, Inc. можно купить следующие аминокислоты с защищенными боковыми цепями: BSD-112344.1-Arg(Pmc), Boc-Thr(Bzl), Fmoc-Thr(t-Bu), Boc-Ser(Bzl), Fmoc-Ser(t-Bu), Boc-Tyr(BrZ), Fmoc-Tyr(t-Bu), Boc-Lys(C1-Z). Fmoc-Lys(Boc), Boc-Glu(Bzl), Fmoc-Glu(t-Bu), Fmoc-His(Trt), Fmoc-Asn(Trt) и Fmoc-Gln(Trt). Boc-His(BOM) можно покупать в Applied Biosystems, Inc. или Bachem Inc. (Torrance, CA). Анизол, диметилсульфид, фенол, этандитиол и тиоанизол можно получать в Aldrich Chemical Company (Milwaukee, WI). Air Products and Chemicals (Allentown, PA) предоставляют HF. Простой этиловый эфир, уксусную кислоту и метанол можно покупать в Fisher Scientific (Pittsburgh, PA).

Твердофазный синтез пептидов можно проводить с использованием автоматического синтезатора пептидов (Model 430A, Applied Biosystems Inc., Foster City, CA), применяя систему NMP/HOBt (вариант 1) и химические вещества tBoc или Fmoc (см. руководство для пользователя Applied Biosystems для синтезатора пептидов ABI 430A, версия 1.3B 1 июля 1988 года, раздел 6, стр. 49-70, Applied Biosystems, Inc., Foster City, CA) вместе с кэппированием. Boc-пептид-смолы можно расщеплять посредством HF (от -50°C до 0°C, 1 час). Пептид можно экстрагировать из смолы с использованием поочередной смены воды и уксусной кислоты, а фильтраты можно лиофилизировать. Fmoc-пептидные смолы можно расщеплять общепринятыми способами (Introduction to Cleavage Techniques, Applied Biosystems, Inc., 1990, pp. 6-12). Также пептиды можно получать с использованием синтезатора Advanced Chem Tech (Model MPS 350, Louisville, Kentucky).

Пептиды можно очищать посредством RP-HPLC (препаративной и аналитической) с использованием системы Waters Delta Prep 3000. Для выделения пептидов можно использовать препаративную колонку A C4, C8 или C18 (10 мкм, 2,2 x 25 см; Vydac, Hesperia, CA), а степень чистоты можно определять с использованием аналитической колонки C4, C8 или C18 (5 мкм, 0,46 × 25 см; Vydac). Растворители (A=0,1% TFA/вода и B=0,1% TFA/CH3CN) можно доставлять в аналитическую колонку при объемной скорости потока 1,0 мл/минута, а в препаративную колонку при 15 мл/минута. Анализы аминокислот можно проводить в системе Waters Pico Tag и обрабатывать с использованием программы Maxima. Пептиды можно гидролизовать посредством кислотного гидролиза в газообразной фазе (115°C, 20-24 часа). Гидролизаты можно дериватизировать и анализировать общепринятыми способами (Cohen, et al., The Pico Tag Method: A Manual of Advanced Techniques for Amino Acid Analysis, pp. 11-52, Millipore Corporation, Milford, MA (1989)). Анализ бомбардировки ускоренными атомами можно проводить с использованием M-Scan, Incorporated (West Chester, PA). Калибровку масс можно осуществлять с использованием йодида цезия или йодида цезия/глицерина. Анализ десорбции-ионизации плазмы с использованием регистрации времени пролета можно проводить на масс-спектрометре Applied Biosystems Bio-Ion 20. Масс-спектроскопию с электрораспылением можно проводить в устройстве VG-Trio.

Также эксендины, аналоги агониста эксендина и агонисты эксендина, которые представляют собой пептиды, можно получать с использованием способов рекомбинантной ДНК, применяя известные в настоящее время в данной области способы. См., например, Sambrook et al, Molecular CLONING: A LABORATORY MANUAL, 2d Ed., Cold Spring Harbor (1989). Альтернативно, такие соединения можно получать способами синтеза пептидов в гомогенной фазе. Эффективные согласно настоящему изобретению соединения, не являющиеся пептидами, можно получать известными в данной области способами. Например, с использованием известных в данной области способов можно получать содержащие фосфат аминокислоты и пептиды, которые содержат такие аминокислоты. См., например, Bartlett and Landen, Biorg. Chem. 14:356-377 (1986).

Эксендины, агонисты эксендина или аналоги агониста эксендина можно составлять в виде фармацевтических композиций для введения индивидам, в том числе человеку. Предпочтительно эти фармацевтические композиции содержат эксендин, агонист эксендина или аналог агониста эксендина в количестве, эффективном для снижения массы тела у индивида, уменьшения BMI, изменения состава тканей организма, лечения диабета, снижения уровня глюкозы в крови натощак или снижения уровня глюкозы в крови после приема пищи, а также фармацевтически приемлемый носитель.

Фармацевтически приемлемые носители, эффективные в этих фармацевтических композициях, включают в себя, например, ионообменные вещества, оксид алюминия, стеарат алюминия, лецитин, белки сыворотки, такие как сывороточный альбумин человека, буферные вещества, такие как фосфаты, глицин, сорбиновая кислота, сорбат калия, смеси неполных глицеридов из насыщенных растительных жирных кислот, воду, соли или электролиты, такие как сульфат протамина, гидрофосфат натрия, гидрофосфат калия, хлорид натрия, соли цинка, коллоидный оксид кремния, трисиликат магния, поливинилпирролидон, вещества на основе целлюлозы, полиэтиленгликоль, карбоксиметилцеллюлозу натрия, полиакрилаты, воска, блок-сополимеры полиэтилен-полиоксипропилен, полиэтиленгликоль и ланолин.

Описанные в настоящей заявке композиции можно вводить парентерально, перорально, посредством спрея для ингаляции, местно, ректально, назально, буккально, вагинально или через имплантируемый резервуар. В рамках настоящей заявки термин "парентеральный" включает в себя подкожное, внутривенное, внутримышечное, внутрисуставное, внутрисиновиальное, внутригрудинное, подоболочечное, внутрипеченочное введение, введение в пораженный участок, а также внутричерепную инъекцию или способы инфузии. В одном из вариантов осуществления композиции вводят с использованием помпы для инфузии или подкожной инъекцией препарата с замедленным высвобождением, продолжительным высвобождением, длительным высвобождением или продолжительным действием. В одном из вариантов осуществления подкожные инъекции проводят раз в сутки; раз в двое, трое, четверо, пятеро или шестеро суток; раз в неделю; дважды в месяц; раз в месяц; раз в два месяца или раз в три месяца.

Любой из эксендинов, агонистов эксендина или аналогов агониста эксендина можно вводить в виде кислоты или амида. Кроме того, любой из эксендинов, агонистов эксендина или аналогов агониста эксендина может образовывать соли с различными неорганическими и органическими кислотами и основаниями. Такие соли включают в себя, без ограничения, соли, получаемые вместе с органическими и неорганическими кислотами, например HCl, HBr, H2SO4, H3PO4, трифторуксусной кислотой, уксусной кислотой, муравьиной кислотой, метансульфоновой кислотой, толуолсульфоновой кислотой, малеиновой кислотой, фумаровой кислотой и камфорсульфоновой кислотой. Получаемые с основаниями соли включают в себя, без ограничения, соли аммония, соли щелочных металлов, например, соли натрия и калия, а также соли щелочноземельных металлов, например соли кальция и магния. Конкретными примерами являются соли в виде ацетата, гидрохлорида и трифторацетата. Соли можно получать общепринятыми способами, например реакцией продукта в виде свободной кислоты или основания вместе с одним или несколькими эквивалентами соответствующего основания или кислоты в растворителе или среде, в которой соль является нерастворимой, или в таком растворителе, как вода, который затем удаляют под вакуумом или посредством лиофилизации или посредством обмена ионов существующей соли с другим ионом в приемлемой ионообменной смоле.

В одном из вариантов осуществления способ введения приводит к средней концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме, превышающей или равной приблизительно 50 пг/мл, в течение периода по меньшей мере приблизительно 12 часов или по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6 или по меньшей мере приблизительно 7 суток; по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11, по меньшей мере приблизительно 12, по меньшей мере приблизительно 13, по меньшей мере приблизительно 14, по меньшей мере приблизительно 15 или по меньшей мере приблизительно 16 недель; или по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11 или по меньшей мере приблизительно 12 месяцев. В другом варианте осуществления способ введения приводит к минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме, превышающей или равной приблизительно 50 пг/мл, в течение периода по меньшей мере приблизительно 12 часов или по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, или по меньшей мере приблизительно 7 суток; по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11, по меньшей мере приблизительно 12, по меньшей мере приблизительно 13, по меньшей мере приблизительно 14, по меньшей мере приблизительно 15 или по меньшей мере приблизительно 16 недель; или по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11 или по меньшей мере приблизительно 12 месяцев. Согласно настоящему изобретению можно использовать любой способ введения при условии, что введение приводит к средней концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме по меньшей мере приблизительно 65 пг/мл, приблизительно 75 пг/мл, приблизительно 85 пг/мл, приблизительно 100 пг/мл, приблизительно 150 пг/мл, приблизительно 170 пг/мл, приблизительно 175 пг/мл, приблизительно 200 пг/мл, приблизительно 225 пг/мл, приблизительно 250 пг/мл, приблизительно 300 пг/мл, приблизительно 350 пг/мл, приблизительно 400 пг/мл, приблизительно 450 пг/мл, приблизительно 500 пг/мл, приблизительно 550 пг/мл или приблизительно 600 пг/мл. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, более чем 50 пмоль/литр, более чем 60 пмоль/литр, более чем 70 пмоль/литр, более чем 80 пмоль/литр, более чем 90 пмоль/литр, более чем 100 пмоль/литр, более чем 110 пмоль/литр, более чем 120 пмоль/литр, более чем 130 пмоль/литр, более чем 140 пмоль/литр или более чем 150 пмоль/литр. В других вариантах осуществления средняя концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, снижению уровня глюкозы, изменению состава тканей организма и т.д., который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. Эти средние концентрации поддерживают в течение периода по меньшей мере приблизительно 12 часов или по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6 или по меньшей мере приблизительно 7 суток; по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11, по меньшей мере приблизительно 12, по меньшей мере приблизительно 13, по меньшей мере приблизительно 14, по меньшей мере приблизительно 15 или по меньшей мере приблизительно 16 недель; или по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11 или по меньшей мере приблизительно 12 месяцев. В еще одном варианте осуществления способ введения приводит к поддерживаемой минимальной концентрации эксендина, агониста эксендина или аналога агониста эксендина в плазме, превышающей или равной приблизительно 65 пг/мл, превышающей или равной приблизительно 75 пг/мл, превышающей или равной приблизительно 85 пг/мл, приблизительно 100 пг/мл, превышающей или равной приблизительно 150 пг/мл, превышающей или равной приблизительно 170 пг/мл, превышающей или равной приблизительно 175 пг/мл, превышающей или равной приблизительно 200 пг/мл, превышающей или равной приблизительно 225 пг/мл, превышающей или равной приблизительно 250 пг/мл, превышающей или равной приблизительно 300 пг/мл, превышающей или равной приблизительно 350 пг/мл, превышающей или равной приблизительно 400 пг/мл, превышающей или равной приблизительно 450 пг/мл, превышающей или равной приблизительно 500 пг/мл, превышающей или равной приблизительно 550 пг/мл или превышающей или равной приблизительно 600 пг/мл. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина составляет по меньшей мере приблизительно от 170 пг/мл до 600 пг/мл или по меньшей мере приблизительно от 170 пг/мл до 350 пг/мл. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, более чем 50 пмоль/литр, более чем 60 пмоль/литр, более чем 70 пмоль/литр, более чем 80 пмоль/литр, более чем 90 пмоль/литр, более чем 100 пмоль/литр, более чем 110 пмоль/литр, более чем 120 пмоль/литр, более чем 130 пмоль/литр, более чем 140 пмоль/литр или более чем 150 пмоль/литр. В других вариантах осуществления минимальная концентрация эксендина, агониста эксендина или аналога агониста эксендина в плазме составляет более чем 40 пмоль/литр, но менее чем 150 пмоль/литр, или более чем 40 пмоль/литр, но менее чем 80 пмоль/литр. В одном из вариантов осуществления эксендин, агонист эксендина или аналог агониста эксендина представляет собой эксендин-4. В других вариантах осуществления концентрация эксендина, агониста эксендина или аналога агониста эксендина представляет собой концентрацию эксендина, агониста эксендина или аналога агониста эксендина, приводящую к биологическому или терапевтическому эффекту, например снижению массы, снижению уровня глюкозы, изменению состава тканей организма и т.д., который эквивалентен эффекту, наблюдаемому при заданной концентрации эксендина-4. Эти минимальные концентрации поддерживают в течение периода по меньшей мере приблизительно 12 часов или по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6 или по меньшей мере приблизительно 7 суток; по меньшей мере приблизительно 1, по меньшей мере приблизительно 2, по меньшей мере приблизительно 3, по меньшей мере приблизительно 4, по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11, по меньшей мере приблизительно 12, по меньшей мере приблизительно 13, по меньшей мере приблизительно 14, по меньшей мере приблизительно 15 или по меньшей мере приблизительно 16 недель; или по меньшей мере приблизительно 5, по меньшей мере приблизительно 6, по меньшей мере приблизительно 7, по меньшей мере приблизительно 8, по меньшей мере приблизительно 9, по меньшей мере приблизительно 10, по меньшей мере приблизительно 11 или по меньшей мере приблизительно 12 месяцев. Концентрации эксендина, агониста эксендина или аналога агониста эксендина можно измерять с использованием любого доступного способа.

Средние концентрации можно определять в течение полного интересующего периода времени или, альтернативно, в течение определенного промежутка интересующего периода времени. Например, и без ограничений, средняя суточная концентрация эксендина, агониста эксендина или аналога агониста эксендина в течение периода, составляющего одну неделю, один месяц, три месяца, шесть месяцев или год; средняя недельная концентрация в течение периода, составляющего один месяц, три месяца, шесть месяцев, девять месяцев или год; или средняя месячная концентрация в течение шести месяцев, девяти месяцев или одного года; и т.д. Следует понимать, что средние (усредненные) концентрации включают в себя отдельные измерения, которые превышают или не достигают среднего значения. Таким образом, при любом конкретном измерении концентрация может быть ниже желаемой минимальной средней величины при условии, что среднее значение в течение желаемого периода времени равно или превышает необходимую минимальную величину. В рамках настоящей заявки в отношении концентрации термин "средняя или минимальная" относится к альтернативе, и его следует понимать или как среднюю концентрацию, или как минимальную концентрацию.

Стерильные, пригодные для инъекции формы композиций согласно этому изобретению могут представлять собой водные или масляные суспензии. Эти суспензии можно составлять известными в данной области способами с использованием приемлемых диспергирующих средств или увлажнителей, а также суспендирующих средств. Также стерильный, пригодный для инъекции препарат может представлять собой стерильный, пригодный для инъекции раствор или суспензию в нетоксичном, приемлемом для парентерального введения разбавителе или растворителе, таком как, например, раствор в бутандиоле-1,3. В число приемлемых носителей и растворителей, которые можно использовать, входят вода, раствор Рингера и изотонический раствор хлорида натрия. Кроме того, в качестве растворителя или суспендирующей среды обычно используют стерильные жирные масла. С этой целью можно использовать любое смягчающее жирное масло, в том числе синтетические моно- или диглицериды. Жирные кислоты, такие как олеиновая кислота и ее глицеридные производные, эффективны для получения пригодных для инъекции веществ, например природных фармацевтически приемлемых масел, таких как оливковое масло или касторовое масло, особенно для их полиоксиэтилированных вариантов. Эти масляные растворы или суспензии также могут содержать разбавитель в виде спирта с длинной цепью или диспергирующее вещество, такое как карбоксиметилцеллюлоза или сходные диспергирующие средства, которые обычно используют в составлении фармацевтически приемлемых лекарственных форм, в том числе эмульсий и суспензий. В целях составления также можно использовать другие обычно используемые поверхностно-активные вещества, такие как TWEEN, Span, а также другие эмульгаторы или повышающие биодоступность средства, которые обычно используют в получении фармацевтически приемлемых твердых, жидких или других лекарственных форм.

Препараты для парентерального введения могут находиться в виде разовой ударной дозы, препарата для инфузии или в виде насыщающей ударной дозы с последующей поддерживающей дозой. Эти композиции можно вводить согласно любой описанной в настоящей заявке схеме введения доз.

Фармацевтические композиции согласно этому изобретению можно вводить перорально в любой приемлемой для перорального введения лекарственной форме, в том числе капсулах, таблетках, водных суспензиях или растворах. В случае таблеток для перорального введения обычно используемые носители включают в себя лактозу и кукурузный крахмал. Также обычно добавляют смазывающие вещества, такие как стеарат магния. В случае перорального введения в виде капсулы эффективные разбавители включают в себя лактозу и высушенных кукурузный крахмал. Если для перорального введения необходимы водные суспензии, то активный ингредиент сочетают с эмульгаторами и суспендирующими средствами. При желании, можно также добавлять определенные подсластители, ароматизаторы или красители.

Альтернативно, фармацевтические композиции согласно этому изобретению можно вводить в виде суппозиториев для ректального введения. Их можно получать смешиванием средства вместе с приемлемым, не вызывающим раздражение эксципиентом, который является твердым при комнатной температуре, но жидким при ректальной температуре, и поэтому расплавляется в прямой кишке, высвобождая лекарственное средство. Такие вещества включают в себя масло какао, пчелиный воск и полиэтиленгликоли.

Также фармацевтические композиции согласно этому изобретению можно вводить местно. Местное введение можно осуществлять с использованием препарата ректального суппозитория (см. выше) или приемлемого препарата в виде клизмы. Также можно использовать местные трансдермальные пластыри.

В случае вариантов местного использования фармацевтические композиции можно составлять в виде приемлемой мази, содержащей активное соединение, которое суспендировано или растворено в одном или нескольких носителях. Носители для местного введения соединений согласно этому изобретению включают в себя минеральное масло, вазелиновое масло, белый вазелин, пропиленгликоль, полиоксиэтилен, соединение полиоксипропилена, эмульгирующий воск и воду. Альтернативно, фармацевтические композиции можно составлять в виде приемлемого лосьона или крема, содержащего активные компоненты, которые суспендированы или растворены в одном или нескольких фармацевтически приемлемых носителях. Приемлемые носители включают в себя, но ими не ограничиваются, минеральное масло, моностеарат сорбитана, полисорбат 60, воск из цетиловых сложных эфиров, цетиариловый спирт, 2-октилдодеканол, бензиловый спирт и воду.

В случае офтальмологического использования фармацевтические композиции можно составлять в виде тонкодисперсных суспензий в изотоническом стерильном солевом растворе с надлежащей величиной pH или предпочтительно в виде растворов в изотоническом стерильном солевом растворе с надлежащей величиной pH, с наличием или отсутствием консерванта, такого как хлорид бензалкония. Альтернативно, для офтальмологических вариантов использования фармацевтические композиции можно составлять в виде мази, такой как вазелиновая.

Также фармацевтические композиции согласно этому изобретению можно вводить с использованием назального аэрозоля или ингаляции. Такие композиции получают способами, хорошо известными в области фармацевтических препаратов, и их можно получать в виде растворов в солевом растворе с использованием бензилового спирта или других приемлемых консервантов, веществ, способствующих всасыванию, для повышения биодоступности, фторуглеродов и/или других общепринятых растворителей или диспергирующих средств.

Количество эксендина, агониста эксендина или аналога агониста эксендина, которое можно сочетать с носителями для получения единой лекарственной формы, различается в зависимости от организма-хозяина, которому проводят лечение, и от конкретного способа введения. Композиции можно составлять таким образом, что пациенту, получающему эти композиции, вводят дозу 0,1-1000 пмоль/кг массы тела/минута (при введении инфузией) эксендина, агонистов эксендина или аналога агониста эксендина. В некоторых вариантах осуществления изобретения доза составляет 1-10 пмоль/кг массы тела/минута (при введении инфузией). В одном из вариантов осуществления при введении внутривенной инфузией доза составляет 0,5-2,0 пмоль/кг/минута. Композицию можно вводить в виде разовой дозы, многократных доз или в течение определенного периода времени. В одном из вариантов осуществления доза составляет приблизительно 0,8 мг препарата с длительным действием, содержащего приблизительно 5% эксендина, агониста эксендина или аналога агониста эксендина, например эксендина-4. В другом варианте осуществления доза составляет приблизительно 2,0 мг препарата с длительным действием, содержащего приблизительно 5% эксендина, агониста эксендина или аналога агониста эксендина, например эксендина-4. В дополнительных вариантах осуществления доза составляет приблизительно 1,0, приблизительно 1,25, приблизительно 1,5, приблизительно 1,75, приблизительно 2,25, приблизительно 2,5, приблизительно 2,75, приблизительно 3,0, приблизительно 3,25, приблизительно 3,5, приблизительно 3,75, приблизительно 4,0, приблизительно 4,25, приблизительно 4,5, приблизительно 4,75 или приблизительно 5,0 мг препарата с длительным действием, содержащего приблизительно 5% эксендина, агониста эксендина или аналога агониста эксендина, например эксендина-4. Понимают, что точная доза различается в зависимости от процента содержания эксендина и количества носителей и/или эксципиентов в конкретном препарате. Осуществление таких поправок для достижения желаемых концентраций описанного в настоящей заявке эксендина, агониста эксендина или аналога агониста эксендина в плазме входит в объем навыков специалистов в данной области. Следует отметить, что можно использовать любое сочетание доз и способов введения при условии, что доза в сочетании со способами введения приводит к достижению желаемого терапевтически эффективного уровня эксендина, агониста эксендина или аналога агониста эксендина.

В одном из вариантов осуществления эксендин или агонисты эксендина, или их аналоги вводят пациентам, у которых установили наличие избыточной массы, ожирение, диабет или их сочетание. В другом варианте осуществления эксендин или агонисты эксендина, или их аналоги вводят инъекцией по меньшей мере один раз в сутки, раз в неделю или посредством непрерывной инфузии через помпу. В еще одном варианте осуществления эксендин или агонисты эксендина, или аналоги агониста эксендина составляют для введения из подкожного депо в течение периода, составляющего сутки, недели или месяцы.

В другом варианте осуществления эксендины, агонисты эксендина или аналоги агониста эксендина составляют в виде препарата с длительным высвобождением или длительным действием. В одном из вариантов осуществления препарат с длительным высвобождением содержит биосовместимый полимер, эксендин или аналог агониста эксендина и сахар. Примеры препаратов описаны в патентной заявке США с серийным номером №09/942631, зарегистрированной 31 августа 2001 года (в настоящее время патент США №6824822), и связанной заявке с серийным номером №11/312371, зарегистрированной 21 декабря 2005 года; условной заявке США №60/419388, зарегистрированной 17 октября 2002 года, и связанных патентных заявок США с серийными номерами №№10/688786 и 10/688059, зарегистрированных 17 октября 2003 года; условной заявке США №60/757258, зарегистрированной 9 января 2006 года; условной заявке США с серийным номером №60/563245, зарегистрированной 15 апреля 2004 года, и связанной патентной заявке США №11/104877, зарегистрированной 13 апреля 2005 года; а также в заявке США с серийным номером №11/107550, зарегистрированной 15 апреля 2005 года, которые приведены здесь полностью в качестве ссылки. Например, такие препараты можно вводить подкожной инъекцией один раз в сутки, раз в 2 суток, 3 суток, 4 суток, 5 суток или 6 суток; раз в неделю, раз в 2 недели или раз в три недели; или один раз в месяц, раз в два месяца или раз в 3 месяца.

Препараты с длительным высвобождением можно получать способом разделения фаз. Общий способ получения препарата с длительным высвобождением или длительным действием, включающего микрочастицы, которые содержат эксендин, агонист эксендина или аналог агониста эксендина и сахарозу, для порции размером 1 кг описан ниже.

Эмульсию вода-в-масле получают с использованием гомогенизатора. Примеры гомогенизаторов включают в себя линейный гомогенизатор Megatron MT-V 3-65 F/FF/FF, Kinematica AG, Switzerland. Водную фазу эмульсии можно получать растворением в воде эксендина, агониста эксендина или аналога агониста эксендина, например эксендина-4, и таких эксципиентов, как сахароза. Концентрация эксендина в получаемом растворе может составлять приблизительно от 50 мг/г до приблизительно 100 мг/г. Например, если лекарственное средство представляет собой эксендин-4, то концентрация лекарственного средства в растворе может составлять приблизительно от 30 г до приблизительно 60 г в 600 г воды. В определенном варианте осуществления 50 г эксендина-4 и 20 г сахарозы растворяют в 600 г воды для промывки (WFI). Указанные выше конкретные количества представляют собой номинальную величину без поправки на уровень содержания пептида, специфичный для используемой порции эксендина-4. Масляную фазу эмульсии получают растворением полимера PLGA (например, 930 г очищенного DL4A PLGA 50:50 (Alkermes, Inc.)) в дихлорметане (14,6 кг или 6% масс./масс.).

Затем для образования грубодисперсной эмульсии в масляную фазу добавляют водную фазу с использованием расположенного сверху перемешивающего устройства в течение приблизительно трех минут. Затем грубодисперсную эмульсию гомогенизируют при приблизительно 21300 об./минута при температуре окружающей среды в течение трех отдельных периодов. Это должно приводить к получению капель внутренней эмульсии размером менее чем 1 микрон. Понимают, что получение внутренней эмульсии можно осуществлять с использованием любых приемлемых способов. Приемлемые способы получения эмульсии включают в себя, но ими не ограничиваются, гомогенизацию, как описано выше, и воздействие ультразвуком.

Затем проводят стадию коацервации посредством добавления к внутренней эмульсии силиконового масла (21,8 кг диметикона, NF, 350 сСт) в течение периода времени, составляющего менее чем или равного приблизительно 5 минутам. Это эквивалентно соотношению силиконового масла и дихлорметана 1,5:1. Дихлорметан из раствора полимера распределяется в силиконовом масле и начинает осаждать полимер вокруг водной фазы, содержащей эксендин, что приводит к образованию микрокапсул. Формируемые таким образом первичные микросферы являются мягкими и нуждаются в повышении твердости. Первичным микросферам часто позволяют отстаиваться в течение небольшого периода времени, например в течение менее чем 1 минуты или приблизительно от 1 минуты до приблизительно 5 минут перед проведением стадии затвердевания микросфер.

Первичные микросферы сразу переносят в смесь растворителей гептан/этанол. Необходимый объем смеси гептан/этанол можно определять на основе величины порции микросфер, как правило, соотношение растворителя гептан/этанол и дихлорметана составляет 16:1. Например, можно использовать приблизительно 210 кг гептана и 23 кг этанола в охлаждаемой до 3°C смесительной емкости. Эта смесь растворителей повышает твердость микросфер посредством экстракции дополнительного количества дихлорметана из микросфер. Также эта стадия затвердевания может быть названа закалкой. После закаливания в течение 1 часа при 3°C смесь растворителей выливают и добавляют свежий гептан (13 кг) при 3°C, и выдерживают в течение 1 часа для смывания остатков силиконового масла, этанола и дихлорметана с поверхности микросфер или перекачивают непосредственно на стадию сбора.

После окончания стадии закалки или слива/промывки микросферы переносят и собирают, например, с использованием фильтра/сушильного устройства модели PH12Y6 12" Sweco Pharmasep. В этом примере в фильтре/сушильном устройстве используют многослойное сито для сбора с размером ячеек 25 микрон, и устройство подключают к мотору, вызывающему колебания сита в течение сбора и сушки. Для обеспечения максимального линейного переноса и для удаления какого-либо избытка силиконового масла можно проводить заключительную промывку гептаном (6 кг при 3°C). Затем микросферы можно сушить под вакуумом при наличии или отсутствии непрерывной продувки газообразным азотом при контролируемой скорости, например от 3 до 10 часов (например, 6 часов) при 3°C; от 3 до 10 часов при повышении температуры до 41°C (например, 6 часов); и поддерживать в течение длительного периода (например, 80-90 часов) при 41°C.

После завершения сушки микросферы извлекают в емкость для сбора, просеивают через сито с размером ячеек 150 мкм и хранят при -20°C до заполнения.

Альтернативный общий способ получения препарата с продолжительным высвобождением или длительным действием, включающего микрочастицы, которые содержат эксендин, агонист эксендина или аналог агониста эксендина и сахарозу, состоит в следующем.

Получают с использованием ультразвукового устройства эмульсию вода-в-масле. Приемлемые ультразвуковые устройства включают в себя Vibracell VCX 750 с измерительной головкой модели CV33, Sonics and Materials Inc., Newtown, CT. Водную фазу эмульсии получают растворением в воде эксендина, например эксендина-4, и таких эксципиентов, как сахароза. Концентрация лекарственного средства в получаемом растворе может составлять приблизительно от 50 мг/г до приблизительно 100 мг/г. Например, если лекарственное средство представляет собой эксендин-4, то концентрация лекарственного средства в растворе может составлять приблизительно от 3,28 г до приблизительно 6,55 г в 65,5 г воды. В определенном варианте осуществления 5,46 г эксендина-4 и 2,18 г сахарозы растворяют в 65,5 г воды для промывки (WFI). Указанные выше конкретные количества превышают на 4% расчетную величину для компенсации потерь при стерилизации компонентов фильтрованием. Масляную фазу эмульсии получают растворением полимера PLGA (например, 97,7 г очищенного DL4A PLGA 50:50 (Alkermes, Inc.)) в дихлорметане (1539 г или 6% мас./об.).

Затем в течение периода приблизительно трех минут к масляной фазе добавляют водную фазу, воздействуя ультразвуком при амплитуде 100% при температуре окружающей среды. Содержащую сахарозу/эксендин-4 водную фазу помещают в реактор для коацервации. Затем в реакторе проводят перемешивание при 1400-1600 об./минута вместе с дополнительным воздействием ультразвуком при амплитуде 100% в течение 2 минут с последующим выдерживанием в течение 30 секунд, а затем воздействием ультразвуком в течение еще 1 минуты. Это приводит к получению внутренней эмульсии с каплями размером менее чем 0,5 микрон. Понимают, что получение внутренней эмульсии можно осуществлять с использованием любых приемлемых способов. Приемлемые способы получения эмульсии включают в себя, но ими не ограничиваются, воздействие ультразвуком, как описано выше, и гомогенизацию.

Затем проводят стадию коацервации посредством добавления к внутренней эмульсии силиконового масла (2294 г диметикона, NF, 350 сСт) в течение периода времени менее чем 5 минут. Это эквивалентно соотношению силиконового масла и дихлорметана 1,5:1. Дихлорметан из раствора полимера распределяется в силиконовом масле и начинает осаждать полимер вокруг водной фазы, содержащей эксендин, что приводит к образованию микрокапсул. Формируемые таким образом первичные микросферы являются мягкими и нуждаются в повышении твердости. Первичным микросферам часто позволяют отстаиваться в течение небольшого периода времени, например, в течение менее чем 1 минуты или приблизительно от 1 минуты до приблизительно 5 минут перед проведением стадии затвердевания микросфер.

Затем первичные микросферы сразу переносят в смесь растворителей гептан/этанол. Необходимый объем смеси гептан/этанол можно определять на основе величины порции микросфер. В настоящем примере используют приблизительно 22 кг гептана и 2448 г этанола в охлаждаемой до 3°C емкости при перемешивании (350-450 об./минута). Эта смесь растворителей повышает твердость микросфер посредством экстракции дополнительного количества дихлорметана из микросфер. Также эта стадия затвердевания может быть названа закалкой. После закаливания в течение 1 часа при 3°C смесь растворителей выливают и добавляют свежий гептан (13 кг) при 3°C и выдерживают в течение 1 часа для смывания остатков силиконового масла, этанола и дихлорметана с поверхности микросфер.

После окончания стадии промывки микросферы переносят и собирают, например, с использованием расположенного внутри конусообразной сушильной камеры многослойного сита с диаметром 6", с размером ячеек 20 микрон, которое функционирует как оконечный фильтр. Для обеспечения максимального линейного переноса проводят заключительную промывку гептаном (6 кг при 4°C). Затем микросферы сушат непрерывной продувкой газообразным азотом при контролируемой скорости, например, в соответствии со следующей схемой: 18 часов при 3°C; 24 часа при 25°C; 6 часов при 35°C; и 42 часа при 38°C.

После окончания сушки микросферы извлекают в стерилизованную емкость для сбора из тефлона/нержавеющей стали, присоединенную к сушильному конусу. Емкость для сбора герметично запечатывают, удаляют из сушильного конуса и хранят при -20 ± 5°C до заполнения. Вещество, которое остается в конусе после демонтирования с целью очистки, отбирают для анализа содержания лекарственного средства.

Ниже указаны неограничивающие примеры конкретных полимеров PLG, которые эффективны для использования в описанных выше общих способах. Указанные полимеры можно получать в Lakeshore Biomaterials of Birmingham, Alabama, или Boehringer Ingelheim Pharma GmbH & Co. KG, Germany, хотя также могут быть доступны другие источники, и эти полимеры могут быть описаны следующим образом.

Полимер 2A: сополимер лактида и гликолида; соотношение лактид:гликолид 50:50; молекулярная масса 12,3 кДа; IV=0,15 (дл/г).

Полимер 4A: сополимер лактида и гликолида; соотношение лактид:гликолид 50:50; молекулярная масса 45-64 кДа; IV=0,45-0,47 (дл/г).

В данной области известно (см., например, Peptide Acylation by Poly(α-Hydroxy Esters) by Lucke et al., Pharmaceutical Research, Vol. 19, No. 2, p.175-181, February 2002), что белки и пептиды, включенные в матрицы PLG, могут быть изменены нежелательным образом (например, быть разрушенными или химически модифицированными) в результате взаимодействия с продуктами распада PLG или примесей, остающихся после получения полимера. Как таковые, полимеры PLG, которые используют в получении описанных в настоящей заявке препаратов микрочастиц, можно очищать перед получением композиций с длительным высвобождением, используя известные в данной области способы очистки.

Конкретные схемы введения доз и схемы лечения для какого-либо конкретного пациента зависят от множества факторов, в том числе конкретного эксендина или агонистов эксендина, или их аналогов, возраста пациента, массы тела, общего состояния здоровья, пола и диеты, а также времени введения, скорости выведения, сочетания лекарственных средств и тяжести конкретного заболевания, подлежащего лечению. Оценка таких факторов медицинскими специалистами по уходу входит в объем обычных навыков в данной области. Количество эксендина или агонистов эксендина, или их аналогов также зависит от конкретного пациента, подлежащего лечению, способа введения, вида препарата, характеристик используемого соединения, тяжести заболевания и желаемого эффекта. Количества эксендина или агонистов эксендина, или их аналогов можно определять с использованием хорошо известных в данной области фармакологических и фармакокинетических принципов.

Для того чтобы описанное в настоящей заявке изобретение можно было понять более полно, ниже представлены следующие примеры. Следует понимать, что эти примеры предназначены только для иллюстративных целей и не предназначены для какого-либо ограничения этого изобретения.

ПРИМЕРЫ

Фармакокинетику препарата эксенатида с длительным действием - высвобождением (LAR) оценивали в рандомизированном, двойном слепом, плацебо-контролируемом, многоцентровом исследовании для индивидов с диабетом типа 2. Исследуемая популяция состояла из 45 индивидов с диабетом типа 2, которым проводили лечение постоянным введением метформина или лечили посредством модификации диеты и физическими упражнениями в течение по меньшей мере 3 месяцев до проведения скрининга. Индивиды, женщины или мужчины, были в возрасте от 18 до 75 лет, с индексом массы тела (BMT) на момент скрининга 25 кг/м2-45 кг/м2 включительно и уровнем HbA1c на момент скрининга 7,1%-11,0% включительно. В исследовании сравнивали многократные дозы препарата эксенатида с длительным действием-высвобождением, который вводили подкожной (SC) инъекцией раз в неделю в течение 15 недель. Исследование также проводили для оценки эффектов такого введения на массу тела индивида и концентрации глюкозы натощак и после приема пищи. Перед вступительным периодом индивидов случайным образом определяли в соответствующие группы вариантов лечения в соотношении 1:1:2:2 (A1:A2:B:C [таблица 3]). В течение 3-суточного, двойного слепого вступительного периода индивиды вводили себе 5 мкг эксенатида (группы B и C) или эквивалентный объем плацебо (группы A1 и A2) подкожно, два раза в сутки, в течение 15 минут до приема пищи утром и вечером. Этот 3-суточный вступительный период был разработан для воздействия эксенатидом на индивидов до введения эксенатида LAR для определения того, может ли индивид обладать высокой чувствительностью к эксенатиду.

Таблица 3
Вступительный период; Период лечения
3-суточный, двойной слепой 15-недельный, двойной слепой
Группа Вступительная обработка лекарственными средствами Доза (мкг)* Объем дозы (мл) Обработка лекарственными средствами в исследовании Доза (мг)** Объем дозы
A1 Плацебо BID - 0,02 Плацебо LAR QW - X
A2 Плацебо BID - 0,02 Плацебо LAR QW - Y
В Эксенатид BID 5 0,02 Эксенатид LAR QW 0,8 X
С Эксенатид BID 5 0,02 Эксенатид LAR QW 2,0 Y
BID обозначает два раза в сутки
QW обозначает раз в неделю
*Доза эксенатида (эксендин-4)
**Доза препарата LAR, содержащего 5% эксенатида (эксендин-4)
***Группы, обозначаемые одной и той же буквой, получали равные объемы лекарственного средства

В ходе трехсуточного вступительного периода индивидам давали указание не принимать пищу (отсутствие пищи или напитков, за исключением воды) по меньшей мере за 8 часов до наступления вечера перед каждым посещением. Вступительное введение лекарственного средства (5 мкг эксенатида [эксендина-4] или плацебо) осуществляли подкожно, два раза в сутки, в течение 15 минут до приема пищи утром и вечером. Если прием пищи был пропущен, то вводили вступительное лекарственное средство, а через 15 минут после этого следовала легкая закуска. Введения осуществляли не чаще, чем с перерывом в 6 часов. Индивиды получали 5 мкг эксенатида, вводимого подкожно, или эквивалентный объем дозы плацебо два раза в сутки (BID). Используемый в этом исследовании раствор эксенатида для инъекции (эксенатид BID) представлял собой прозрачный, бесцветный, стерильный консервированный раствор для подкожной инъекции, содержащий эксенатид (эксендин-4) в буфере из ацетата натрия, pH 4,5, 4,3% маннита в качестве изоосмоляльного модифицирующего вещества и 0,22% метакрезола в качестве консерванта. Концентрация раствора эксенатида для инъекции составляет 0,25 мг/мл эксендина-4. Раствор плацебо для инъекции является таким же, как активный препарат раствора эксенатида для инъекции, за исключением отсутствия активного ингредиента (эксендина-4).

В течение 15-недельного периода лечения индивидам проводили еженедельные подкожные инъекции эксенатида LAR, 0,8 мг или 2,0 мг в дозе, или эквивалентного объема дозы плацебо LAR. Также индивидов наблюдали в течение 12 недель после периода лечения на предмет безопасности и фармакокинетического анализа.

Эксенатид LAR представляет собой препарат эксенатида (эксендина-4) с длительным высвобождением, разработанный для обеспечения высвобождения эксенатида в течение периода в диапазоне от 7 до 91 суток. Используемый в этом исследовании эксенатид LAR содержал, на основе масс./масс., 5% эксенатида, 2% сахарозы и 93% сополимера D,L-молочной и гликолевой кислот 50:50 MEDISORB®. Флакон, содержащий сухой порошок с цветом от белого до белого с желтоватым оттенком (2,8 мг микросфер эксенатида LAR), хранили в центре проведения исследования в замороженном состоянии в морозильной камере с регистрируемой температурой ≤-20±5°C. Плацебо LAR являлось таким же, как активный препарат эксенатида LAR, за исключением замены активного ингредиента (эксенатида) 0,5% сульфатом аммония.

Индивидов еженедельно наблюдали на предмет массы тела, основных показателей жизнедеятельности (в том числе артериального давления, частоты сердечных сокращений, частоты дыхания и температуры), анализа мочи и неблагоприятных событий. Кроме того, осуществляли забор крови для оценки концентраций эксендина и глюкозы в плазме. Уровень HbA1c определяли каждые три недели. Индекс массы тела рассчитывали с использованием номограммы.

Проводимые для семи точек, самоконтролируемые измерения уровня глюкозы в крови (SMBG) выполняли в течение 3 суток в промежутке от суток -7 до суток -3, а также в промежутке от недели 14 до недели 15. Отдельный 7-точковый профиль SMBG включал одни сутки с тремя измерениями уровня глюкозы, получаемыми до приема пищи (в течение 15 минут до приема пищи), и тремя измерениями уровня глюкозы, получаемыми после приема пищи (через 1,5-2 часа после приема пищи) для трех основных приемов пищи в течение суток. Седьмое измерение проводили в 0300 часа.

Уровень эксенатида в плазме количественно определяли утвержденным твердофазным иммуноферментным анализом (ELISA) (Fineman et al., Diabetes Care, 26:2370-2377, 2003) в LINCO Diagnostic Services, Inc (St. Charles, Missouri). Уровень гликозилированного гемоглобина количественно определяли в Quintiles Laboratories (Smyrna, GA) с использованием высокоэффективной жидкостной хроматографии (Davis et al., Diabetes, 27:102-107, 1978; Cole et al., Metabolism, 27:289-301, 1978). Антитела против эксенатида измеряли способом, сходным со способом, который описан ранее (Fineman et al., Diabetes Care, 26:2370-2377, 2003), в LESTCO Diagnostic Services.

Выборку численностью 36 индивидов оценивали для обеспечения доверительных интервалов 95%, составляющих приблизительно от 65 до 115 пг/мл и от 170 до 290 пг/мл для средних концентраций эксенатида в равновесном состоянии в случае 0,8 и 2,0 мг эксенатида LAR соответственно.

Предназначенная для лечения (ITT) популяция включала всех выбранных случайным образом индивидов, которым проводили по меньшей мере одну инъекцию лекарственного средства для вступительного периода, тогда как оцениваемая популяция состояла из индивидов, полностью прошедших процедуры исследования в течение недели 15 в соответствии с протоколом. Для популяции ITT обеспечивали описательную статистику по демографическим показателям, безопасности, конечным точкам гликемии и массы. В случае оцениваемой популяции получали описательную статистику для процента индивидов, достигавших уровня гемоглобина ≤7,0%, и проводили самоконтролируемые измерения уровня глюкозы в крови. Для тех индивидов, которые получали эксенатид LAR и полностью завершили исследование, представляли концентрации эксенатида в плазме в зависимости от варианта лечения и времени. Фармакокинетику эксенатида анализировали с использованием некомпартментных способов и обобщали описательно. Для уровня гликозилированного гемоглобина, уровня глюкозы в плазме натощак и массы тела вычисляли доверительные интервалы 95% для разницы в изменениях от исходного уровня до недели 15 для групп 0,8 мг и 2,0 мг эксенатида LAR в сравнении с группой плацебо LAR. Значимыми считали различия, для которых доверительные интервалы 95% не включали ноль.

Средние равновесные концентрации эксенатида (0,8 мг: 111 пг/мл, 2,0 мг: 232 пг/мл) достигали в период от 6 до 7 недели и поддерживали в заданном диапазоне в течение периода лечения (неделя 15). После завершения стадии лечения в неделю 15 концентрации эксенатида постепенно снижались (фигура 1).

При первом измерении после введения эксенатида LAR (неделя 1) уровень глюкозы натощак был снижен, при этом значимые изменения от исходного уровня до недели 15 составили -43±16 мг/дл (среднее значение ± SE) и -39±9 мг/дл для групп 0,8 и 2,0 мг эксенатида LAR соответственно в сравнении с +18±12 мг/дл для группы плацебо LAR. Через 15 недель лечения эксенатидом LAR средние величины глюкозы в плазме натощак составили 143 мг/дл и 128 мг/дл в группах 0,8 и 2,0 мг эксенатида LAR в сравнении с 198 мг/дл для группы плацебо LAR (фигура 2A).

Для всех 3 групп (0,8 мг, 2,0 мг & плацебо) наблюдали сходные профили саморегистрируемых уровней глюкозы в крови и сходные средние суточные концентрации глюкозы в крови в начальный момент (плацебо LAR: 203 мг/дл, 0,8 мг: 205 мг/дл, 2,0 mg: 195 мг/дл) (фигура 2B). К неделе 15 средние суточные концентрации глюкозы в крови снизились в обеих группах варианта лечения LAR (0,8 мг: до 165 мг/дл, 2,0 мг: до 149 мг/дл), а в группе плацебо LAR средняя суточная концентрация глюкозы в крови повысилась (до 220 мг/дл). Концентрации глюкозы в плазме перед приемом пищи и после приема пищи снижались в обеих группах эксенатида LAR, при этом величина отклонений уровня после приема пищи в случае 2,0 мг эксенатида LAR снижалась в четыре раза в сравнении с плацебо LAR.

При первом измерении после введения эксенатида LAR (неделя 3) уровень гликозилированного гемоглобина был снижен в обеих группах эксенатида LAR, и он постепенно снижался в течение всего периода лечения (фигура 2C). К неделе 15 наблюдали значимые отклонения величины гликозилированного гемоглобина от исходного уровня, составившие -1,4±0,3% и -1,7±0,3% для групп 0,8 и 2,0 мг эксенатида LAR соответственно в сравнении с +0,4±0,3% для группы плацебо LAR, что приводило к средним величинам гликозилированного гемоглобина 7,2% и 6,6% в группах 0,8 и 2,0 мг эксенатида LAR в сравнении с 9,0% для группы плацебо LAR. У восьмидесяти шести процентов индивидов с исходным уровнем гликозилированного гемоглобина >7% в группе 2,0 мг и 36% индивидов в группе 0,8 мг к неделе 15 наблюдали уровень гликозилированного гемоглобина, составивший <7%, в сравнении с 0% индивидов в группе плацебо LAR (фигура 2D).

В случае варианта лечения 2,0 мг эксенатида LAR масса тела снижалась постепенно, при этом значимое отклонение от исходного уровня к неделе 15 составило -3,8±1,5 кг (3,5% общей массы тела) (фигура 3). В группах 0,8 мг эксенатида LAR и плацебо LAR масса тела практически не изменялась.

Следует понимать, что настоящее изобретение было описано подробно посредством иллюстраций и примеров в целях ознакомления специалистов в данной области с изобретением, его принципами и его практическим применением. Конкретные препараты и способы согласно настоящему изобретению не ограничены представленными описаниями конкретных вариантов осуществления, при этом описания и примеры следует рассматривать в контексте формулы изобретения и ее эквивалентов. Хотя некоторые указанные выше примеры и описания содержат определенные заключения относительно возможного способа функционирования изобретения, автор изобретения не подразумевает ограничиваться этими заключениями и функциями, а представляет их только в качестве возможных объяснений.

Кроме того, следует понимать, что представленные конкретные варианты осуществления настоящего изобретения не предназначены являться исчерпывающими или ограничивающими изобретение и что множество альтернативных вариантов, модификаций и изменений очевидны специалистам в данной области исходя из приведенных выше примеров и подробного описания. Соответственно подразумевают, что это изобретение включает в себя все такие альтернативные варианты, модификации и изменения, которые входят в объем следующей ниже формулы изобретения.

1. Способ снижения уровня HbA1C, снижения уровня глюкозы в плазме натощак или уменьшения массы тела у человека, в случае необходимости предусматривающий введение человеку эксендина или аналога агониста эксендина в эффективном количестве, поддерживающем содержание эксендина или аналога агониста эксендина на уровне средней равновесной концентрации в плазме, составляющей от 170 до 290 пг/мл в течение по меньшей мере 1 месяца, где эффективное количество эксендина или аналога агониста эксендина, составляющее приблизительно от 1,0 мг до приблизительно 5,0 мг, вводится один раз в неделю.

2. Способ по п.1, где эксендин или аналог агониста эксендина представляет собой эксендин-4.

3. Способ по п.1, где снижение уровня HbA1c составляет по меньшей мере 1,5%.

4. Способ по п.1, где уровень HbA1c снижают до уровня менее 7,0%.

5. Способ по п.1, где уровень HbAlc снижают до уровня менее 6,5%.

6. Способ по п.1, где снижение массы составляет по меньшей мере 2 кг.

7. Способ по п.1, где средняя равновесная концентрация эксендина или аналога агониста эксендина в плазме составляет приблизительно 232 пг/мл.

8. Способ по п.1, где эффективное количество эксендина или аналога агониста эксендина составляет 2,0 мг и вводится один раз в неделю.

9. Способ лечения диабета у человека, в случае необходимости предусматривающий введение человеку эксендина или аналога агониста эксендина в эффективном количестве, поддерживающем содержание эксендина или аналога агониста эксендина на уровне средней равновесной концентрации в плазме, составляющей от 170 до 290 пг/мл в течение по меньшей мере 1 месяца, где эффективное количество эксендина или аналога агониста эксендина, составляющее приблизительно от 1,0 мг до приблизительно 5,0 мг, вводится один раз в неделю.

10. Способ по п.9, где эксендин или аналог агониста эксендина представляет собой эксендин-4.

11. Способ по п.9, где уровень глюкозы в плазме натощак снижают до уровня менее 140 мг/дл.

12. Способ по п.9, где снижение массы составляет по меньшей мере 2 кг.

13. Способ по п.9, где поддерживаемая минимальная концентрация эксендина или аналога агониста эксендина в плазме составляет приблизительно от 232 пг/мл.

14. Способ по п.9, где диабет представляет собой диабет типа I, диабет типа II или диабет, обусловленный беременностью.

15. Способ по п.1 или 9, где эксендин или аналог агониста эксендина содержит аминокислотную последовательность, выбранную из одной или более следующих последовательностей SEQ ID №: 8-14 и 23-142.

16. Способ по п.1 или 9, где эксендин или аналог агониста эксендина содержит аминокислотную последовательность, выбранную из одной или более следующих последовательностей SEQ ID №: 15-22.

17. Способ по п.9, где эффективное количество эксендина или аналога агониста эксендина составляет 2,0 мг и вводится один раз в неделю.

18. Способ по любому из пп.1 или 9, включающий введение фармацевтической композиции, содержащей сополимер лактида и гликолида и 2,0 мг эксендина-4.

19. Способ по любому из пп.1 или 9, включающий введение фармацевтической композиции, содержащей 5% (мас./мас.) эксендина-4, 2% (мас./мас.) сахарозы и 93% (мас./мас.) сополимера лактида и гликолида.



 

Похожие патенты:
Изобретение относится к медицине, а именно к кардиологии и эндокринологии, и касается лечения больных хронической сердечной недостаточностью, отягощенной сахарным диабетом 2 типа.

Изобретение относится к питанию, особенно к способу и пищевой композиции для улучшения баланса глюкозы и инсулина у индивидуума. .

Изобретение относится к новым соединениям - производным бензохинонов формулы (I): где каждый R1 и R2 представляет собой O-С(O)фенил; где фенил замещен 1 заместителем, выбранным из галоида, нитро, C1-С6алкила или С1-С6алкокси, и к их фармацевтически приемлемым солям.

Изобретение относится к соединению, имеющему структуру , значения радикалов такие, как представлено в формуле изобретения, а также к его фармацевтически приемлемой соли, пролекарству, таутомеру и стереоизомеру.

Изобретение относится к соединению формулы 1 где Х представляет собой OR1, SR1 или NR1R2, где R1 и R2 независимо представляют собой С1 -С5 низший алкил, и R1 и R2 в NR1R2 могут образовывать 5-7-членное кольцо, включающее гетероатом О; или к его стереоизомеру, фармацевтически приемлемой соли, гидрату или сольвату.

Изобретение относится к области фармакологии, медицины и пищевой промышленности и касается средства для снижения накопления висцеральной жировой ткани, содержащего соединение формулы 1 или экстракт растения Liliaceae, включающий эти соединения, применения указанных соединений или экстрактов для ингибирования накопления висцеральной жировой ткани, а также пищевого продукта на их основе.

Изобретение относится к фармацевтической промышленности и касается способа увеличения срока годности фармацевтической композиции для парентерального введения, содержащей глюкагоноподобный пептид, его аналог или производное аналога.

Изобретение относится к области фармацевтических препаратов и касается способа получения стабильного раствора соединения GLP-1, при котором нагревают раствор указанного пептида, причем температура находится между 50 и 95°С, рН находится между примерно 8,0 и 10,5 и нагревание осуществляют в течение периода времени, составляющего между 3 мин и 180 мин.

Изобретение относится к области медицины. .

Изобретение относится к новым производным глюкагон-подобного пептида (GLP-1), которые имеют пролонгированный профиль действия, их фармацевтическим композициям и применению соединений для приготовления лекарственного средства для лечения или предотвращения гипергликемии, диабета 2 типа или ожирения.

Изобретение относится к соединению формулы (I) или его фармацевтически приемлемой соли, где R 1 и R2, каждый независимо, обозначают атом водорода, атом галогена, низший алкил, гидроксильную группу, цианогруппу или низший алкокси; R3 независимо обозначает атом водорода, атом галогена, низший алкил, низший алкокси, гидроксиалкил, трифторметил, низший алкенил или цианогруппу; R4 независимо обозначает атом водорода, низший алкил, низший алкокси, атом галогена, трифторметил, гидроксиалкил, необязательно замещенный низшим алкилом, аминоалкил, необязательно замещенный низшим алкилом, алканоил, карбоксильную группу, низший алкоксикарбонил или цианогруппу; Q обозначает атом азота; R5 и R6, каждый независимо, обозначают атом водорода, низший алкил, атом галогена, низший алкилсульфонил, низший алкилсульфинил, алканоил, формил, арил, моно- или ди-(низший) алкилкарбамоил или моно- или ди-(низший) алкилсульфамоил; и далее, как указано в формуле изобретения.
Изобретение относится к медицине, а именно к эндокринологии, и касается лечения диабета 2 типа. .

Изобретение относится к слитым белкам альбумина. .

Изобретение относится к лекарственным средствам и касается применения оксинтомодулина или его аналога, в котором остаток гистидина в положении 1 сохранен или замещен другой ароматической аминокислотой, несущей положительный заряд, или его фармацевтически приемлемой соли или конъюгата с полимером или полисахаридом или химически модифицированнного варианта, в частности с помощью модификации боковых цепей, С-конца, ацилирования и амидирования, для профилактики или лечения избыточной массы тела у млекопитающего.

Изобретение относится к области биофармакологии, медицины и лекарственным средствам. .

Изобретение относится к химико-фармацевтической промышленности и касается новых композиций, содержащих: (а) соединение GLP-1, выбранное из группы, состоящей из соединений GLP-1, представленных в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 13 и SEQ ID NO: 14; и (б) средство для доставки, выбранное из группы, состоящей из средства для доставки 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55 и 56.

Изобретение относится к области медицины, а именно к фармацевтическим композициям, содержащим пептид и пропиленгликоль, к способам приготовления таких композиций, а также относится к способам снижения засорения инъекционных устройств пептидной композицией и снижения образования отложений в производственном оборудовании в процессе изготовления пептидной композиции
Наверх