Слитые конструкции лекарственного средства и конъюгаты



Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты
Слитые конструкции лекарственного средства и конъюгаты

 


Владельцы патента RU 2428431:

Домантис Лимитед (GB)

Изобретение относится к биотехнологии. Описаны конъюгаты лекарственного средства, которые содержат инкретиновый терапевтический или диагностический агент, который слит или конъюгирован с антигенсвязывающим фрагментом антитела, которое связывает сывороточный альбумин. Конъюгаты имеют более длительный in vivo период полувыведения по сравнению с неконъюгированным или неслитым терапевтическим или диагностическим агентом. 10 н. и 17 з.п. ф-лы, 19 ил., 13 табл.

 

РОДСТВЕННЫЕ ЗАЯВКИ

Данная заявка имеет приоритет согласно предварительной заявке на патент США №60/632361, поданной 2 декабря 2004 г., и приоритет согласно заявке на патент Великобритании №0511019.2. Содержание вышеназванных заявок полностью включено в настоящий документ посредством ссылки.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Многие лекарственные средства, обладающие биологической активностью, которая могла бы быть полезной для терапевтических и/или диагностических целей, обладают ограниченной ценностью, поскольку они быстро выводятся из организма при введении. Например, многие полипептиды, которые имеют терапевтически полезные виды активности, быстро выводятся из кровообращения почками. Соответственно, следует вводить большие дозы, чтобы достичь желаемого терапевтического эффекта. Существует необходимость в улучшенных терапевтических и диагностических агентах, которые имеют улучшенные фармакокинетические свойства. Полипептиды, которые связывают сывороточный альбумин, известны в уровне техники. (См., например, ЕР 0486525 В1 (Сети Bioteknik AB); US 6267964 В1 (Nygren et al.); WO 04/001064 A2 (Dyax, Corp.); WO 02/076489 A1 (Dyax, Corp.); WO 01/45746 (Genentech, Inc.).)

Один такой класс лекарственных средств, которые имеют короткий период полувыведения в организме или большом круге кровообращения, представляет собой инкретиновые гормоны, такие как глюкагон-подобный пептид 1, или Пептид YY.

Глюкагон-подобный пептид (GLP)-1 представляет собой инкретиновый гормон с ярко выраженными глюкозозависимыми инсулинотропным и глюкагоностатическим видами действия, трофическим действием на панкреатические В клетки и ингибиторными эффектами в отношении желудочно-кишечной секреции и перистальтики, вдобавок к способности понижать уровень глюкозы в плазме и уменьшать амплитуду изменения концентраций глюкозы. Кроме того, посредством своей способности усиливать чувство насыщения, GLP-1 уменьшает потребление пищи, таким образом, ограничивая увеличение массы тела, и может даже вызывать снижение массы тела. Все вместе, эти виды действия придают GLP-1 уникальный профиль, считающийся высоко желательным для противодиабетического агента, особенно в связи с тем, что зависимость глюкозы от его антигипергликемических эффектов должна минимизировать любой риск тяжелой гипогликемии. Однако его фармакокинетический/ фармакодинамический профиль таков, что природный GLP-1 не является терапевтически пригодным. Таким образом, в то время как GLP-1 является наиболее эффективным при постоянном введении, однократные подкожные инъекции имеют непродолжительные эффекты. GLP-1 в высшей степени подвержен ферментативному разрушению in vivo, и расщепление дипептидилпептидазой IV (DPP-IV) является, вероятно, наиболее правдоподобным, поскольку это происходит быстро и приводит к образованию неинсулинотропного метаболита. Следовательно, стратегии для мобилизации терапевтического потенциала GLP-1 на основе понимания факторов, влияющих на его метаболическую стабильность и фармакокинетический/ фармакодинамический профиль, находятся в центре интенсивных исследований.

Огромная работа была проделана с целью предпринять попытку ингибировать пептидазу или модифицировать GLP-1 таким образом, чтобы замедлить его разрушение при сохранении, тем не менее, биологической активности. В WO 05/027978 раскрыты производные GLP-1, имеющие пролонгированный профиль действия (и включенные ссылкой в настоящий документ в качестве примеров производных и аналогов GLP-1, которые можно применять в настоящем изобретении). В WO 02/46227 описаны гетерологичные слитые белки, содержащие полипептид (например, альбумин), слитый с GLP-1 или аналогами (описание данных аналогов включено ссылкой в настоящий документ в качестве примеров аналогов GLP-1, которые можно применять в настоящем изобретении). В WO 05/003296, WO 03/060071, WO 03/059934 раскрыт аминослитый белок, где GLP-1 слит с альбумином с целью увеличения периода полувыведения этого гормона.

Однако, несмотря на эти усилия, не был получен GLP-1, сохраняющий активность в течение длительного промежутка времени.

По существу, особенно в области диабета и ожирения, существует колоссальная потребность в улучшенных GLP-1 пептидах или других агентах, которые аналогично имеют инсулинотропный эффект, пригодный для лечения, в частности, диабета и ожирения. Следовательно, существует потребность в модифицировании GLP-1 и других инсулинотропных пептидов для предоставления большей продолжительности действия in vivo при поддержании их низкой токсичности и терапевтических преимуществ.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Изобретение относится к слитым конструкциям лекарственного средства и конъюгатам лекарственного средства, которые имеют улучшенные периоды полувыведения в сыворотке. В одном аспекте, слитая конструкция лекарственного средства представляет собой непрерывную полипептидную цепь, имеющую формулу:

a-(X)n1-b-(Y)n2-c-(Z)n3-d или a-(Z)n3-b-(Y)n2-c-(X)n1-d,

где Х представляет собой полипептидное лекарственное средство, которое имеет связывающую специфичность в отношении первой мишени;

Y представляет собой вариабельный домен тяжелой цепи иммуноглобулина (VH), который имеет связывающую специфичность в отношении сывороточного альбумина, или вариабельный домен легкой цепи иммуноглобулина (VL), который имеет связывающую специфичность в отношении сывороточного альбумина;

Z представляет собой полипептидное лекарственное средство, которое имеет связывающую специфичность в отношении второй мишени;

каждое из а, b, с и d независимо отсутствует либо представляет собой от одного до примерно 100 аминокислотных остатков;

n1 равно от одного до примерно 10;

n2 равно от одного до примерно 10; и

n3 равно от нуля до примерно 10,

при условии, что, если оба n1 и n2 равны одному, а n3 равно нулю, Х не содержит цепь антитела или фрагмент цепи антитела.

В некоторых вариантах воплощения, Y содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26, или аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23. В конкретных вариантах воплощения, Х представляет собой GLP-1 или аналог GLP-1.

В другом аспекте, слитая конструкция лекарственного средства содержит непрерывную полипептидную цепь, причем указанная цепь содержит группировки X' и Y', где

X' представляет собой полипептидное лекарственное средство при условии, что X' не содержит цепь антитела или фрагмент цепи антитела; и

Y' представляет собой вариабельный домен тяжелой цепи иммуноглобулина (VH), который имеет связывающую специфичность в отношении сывороточного альбумина, или вариабельный домен легкой цепи иммуноглобулина (VL), который имеет связывающую специфичность в отношении сывороточного альбумина. В некоторых вариантах воплощения, Y' содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26, или аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23. В конкретных вариантах воплощения, X' представляет собой GLP-1 или аналог GLP-1.

В другом аспекте, изобретение представляет собой конъюгат лекарственного средства, содержащий вариабельный домен тяжелой цепи иммуноглобулина (VH), который имеет связывающую специфичность в отношении сывороточного альбумина, или вариабельный домен легкой цепи иммуноглобулина (VL), который имеет связывающую специфичность в отношении сывороточного альбумина, и лекарственное средство, которое ковалентно связано с указанным VH или VL. В некоторых вариантах воплощения, вариабельный домен тяжелой цепи иммуноглобулина содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26, или аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23. В конкретных вариантах воплощения, лекарственное средство представляет собой GLP-1 или аналог GLP-1.

В изобретении также предложены рекомбинантные нуклеиновые кислоты и конструкции, кодирующие слитые конструкции лекарственного средства, описанные в настоящем документе, и клетки-хозяева, содержащие рекомбинантные нуклеиновые кислоты и/или конструкции. В изобретении дополнительно предложен способ получения слитой конструкции лекарственного средства, включающий поддержание клетки-хозяина, которая содержит рекомбинантную нуклеиновую кислоту и/или конструкцию, которая кодирует слитую конструкцию лекарственного средства, описанную в настоящем документе, в условиях, пригодных для экспрессии указанной рекомбинантной нуклеиновой кислоты, посредством чего получают слитую конструкцию лекарственного средства.

В изобретении также предложены композиции (например, фармацевтические композиции), содержащие слитую конструкцию лекарственного средства или конъюгат лекарственного средства по изобретению. В изобретении также предложен способ лечения индивидуума, имеющего заболевание или расстройство, такое как таковое, описанное в настоящем документе, включающий введение указанному индивидууму терапевтически эффективного количества конъюгата лекарственного средства или слитой конструкции лекарственного средства по изобретению. В некоторых вариантах воплощения, заболевание или расстройство представляет собой воспалительное заболевание, такое как артрит (например, ревматоидный артрит). В дополнительном варианте воплощения, заболевание или расстройство представляет собой метаболическое заболевание, такое как диабет или ожирение. В изобретении также предложено применение конъюгата лекарственного средства или слитой конструкции лекарственного средства по изобретению для изготовления лекарства для лечения заболевания или расстройства, такого как воспалительное заболевание (например, артрит (например, ревматоидный артрит)) или диабет или ожирение. Изобретение также относится к применению слитой конструкции лекарственного средства или конъюгата лекарственного средства, как описано в настоящем документе, для применения в терапии, диагностике или профилактике.

В другом аспекте, изобретение представляет собой нековалентный конъюгат лекарственного средства, содержащий вариабельный домен тяжелой цепи иммуноглобулина (VH), который имеет связывающую специфичность в отношении сывороточного альбумина, или вариабельный домен легкой цепи иммуноглобулина (VL), который имеет связывающую специфичность в отношении сывороточного альбумина, и лекарственное средство, которое нековалентно связано с указанным VH или VL. В некоторых вариантах воплощения, вариабельный домен тяжелой цепи иммуноглобулина содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26, или аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23.

В дополнительном варианте воплощения, в изобретении предложен инактивированный вариант Dom7h-8, iDom7h-8, который не связывает сывороточный альбумин, который используют в качестве инструмента для исследования и который является предсказывающим вариантом для активного связывающего сывороточный альбумин Dom7h-8.

КРАТКОЕ ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ

На Фиг.1А представлено выравнивание аминокислотных последовательностей трех VK, выбранных путем связывания с сывороточным альбумином мышей (MSA). Выровненные аминокислотные последовательности принадлежат VK, обозначенным MSA 16, который также обозначают DOM7m-16 (SEQ ID NO:1), MSA 12, который также обозначают DOM7m-12 (SEQ ID NO:2), и MSA 26, который также обозначают DOM7m-26 (SEQ ID NO:3).

На Фиг.1 В представлено выравнивание аминокислотных последовательностей шести VK, выбранных путем связывания с сывороточным альбумином крыс (RSA). Выровненные аминокислотные последовательности принадлежат VK, обозначенным DOM7M (SEQ ID NO:4), DOM7r-3 (SEQ ID NO:5), DOM7r-4 (SEQ ID NO:6), DOM7r-5 (SEQ ID NO:7), DOM7r-7 (SEQ ID NO:8) и DOM7r-8 (SEQ ID NO:9).

На Фиг.1C представлено выравнивание аминокислотных последовательностей шести VK, выбранных путем связывания с сывороточным альбумином человека (HSA). Выровненные аминокислотные последовательности принадлежат VK, обозначенным DOM7h-2 (SEQ ID NO:10), DOM7h-3 (SEQ ID NO:11), DOM7h-4 (SEQ ID NO:12), DOM7h-6 (SEQ ID NO:13), DOM7h-1 (SEQ ID NO:14), DOM7h-7 (SEQ ID NO:15).

На Фиг.1D представлено выравнивание аминокислотных последовательностей семи VH, выбранных путем связывания с сывороточным альбумином человека и консенсусной последовательностью (SEQ ID NO:23). Выровненные аминокислотные последовательности принадлежат VK, обозначенным DOM7h-22 (SEQ ID NO:16), DOM7h-23 (SEQ ID NO:17), DOM7h-24 (SEQ ID NO:18), DOM7h-25 (SEQ ID NO:19), DOM7h-26 (SEQ ID NO:20), DOM7h-21 (SEQ ID NO:21) и DOM7h-27 (SEQ ID NO:22).

На Фиг.1Е представлено выравнивание аминокислотных последовательностей трех VK, выбранных путем связывания с сывороточным альбумином человека и сывороточным альбумином крыс. Выровненные аминокислотные последовательности принадлежат VK, обозначенным DOM7h-8 (SEQ ID NO:24), DOM7r-13 (SEQ ID NO:25) и DOM7r-14 (SEQ ID NO:26).

На Фиг.2А и 2 В представлены схематичные карты векторов, использованных для экспрессии слитых конструкций MSA16IL-1ra (также обозначаемой DOM7m-16/IL-1ra) и IL-1raMSA16 (также обозначаемой IL-1ra/DOM7m-16), соответственно.

На Фиг.2С-2D представлена нуклеотидная последовательность (SEQ ID NO:27), кодирующая слитую конструкцию IL-1raMSA16 (также обозначаемую IL-1ra/DOM7m-16), и аминокислотная последовательность (SEQ ID NO:28) слитой конструкции.

На Фиг.2Е-2F представлена нуклеотидная последовательность (SEQ ID NO:29), кодирующая слитую конструкцию MSA16IL-1ra (также обозначаемую DOM7m-16/IL-1ra), и аминокислотная последовательность (SEQ ID NO:30) слитой конструкции.

На Фиг.2G-2Н представлена нуклеотидная последовательность (SEQ ID NO:31), кодирующая слитую конструкцию DummyIL-1ra, которая не связывала сывороточный альбумин, и аминокислотная последовательность (SEQ ID NO:32) слитой конструкции.

Фиг.3А представляет собой иллюстрацию, показывающую, что IL-1 индуцирует производство IL-8 HeLa-клетками, и показывающую механизм обнаружения IL-8 методом ELISA.

Фиг.3 В представляет собой график, показывающий, что каждый из IL-1rа (♦), MSA16IL-1ra (▀) и IL-1raMSA16 (▲ ) ингибировал IL-1-индуцированную секрецию IL-8 культивированными MRC-5 клетками. Наблюдаемое ингибирование носило дозозависимый характер для IL-1ra, MSA16IL-1ra и IL-1raMSA16.

Фиг.4А-4С представляют собой графики, показывающие, что IL-1ra (♦), а также MSA16IL-1ra (▀) ингибировали IL-1-индуцированную секрецию IL-8 культивированными MRC-5 клетками в анализах, которые не включали сывороточный альбумин мышей (4А), включали 5% сывороточного альбумина мышей (4В) или 10% сывороточного альбумина мышей (4С). Наблюдаемое ингибирование носило дозозависимый характер для IL-1ra и MSA16IL-1ra во всех условиях тестирования.

На Фиг.5 схематично представлены результаты ELISA (метод твердофазного иммуноферментного анализа), демонстрирующие, что слитая конструкция MSA16IL-1ra, а также слитая конструкция IL-1raMSA16 связывали сывороточный альбумин, а слитая конструкция DummyIL-1ra не связывала.

На Фиг.6А-6С представлены сенсограммы и таблицы, показывающие данные сродства BIACORE для клона DOM7h-1, связывающего сывороточный альбумин человека (HSA) (6А), DOM7h-7, связывающего HSA (6В), и DOM7M, связывающего сывороточный альбумин крыс (RSA).

На Фиг.7 представлена таблица, показывающая сродство DOM7h-1, DOM7r-1, DOM7h-2, DOM7r-3, DOM7h-7, DOM7h-8, DOM7r-8, DOM7r-13, DOM7r-14, DOM7m-16, DOM7h-22, DOM7h-23, DOM7h-26, DOM7r-16, DOM7m-26, DOM7r-27 и DOM7R-31 к сывороточным альбуминам, которые они связывают.

На Фиг.8А представлена нуклеотидная последовательность (SEQ ID NO:33) нуклеиновой кислоты, кодирующей рецепторный антагонист человеческого интерлейкина-1 (IL-1ra), помещенный в GenBank под регистрационным номером NM_173842. Нуклеиновая кислота имеет открытую рамку считывания, стартующую в положении 65.

На Фиг.8В представлена аминокислотная последовательность человеческого IL-1ra (SEQ ID NO:34), кодируемого нуклеиновой кислотой, показанной на Фиг.8А (SEQ ID NO:33). Зрелый белок состоит из 152 аминокислотных остатков (аминокислотные остатки 26-177 из SEQ ID NO:34).

На Фиг.9 представлена графическая зависимость концентрации (мкг/мл) MSA-связывающего слитого белка с dAb/HA-эпитопной меткой в сыворотке мышей после однократной внутривенной (в/в) инъекции (доза составляла примерно 1,5 мг/кг) животным мужского пола штамма CD1 от времени (сутки). Сывороточную концентрацию определяли методом ELISA с использованием реактивов детекции захвата козлиных анти-НА (Abeam, UK) и протеин L-HRP (Invitrogen, USA). Стандартные кривые известных концентраций MSA-связывающей слитой конструкции dAb/HA устанавливали в присутствии 1х мышиной сыворотки для обеспечения сравнимости с тест-образцами. Моделирование при помощи однокомпартментной модели (WinNonlin Software, Pharsight Corp., USA) показало, что MSA-связывающий слитый белок с dAb/HA-эпитопной меткой имел конечную фазу t1/2, равную 29,1 часа, и площадь под кривой, равную 559 час-мкг/мл.

На Фиг.10 представлены аминокислотные последовательности VK, выбранных путем связывания с сывороточным альбумином крыс (RSA). Иллюстрированные последовательности принадлежат VK, обозначаемым DOM7r-15 (SEQ ID NO:37), DOM7r-16 (SEQ ID NO:38), DOM7M7 (SEQ ID NO:39), DOM7r-18 (SEQ ID NO:40), DOM7r-19 (SEQ ID NO:41).

На Фиг.11А-11В представлены аминокислотные последовательности VK, которые связывают сывороточный альбумин крыс (RSA). Иллюстрированные последовательности принадлежат VK, обозначаемым DOM7r-20 (SEQ ID NO:42), DOM7r-21 (SEQ ID NO:43), DOM7r-22 (SEQ ID NO:44), DOM7r-23 (SEQ ID NO:45), DOM7r-24 (SEQ ID NO:46), DOM7r-25 (SEQ ID NO:47), DOM7r-26 (SEQ ID NO:48), DOM7r-27 (SEQ ID NO:49), DOM7r-28 (SEQ ID NO:50), DOM7r-29 (SEQ ID NO:51), DOM7r-30 (SEQ ID NO:52), DOM7r-31 (SEQ ID NO:53), DOM7r-32 (SEQ ID NO:54), DOM7r-33 (SEQ ID NO:55).

На Фиг.12 представлена графическая зависимость концентрации (% от исходной дозы) DOM7m-16, DOM7m-26 или контрольного dAb, которое не связывает MSA, каждый из которых содержал НА-эпитопную метку, в сыворотке мышей после однократной внутривенной (в/в) инъекции (доза составляла примерно 1,5 мг/кг) животным мужского пола штамма CD1 от времени. Сывороточную концентрацию определяли методом ELISA с использованием реактивов детекции захвата козлиных анти-НА (Abeam, UK) и протеин L-HRP (Invitrogen, USA). Стандартные кривые известных концентраций MSA-связывающей слитой конструкции dAb/HA устанавливали в присутствии 1х мышиной сыворотки для обеспечения сравнимости с тест-образцами. Моделирование при помощи однокомпартментной модели (WinNonlin Software, Pharsight Corp., USA) показало, что контрольное dAb имело конечную фазу t1/2a, равную 20 минутам, в то время как DOM7m-16, DOM7m-26 оставались в сыворотке значительно дольше.

На Фиг.13 графически представлено, что DOM7m-16/IL-1ra был более эффективен, чем IL-1ra или ENBREL® (энтаресепт; Immunex Corporation) при лечении артрита в модели коллаген-индуцированного артрита (CIA) у мышей. Индуцировали артрит и, начиная с 21 суток, вводили мышам дексаметазон в количестве 0,4 мг/кг (стероид), DOM7m-16/IL-1ra в количестве 1 мг/кг (IL-1ra/анти-SA 1 мг/кг) или 10 мг/кг (IL-lra/aHTH-SA 10 мг/кг), IL-1ra в количестве 1 мг/кг или 10 мг/кг, ENBREL® (энтаресепт; Immunex Corporation) в количестве 5 мг/кг или физиологический раствор. Результаты показывают, что DOM7m-16/IL-1ra был более эффективен, чем IL-1ra или ENBREL® (энтаресепт; Immunex Corporation) в данном исследовании. Отклик на IL-1ra имел дозозависимый характер, как ожидалось, и отклик на DOM7m-16/IL-1ra являлся также дозозависимым. Средние показатели в случае лечения DOM7m-16/IL-1ra в количестве 1 мг/кг были сообразно ниже, чем средние показатели, полученные в случае лечения IL-1ra в количестве 10 мг/кг. Результаты показывают, что лечение DOM7m-16/IL-1ra было в 10 раз эффективнее, чем применение IL-1ra в данном исследовании.

На Фиг.14A-14G представлены аминокислотные последовательности сапориновых полипетидов. На Фиг.14А представлена аминокислотная последовательность предшественника сапорина-2, зарегистрированная как Swissprot Accession Number P27559 (SEQ ID NO:60). Сигнальный пептид представляет собой аминокислоты с 1 по 24 из SEQ ID NO:60. На Фиг.14 В представлена аминокислотная последовательность сапорина-3, зарегистрированная как Swissprot Accession Number P27560 (SEQ ID NO:61). На Фиг.14С представлена аминокислотная последовательность предшественника сапорина-4, зарегистрированная как Swissprot Accession Number P27561 (SEQ ID NO:62). Сигнальный пептид представляет собой аминокислоты с 1 по 24 из SEQ ID NO:62. На Фиг.14D представлена аминокислотная последовательность сапорина-5, зарегистрированная как Swissprot Accession Number Q41389 (SEQ ID NO:63). На Фиг.14Е представлена аминокислотная последовательность предшественника сапорина-6, зарегистрированная как Swissprot Accession Number P20656 (SEQ ID NO:64). Сигнальный пептид представляет собой аминокислоты с 1 по 24 из SEQ ID NO:64, и потенциальный пропептид представляет собой аминокислоты с 278 по 299 из SEQ ID NO:64. Зрелый полипептид представляет собой аминокислоты с 25 по 277 из SEQ ID NO:64 (SEQ ID NO:65). На Фиг.14F представлена аминокислотная последовательность сапорина-7, зарегистрированная как Swissprot Accession Number Q41391 (SEQ ID NO:66). На Фиг.14G представлена консенсусная аминокислотная последовательность, охватывающая несколько вариантов и изоформ сапорина-6 (SEQ ID NO:67).

На Фиг.15 представлены аминокислотные последовательности нескольких Camelid VHH, которые связывают сывороточный альбумин мышей, которые описаны в WO 2004/041862. Последовательность A (SEQ ID NO:72), Последовательность В (SEQ ID NO:73), Последовательность С (SEQ ID NO:74), Последовательность D (SEQ ID NO:75), Последовательность Е (SEQ ID NO:76), Последовательность F (SEQ ID NO:77), Последовательность G (SEQ ID NO:78), Последовательность H (SEQ ID NO:79), Последовательность I (SEQ ID NO:80), Последовательность J (SEQ ID NO:81), Последовательность К (SEQ ID NO:82), Последовательность L (SEQ ID NO:83), Последовательность М (SEQ ID NO:84), Последовательность N (SEQ ID NO:85), Последовательность О (SEQ ID NO:86), Последовательность Р (SEQ ID NO:87), Последовательность Q (SEQ ID NO:88).

На Фиг.16А представлена нуклеотидная последовательность, кодирующая [Pro9]GLP-1-Dom7h8 слитую конструкцию (SEQ ID NO:177), и аминокислотная последовательность слитой конструкции (SEQ ID NO:179).

На Фиг.16В представлена нуклеотидная последовательность, кодирующая [Pro9]GLP-1-PSS-Dom7h8 слитую конструкцию (SEQ ID NO:180), и аминокислотная последовательность слитой конструкции (SEQ ID NO:182).

На Фиг.16С представлена нуклеотидная последовательность, кодирующая [Pro9]GLP-l-PSSGAP- Dom7h8 слитую конструкцию (SEQ ID NO:183), и аминокислотная последовательность слитой конструкции (SEQ ID NO:185).

Фиг.17 представляет собой график, показывающий, что [Pro9]GLP-1-PSSGAP-Dom7h8 слитая конструкция (□) имела эквивалентную дозозависимую активность клеточной пролиферации к GLP-1 контролю, (▲), Эксендин-4 (▼). Базальный зеро контроль показан (♦).

Фиг.18 представляет собой график, показывающий, что [Pro9]GLP-1-PSSGAP-Dom7h8 слитая конструкция (□) имела эквивалентное дозозависимое высвобождение инсулина к GLP-1 контролю, (▲), Эксендин-4 (▼). Базальный зеро контроль показан (♦).

На Фиг.19А-19С представлена аминокислотная последовательность Dom7h-8 PYY (3-36) (SEQ ID NO:186), PYY (3-36). Dom7h-8 (SEQ ID NO:187) и [Pro9]GLP-1(3-27)-Dom7h-8 PYY (3-36) (SEQ ID NO:188) слитых конструкций соответственно.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

В данном описании варианты воплощения были описаны таким образом, чтобы создать четкое и ясное описание, однако подразумевается и следует понимать, что варианты воплощения можно различным образом объединять или разъединять без отклонения от объема изобретения.

Как использовано в настоящем описании, «лекарственное средство» относится к любому соединению (например, небольшая органическая молекула, нуклеиновая кислота, полипептид), которую можно ввести индивидууму для получения выгодного терапевтического или диагностического эффекта посредством связывания с и/или изменения функции биологической молекулы-мишени у индивидуума. Молекула-мишень может представлять собой эндогенную молекулу-мишень, кодируемую геномом индивидуума (например, фермент, рецептор, фактор роста, цитокин, кодируемый геномом индивидуума), или экзогенную молекулу-мишень, кодируемую геномом патогена (например, фермент, кодируемый геномом вируса, бактерии, гриба, нематоды или другого патогена).

Как использовано в настоящем описании, термин «основа лекарственного средства» относится к видам активности композиций лекарственного средства и лекарственных средств, которые нормализованы исходя их количества лекарственного средства (или лекарственной группировки), использованной для того, чтобы оценить, измерить или установить активность. Как правило, композиции лекарственного средства по изобретению (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) имеют большую молекулярную массу, чем лекарственное средство, которое они содержат. Таким образом, эквивалентные количества композиции лекарственного средства и лекарственного средства, по массе, будут содержать разные количества лекарственного средства на молекулярной или молярной основе. Например, если композиция лекарственного средства по изобретению имеет молекулярную массу вдвое большую, чем молекулярная масса лекарственного средства, которое она содержит, виды активности можно устанавливать на основе «основы лекарственного средства», используя 2 мкг композиции лекарственного средства и 1 мкг лекарственного средства, поскольку указанные количества содержали бы одинаковые количества лекарственного средства (в виде свободного лекарственного средства или в виде части композиции лекарственного средства). Виды активности можно нормализовать и выразить на основе «основы лекарственного средства» с использованием подходящих расчетов, например, выражая активность на основе сайта, связывающего мишень, или, для ферментативных лекарственных средств, на основе активного сайта.

Как использовано в настоящем описании, «композиция лекарственного средства» относится к композиции, содержащей лекарственное средство, которое ковалентно или нековалентно связано с полипептидсвязывающей группировкой, где полипептидсвязывающая группировка содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. Композиция лекарственного средства может представлять собой конъюгат, где лекарственное средство ковалентно или нековалентно связано с полипептидсвязывающей группировкой. Лекарственное средство может быть ковалентно или нековалентно связано с полипептидсвязывающей группировкой прямым или непрямым образом (например, через подходящий линкер и/или нековалентное связывание комплементарных связывающих партнеров (например, биотина и авидина)). Если применяют комплементарные связывающие партнеры, один из связывающих партнеров может быть ковалентно связан с лекарственным средством напрямую или через подходящую линкерную группировку, и комплементарный связывающий партнер может быть ковалентно связан с полипептидсвязывающей группировкой напрямую или через подходящую линкерную группировку. Если лекарственное средство представляет собой полипептид или пептид, композиция лекарственного средства может представлять собой слитый белок, где полипептидное или пептидное лекарственное средство и полипептидсвязывающая группировка являются раздельными частями (группировками) непрерывной полипептидной цепи.

Как использовано в настоящем описании, «конъюгат» относится к композиции, содержащей антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, и который связан с лекарственным средством. Такие конъюгаты включают «конъюгаты лекарственного средства», которые содержат антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, с которым ковалентно связано лекарственное средство, и «нековалентные конъюгаты лекарственного средства», которые содержат антигенсвязывающий фрагмент антитела, который связывает сывороточный альбумин, с которым нековалентно связано лекарственное средство.

Как использовано в настоящем описании, «конъюгат лекарственного средства» относится к композиции, содержащей антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, с которым ковалентно связано лекарственное средство. Лекарственное средство может быть ковалентно связано с антигенсвязывающим фрагментом напрямую или непрямым путем через подходящую линкерную группировку. Лекарственное средство может быть связано с антигенсвязывающим фрагментом в любом подходящем положении, таком как аминоконец, карбоксиконец или через подходящие аминокислотные боковые цепочки (например, е аминогруппа лизина или тиольная группа цистеина).

Как использовано в настоящем описании, «нековалентный конъюгат лекарственного средства» относится к композиции, содержащей антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, с которым нековалентно связано лекарственное средство. Лекарственное средство может быть нековалентно связано с антигенсвязывающим фрагментом напрямую (например, электростатическое взаимодействие, гидрофобное взаимодействие) или непрямым путем (например, через нековалентное связывание комплементарных связывающих партнеров (например, биотина и авидина), где один партнер ковалентно связан с лекарственным средством, и комплементарный связывающий партнер ковалентно связан с антиген-связывающим фрагментом). Если применяют комплементарные связывающие партнеры, один из связывающих партнеров может быть ковалентно связан с лекарственным средством напрямую или через подходящую линкерную группировку и комплементарный связывающий партнер может быть ковалентно связан с антигенсвязывающим фрагментом антитела, которое связывает сывороточный альбумин, напрямую или через подходящую линкерную группировку.

Как использовано в настоящем описании, «слитая конструкция лекарственного средства» относится к слитому белку, который содержит антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, и полипептидное лекарственное средство. Антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, и полипептидное лекарственное средство присутствуют в виде раздельных частей (группировок) одной непрерывной полипептидной цепи.

Термин «альбуминсвязывающий остаток», как использовано в настоящем описании, означает остаток, который связывается нековалентно с человеческим сывороточным альбумином. Альбуминсвязывающий остаток, присоединенный к терапевтическому полипептиду, обычно имеет сродство менее 10 мкМ к человеческому сывороточному альбумину и, предпочтительно, менее 1 пМ. В одном варианте воплощения, известен ряд альбуминсвязывающих остатков среди линейных и разветвленных липофильных группировок, содержащих 4-40 углеродных атомов, соединений с циклопентанофенантреновым скелетом, пептидов, имеющих 10-30 аминокислотных остатков и т.д.

Как использовано в настоящем описании, «рецепторный антагонист интерлейкина-1» (IL-1ra) относится к природным или эндогенным IL-1ra белкам млекопитающих и к белкам, имеющим аминокислотную последовательность, которая является той же самой, что и аминокислотная последовательность у природного или эндогенного соответствующего белка IL-1ra млекопитающих (например, рекомбинантные белки, синтетические белки (т.е. полученные методами синтетической органической химии)). Соответственно, как указано в настоящем описании, термин включает зрелый белок, полиморфные или аллельные варианты и другие изоформы IL-1ra (например, полученные путем альтернативного сплайсинга или другими клеточными процессами), а также модифицированные или немодифицированные формы вышеназванного (например, с присоединенными липидами, гликозилированные, пэгилированные). Природные или эндогенные IL-1ra включают белки дикого типа, такие как зрелый IL-1ra, полиморфные или аллельные варианты и другие изоформы, которые встречаются в природе у млекопитающих (например, у человека, приматов кроме человека). Такие белки можно извлечь или выделить из источника, который, например, продуцирует IL-1ra в природе. Данные белки и IL-1ra белки, имеющие такую же аминокислотную последовательность, как природные или эндогенные соответствующие IL-1ra, обозначают по названию соответствующего млекопитающего. Например, если соответствующее млекопитающее представляет собой человека, белок обозначают как человеческий IL-1ra.

«Функциональные варианты» IL-1ra включают функциональные фрагменты, функциональные мутантные белки и/или функциональные слитые белки, которые можно получить с применением подходящих способов (например, мутагенез (например, химический мутагенез, радиационный мутагенез), методики рекомбинантных ДНК). «Функциональный вариант» противодействует рецептору типа 1 интерлейкина-1. Как правило, фрагменты или участки IL-1ra включают таковые, имеющие делецию и/или добавление (т.е. одну или более делеций и/или добавлений аминокислоты) аминокислоты (т.е. одна или более аминокислот) относительно зрелого IL-1ra (такие как N-концевые, С-концевые или внутренние делеций). Предусматриваются также фрагменты или участки, в которых были удалены только смежные аминокислоты или в которых были удалены несмежные аминокислоты относительно зрелого IL-1ra. Функциональный вариант человеческого IL-1ra может иметь по меньшей мер, примерно 80%, или по меньшей мере примерно 85%, или по меньшей мере примерно 90%, или по меньшей мере примерно 95%, или по меньшей мере примерно 96%, или по меньшей мере примерно 97%, или по меньшей мере примерно 98%, или по меньшей мере примерно 99% идентичности аминокислотной последовательности с зрелой формой человеческого IL-1ra, состоящей из 152 аминокислот, и противодействует рецептору типа 1 человеческого интерлейкина-1. (См. Eisenberg et al., Nature 343:341-346 1990). Вариант может содержать одну или более дополнительных аминокислот (например, содержать 153, или 154, или более аминокислот). Например, вариант IL-1ra может иметь аминокислотную последовательность, которая состоит из аминоконцевого метионинового остатка, за которым следуют остатки от 26 до 177 из SEQ ID NO:33. (KINERET® (anakinra), Amgen).

Как использовано в настоящем описании, термин «примерно» является возможным, но, предпочтительно, интерпретируется как означающий плюс или минус 20%, более предпочтительно, плюс или минус 10%, еще более предпочтительно, плюс или минус 5%, еще более предпочтительно, плюс или минус 2%, наиболее предпочтительно, плюс или минус 1%.

Термин «аналог», как использовано в настоящем описании, относящийся к полипептиду, означает модифицированный полипептид, где один или более аминокислотных остатков пептида были замещены другими аминокислотными остатками, и/или где один или более аминокислотных остатков пептида были удалены из пептида, и/или где один или более аминокислотных остатков пептида были удалены из пептида, и/или где один или более аминокислотных остатков пептида были добавлены к пептиду. Такое добавление или удаление аминокислотных остатков может произойти на N-конце пептида и/или на С-конце пептида, или они могут произойти внутри пептида. Используют простую систему для описания аналогов GLP-1: Например, [Arg34] GLP-1 (7-37) Lys обозначает аналог GLP-1, где природный лизин в положении 34 был замещен аргинином, и остаток лизина был добавлен к С-концу (положение 38). Формулы аналогов пептида и его производных рисуют с использованием стандартных единичных буквенных аббревиатур для аминокислот, используемых согласно номенклатуре IUPAC-IUB.

Термин «GLP-1 пептид», как использовано в настоящем описании, означает GLP-1 (7-37) (SEQ ID NO:158) или GLP-1 (7-36) (SEQ ID NO:159), аналог GLP-1, производное GLP-1 или производное аналога GLP-1. Такие пептиды, аналоги и производные представляют собой инсулинотропные агенты.

Термин «инсулинотропный агент», как использовано в настоящем описании, означает соединение, которое способно стимулировать, или вызывать стимулирование, синтез, или экспрессию, или активность гормона инсулина. Известные примеры инсулинотропных агентов включают, но не ограничены, глюкозу, GIP (глюкозозависимый инсулинотропный пептид), GLP, Эксендин и ОХМ (оксинтомодулин).

Термин «инкретин», как использовано в настоящем описании, означает тип желудочно-кишечного гормона, который вызывает увеличение количества инсулина, высвобождаемого, когда уровни глюкозы являются нормальными, или, особенно, когда они повышены. В качестве примера, они включают GLP-1, GIP и ОХМ.

Термин «пептид Эксендин-4», как использовано в настоящем описании, означает Эксендин-4 (1-39), аналог Эксендин-4, производное Эксендин-4 или производное аналога Эксендин-4. В одном варианте воплощения, Эксендин-4 пептид представляет собой инсулинотропный агент. Такие пептиды, аналоги и производные представляют собой инсулинотропные агенты.

Термин «DPP-IV-защищенный», как использовано в настоящем описании, относящийся к полипептиду, означает полипептид, который был модифицирован (например, химически модифицирован), чтобы сделать указанное соединение устойчивым к пептидазе плазмы дипептидиламинопептидаза-4 (DPP-IV). DPP-IV фермент в плазме, как известно, вовлечен в разрушение нескольких пептидных гормонов, например, GLP-1, GLP-2 и т.д. Таким образом, прикладываются серьезные усилия к разработке аналогов и производных полипептидов, подверженных DPP-IV-опосредованному гидролизу, чтобы уменьшить скорость и/или степень разрушения под действием DPP-IV.

Как использовано в настоящем описании, «сапорин» относится к семейству одноцепочечных полипептидов, инактивирующих рибосому, продуцируемых растением Saponaria officinalis. (Stirpe, F., et al., Biochem. J. 216:617-625 (1983), Bagga, S. et al., J. Biol. Chem. 278:4813-4820 (2003).) Сапориновые полипептиды существуют в нескольких формах, которые отличаются по длине и/или аминокислотной последовательности. (См., например, Id. and Barthelemy, L et al., J. Biol. Chem. 268:6541-6548 (1993).) Сапорин-6 является наиболее активной формой сапорина. (Bagga, S. et al., J. Biol. Chem. 278:4813-4820 (2003).) Описаны, по меньшей мере, четыре встречающиеся в природе изоформы сапорина-6, в которых аминокислота в положении 48 зрелого полипептида (SEQ ID NO:65) представляет собой Asp или Glu, и аминокислота в положении 91 зрелого полипептида (SEQ ID NO:65) представляет собой Arg или Lys (Barthelemy, L et al., J. Biol. Chem. 268:6541-6548 (1993).) Дополнительные формы сапорина-6 включают полипептиды, в которых аминокислота в положении 99 зрелого полипептида (SEQ ID NO:65) представляет собой Ser или Leu; аминокислота в положении 134 зрелого полипептида (SEQ ID NO:65) представляет собой Gln или Lys; аминокислота в положении 147 зрелого полипептида (SEQ ID NO:65) представляет собой Ser или Leu; аминокислота в положении 149 зрелого полипептида (SEQ ID NO:65) представляет собой Ser или Phe; аминокислота в положении 162 зрелого полипептида (SEQ ID NO:65) представляет собой Asp или Asn; аминокислота в положении 177 зрелого полипептида (SEQ ID NO:65) представляет собой Ala или Val; аминокислота в положении 188 зрелого полипептида (SEQ ID NO:65) представляет собой Ilе или Thr; аминокислота в положении 196 зрелого полипептида (SEQ ID NO:65) представляет собой Asn или Asp; аминокислота в положении 198 зрелого полипептида (SEQ ID NO:65) представляет собой Glu или Asp; аминокислота в положении 231 зрелого полипептида (SEQ ID NO:65) представляет собой Asn или Ser, и полипептиды, в которых аминокислота в положении 233 зрелого полипептида (SEQ ID NO:65) представляет собой Lys или Аrg. Консенсусная последовательность, охватывающая данные изоформы и варианты, представлена на Фиг.14G (SEQ ID NO:67).

Соответственно, термин «сапорин» включает белок-предшественник, зрелый полипептид, нативный белок, полиморфные или аллельные варианты и другие изоформы (например, продуцированные альтернативным сплайсингом или другими клеточными процессами), а также модифицированные или немодифицированные формы вышеупомянутого (например, с присоединенными липидами, гликозилированные, пэгилированные). Природный или эндогенный сапорин включают белки дикого типа, такие как зрелый сапорин (например, зрелый сапорин-6), полиморфные или аллельные варианты и другие изоформы, которые встречаются в природе в Saponaria officinalis. Такие белки можно извлекать или выделять из Saponaria officinalis, применяя любые подходящие способы. «Функциональные варианты» сапорина включают функциональные фрагменты, функциональные мутантные белки и/или функциональные слитые белки, которые можно получить, применяя подходящие способы (например, мутагенез (например, химический мутагенез, радиационный мутагенез), методики рекомбинантных ДНК). Как правило, фрагменты или участки сапорина (например, сапорина-6) включают таковые, имеющие делецию и/или добавление (т.е. одну или более делеций и/или добавлений аминокислоты) аминокислоты (т.е. одна или более аминокислот) относительно зрелого сапорина (такие как N-концевые, С-концевые или внутренние делеций). Предусматриваются также фрагменты или участки, в которых были удалены только смежные аминокислоты или в которых были удалены несмежные аминокислоты относительно зрелого сапорина. Можно получить множество функциональных вариантов сапорина. Например, были получены слитые белки сапорина-6, которые содержат аминоконцевые удлинения и, как показано, которые сохраняют полностью рибосом-ингибирующую активность в методе анализа кроличьего ретикулоцитного лизата. (Barthelemy, L. et al., J. Biol. Chem. 268:6541-6548 (1993).) Варианты сапорина-6, в которых остаток активного сайта, Тyr72, Тyr120, Glu176, Arg179 или Тrp208 (аминокислоты 72, 120, 176, 179 или 208 из SEQ ID NO:65) был заменен на аланин, имели сниженную цитотоксическую активность в in vitro анализах. (Bagga, S. et al., J. Biol. Chem. 278:4813-4820 (2003).) Соответственно, если желательно получить дополнительные функциональные варианты сапорина, следует избегать мутации, замещения, замены, удаления или модификации остатков активного сайта. Предпочтительно, функциональный вариант сапорина, который содержит меньше аминокислот, чем природный зрелый полипептид, включает, по меньшей мере, активный сайт. Например, вариант сапорина-6, который содержит меньше аминокислот, чем природный зрелый сапорин-6, может включать остатки активного сайта зрелого сапорина-6 (Tyr72, Tyr120, Glu176, Arg179 и Тrp208 (аминокислоты 72, 120, 176, 179 и 208 из SEQ ID NO:65)) и составлять, по меньшей мере, примерно 137 аминокислот в длину, по меньшей мере, примерно 150 аминокислот в длину, по меньшей мере, примерно 175 аминокислот в длину, по меньшей мере, примерно 200 аминокислот в длину, по меньшей мере, примерно 225 аминокислот в длину, или, по меньшей мере, примерно 250 аминокислот в длину.

«Функциональный вариант» сапорина имеет рибосома-инактивирующую активность (например, rРНК N-гликозидазную активность) и/или цитотоксическую активность. Такую активность можно легко оценить с использованием любого подходящего метода, такого как ингибирование белкового синтеза, используя хорошо известный метод анализа кроличьего ретикулоцитного лизата или любой из хорошо известных методов анализа цитотоксичности, в которых применяют раковые клеточные линии. (См., например, Bagga, S. et al., J. Biol. Chem. 278:4813-4820 (2003) и Barthelemy, L. et al., J. Biol. Chem. 268:6541-6548 (1993).)

В некоторых вариантах воплощения, функциональный вариант сапорина имеет, по меньшей мере, примерно 80%, или, по меньшей мере, примерно 85%, или, по меньшей мере, примерно 90%, или, по меньшей мере, примерно 91%, или, по меньшей мере, примерно 92%, или, по меньшей мере, примерно 93%, или, по меньшей мере, примерно 94%, или, по меньшей мере, примерно 95%, или, по меньшей мере, примерно 96%, или, по меньшей мере, примерно 97%, или, по меньшей мере, примерно 98%, или, по меньшей мере, примерно 99% идентичности аминокислотной последовательности с зрелым сапорином-6 (SEQ ID NO:65).

Изобретение относится к композициям, которые содержат лекарственное средство и полипептидсвязывающую группировку, которая содержит антигенсвязывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. Как подробно описано в настоящей заявке в отношении композиций, которые содержат антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина, лекарственное средство и связывающий полипептид могут быть конъюгированы ковалентно или нековалентно. В некоторых вариантах воплощения, композиция представляет собой слитый белок, который содержит полипептидное лекарственное средство и полипептидсвязывающую группировку, которая содержит антигенсвязывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. В других вариантах воплощения, композиция содержит лекарственное средство, которое ковалентно или нековалентно связано с полипептидсвязывающей группировкой, которая содержит антигенсвязывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo.

Изобретение относится к композициям лекарственных средств, которые содержат лекарственное средство и полипептидсвязывающую группировку, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. Как подробно описано в настоящей заявке в отношении композиций лекарственных средств, которые содержат антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина, лекарственное средство и полипептидсвязывающая группировка могут быть связаны друг с другом ковалентно или нековалентно. В некоторых вариантах воплощения, композиция лекарственного средства представляет собой слитый белок, который содержит полипептидное лекарственное средство и полипептидсвязывающую группировку, которая содержит антигенсвязывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. В других вариантах воплощения, композиция лекарственного средства содержит лекарственное средство, которое ковалентно или нековалентно связано с полипептидсвязывающей группировкой, которая содержит антигенсвязывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo.

Обычно полипептид, который увеличивает период полувыведения в сыворотке in vivo, представляет собой полипептид, который встречается в природе in vivo и который устойчив к деградации или удалению эндогенными механизмами, которые удаляют нежелательный материал из организма (например, человека). Например, полипептид, который увеличивает период полувыведения в сыворотке in vivo, можно выбрать из белков внеклеточного матрикса, белков, обнаруженных в крови, белков, обнаруженных в гематоэнцефалическом барьере или в нервной ткани, белков, локализованных в почках, печени, легких, сердце, коже или костной ткани, стресс-белков, заболевание-специфических белков или белков, вовлеченных в Fc транспорт.

Подходящие полипептиды, которые увеличивают период полувыведения в сыворотке in vivo, включают, например, слитые белки лиганд-нейрофармацевтического агента, специфического к трансферриновым рецепторам (см. Патент США. №5977307, содержание которого включено в настоящий документ посредством ссылки), рецептор капиллярной эндотелиальной клетки мозга, трансферрин, трансферриновый рецептор (например, растворимый трансферриновый рецептор), инсулин, рецептор инсулиноподобного фактора роста 1 (IGF 1), рецептор инсулиноподобного фактора роста 2 (IGF 2), инсулиновый рецептор, фактор свертывания крови X, α1-антитрипсин и HNF 1α. Подходящие полипептиды, которые увеличивают период полувыведения в сыворотке, включают также альфа-1 гликопротеид (оросомукоид; AAG), альфа-1 антихимотрипсин (ACT), альфа-1 микроглобулин (протеин НС; AIM), антитромбин III (AT III), аполипопротеин А-1 (Аро А-1), аполипопротеин В (Аро В), церулоплазмин (Ср), компонент комплемента С3 (С3), компонент комплемента С4 (С4), С1 ингибитор эстеразы (С1 INH), С-реактивный белок (CRP), ферритин (FER), гемопексин (НРХ), липопротеид(а) (Lp(a)), маннозасвязывающий белок (МБР), миоглобин (Муо), преальбумин (транстиретин; PAL), ретинолсвязываюший белок (RBP) и ревматоидный фактор (RF).

Подходящие белки из внеклеточного матрикса включают, например, коллагены, ламинины, интегрины и фибронектин. Коллагены представляют собой основные белки внеклеточного матрикса. В настоящее время известно примерно 15 типов коллагеновых молекул, обнаруженных в различных частях организма, например, коллаген I типа (составляющий 90% коллагена организма), обнаруженный в костной ткани, коже, сухожилиях, связках, роговице, внутренних органах, или коллаген II типа, обнаруженный в хрящах, вертебральных дисках, хорде и глазном стекловидном теле.

Подходящие белки из крови включают, например, белки плазмы (например, фибрин, α-2 макроглобулин, сывороточный альбумин, фибриноген (например, фибриноген А, фибриноген В), сывороточный амилоидный белок А, гаптоглобулин, профилин, убиквитин, утероглобулин и α-2-микроглобулин), ферменты и ингибиторы ферментов (например, плазминоген, лизоцим, цистатин С, альфа-1-антитрипсин и панкреатический ингибитор трипсина), белки иммунной системы, такие как иммуноглобулиновые белки (например, IgA, IgD, IgE, IgG, IgM, легкие цепи иммуноглобулина (каппа/лямбда)), транспортные белки (например, ретинолсвязывающий белок, α-1 микроглобулин), дефенсины (например, бета-дефенсин 1, нейтрофильный дефенсин 1, нейтрофильный дефенсин 2 и нейтрофильный дефенсин 3) и тому подобное.

Подходящие белки, обнаруженные в гематоэнцефалическом барьере или в нервной ткани, включают, например, меланокортиновый рецептор, миелин, аскорбатный транспортер и тому подобное.

Подходящие полипептиды, которые увеличивают период полувыведения в сыворотке in vivo, также включают белки, локализованные в почках (например, полицистин, коллаген IV типа, К1 транспортер органического иона, антиген Хейманна), белки, локализованные в печени (например, алкоголь десидрогеназа, G250), белки, локализованные в легких (например, секреторный компонент, который связывает IgA), белки, локализованные в сердце (например, HSP 27, который связан с дилатационной кардиомиопатией), белки, локализованные в коже (например, кератин), белки, специфические для костной ткани, такие как морфогенетические белки (BMPs), которые представляют собой подкласс надсемейства белков, трансформирующих фактор роста Р, которые проявляют остеогенную активность (например, BMP-2, BMP-4, BMP-5, BMP-6, BMP-7, BMP-8), специфические белки новообразований (например, трофобластный антиген, герцептиновый рецептор, эстрогеновый рецептор, катепсины (например, катепсин В, который можно обнаружить в печени и селезенке)).

Подходящие заболевание-специфические белки включают, например, антигены, экспрессированные только на активированных Т-клетках, включая LAG-3 (ген активации лимфоцитов), лиганд остеопротегерина (OPGL; см. Nature 402, 304-309 (1999)), 0Х40 (член семейства TNF рецепторов, экспрессируемых на активированных Т-клетках и специфически активируемых в клетках-хозяевах Т-лимфотропного человеческого вируса первого типа (HTLV-I); см. Immunol. 165 (1):263-70 (2000)). Подходящие заболевание-специфические белки также включают, например, металлопротеазы (связанные с артритом/раком), включая CG6512 Drosophila, человеческий параплегин, человеческий FtsH, человеческий AFG3L2, мышиный ftsH, и ангиогенные факторы роста, включая кислотный фактор роста фибробластов (FGF-1), основной фактор роста фибробластов (FGF-2), васкулярный эндотелиальный фактор роста/васкулярный фактор проницаемости (VEGF/VPF), трансформирующий фактор роста-α (TGF-а), фактор-альфа некроза опухоли (TNF-α), ангиогенин, интерлейкин 3 (IL-3), интерлейкин 8 (IL-8), тромбоцитарный эндотелиальный фактор роста (PD-ECGF), плацентарный фактор роста (P1GF), димерная изоформа ВВ тромбоцитарного фактора роста (PDGF) и фракталкин.

Подходящие полипептиды, которые увеличивают период полувыведения в сыворотке in vivo, также включают стресс-белки, такие как белки теплового шока (HSPs). HSPs обычно обнаруживают внутри клеток. Когда их находят внеклеточно, то это является показателем того, что клетка умерла и выделила наружу свое содержимое. Эта непрограммируемая клеточная смерть (некроз) происходит, когда, в результате травмы, заболевания или повреждения, внеклеточные HSPs запускают ответ со стороны иммунной системы. Связывание с внеклеточным HSP может приводить к локализации композиции по изобретению в сайте заболевания.

Подходящие белки, вовлеченные в Fc перенос, включают, например, рецептор Brambell (также известный, как FcRB). Этот Fc рецептор имеет две функции, обе из которых потенциально полезны для доставки. Функции представляют собой (1) перенос IgG от матери к ребенку через плаценту и (2) защиту IgG от деградации, таким образом, удлиняя его период полувыведения в сыворотке. Считается, что рецептор рециркулирует IgG от эндосом. (См., Holliger etal., Nat Biotechnol 15(7):632-6 (1997).)

Композиции лекарственного средства по изобретению могут содержать любую полипептидсвязывающую группировку, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. Предпочтительно, полипептидсвязывающая группировка содержит, по меньшей мере, 31, по меньшей мере, примерно 40, по меньшей мере, примерно 50, по меньшей мере, примерно 60, по меньшей мере, примерно 70, по меньшей мере, примерно 80 аминокислот, по меньшей мере, примерно 90 аминокислот, по меньшей мере, примерно 100 аминокислот или, по меньшей мере, примерно 110 аминокислот в виде отдельной молекулярной структуры. Предпочтительно, полипептидсвязывающая группировка связывает полипептид, который увеличивает период полувыведения в сыворотке in vivo, с KD, по меньшей мере, примерно 5 мМ KD (KD=Koff(kd)/Kon(ka)). В некоторых вариантах воплощения, полипептидсвязывающая группировка связывает полипептид, который увеличивает период полувыведения в сыворотке in vivo, с KD от примерно 10 до примерно 100 нМ, или от примерно 100 нМ до примерно 500 нМ, или от примерно 500 нМ до примерно 5 мМ, как определено методом поверхностного плазменного резонанса (например, используя прибор BIACORE). В конкретных вариантах воплощения, полипептидсвязывающая группировка связывает полипептид, который увеличивает период полувыведения в сыворотке in vivo, с KD примерно 50 нМ, или примерно 70 нМ, или примерно 100 нМ, или примерно 150 нМ, или примерно 200 нМ.

Предпочтительно, полипептидсвязывающая группировка, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, не является прокариотическим или бактериальным полипептидом или пептидом. Предпочтительно, полипептидсвязывающая группировка представляет собой полипептид или пептид эукариотической клетки, млекопитающего или человека.

В конкретных вариантах воплощения, полипептидсвязывающая группировка, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, представляет собой домен свернутого белка. В других вариантах воплощения, полипептидсвязывающая группировка имеет молекулярную массу, по меньшей мере, примерно 4 кДа, по меньшей мере, примерно, 4,5 кДа, по меньшей мере, примерно, 5 кДа, по меньшей мере, примерно, 5,5 кДа, по меньшей мере, примерно, 6 кДа, по меньшей мере, примерно, 6,5 кДа, по меньшей мере, примерно, 7 кДа, по меньшей мере, примерно, 7,5 кДа или, по меньшей мере, примерно, 8 кДа, как отдельная молекулярная структура.

Подходящие полипептидсвязывающие группировки, которые содержат связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, можно идентифицировать любым подходящим способом, таким как скрининг природных или не встречающихся в природе полипептидов в подходящем методе анализа адгезии. Как описано в настоящем документе, предпочтительные полипептидсвязывающие группировки, которые имеют антигенсвязывающий сайт для полипептида, который увеличивает период полувыведения в сыворотке in vivo, представляют собой антигенсвязывающие фрагменты антител, которые имеют связывающую специфичность в отношении сывороточного альбумина. Однако в изобретении можно применять антигенсвязывающие фрагменты антител, которые имеют связывающую специфичность в отношении других полипептидов, которые увеличивают период полувыведения в сыворотке in vivo.

При желании, один или более гипервариабельных участков (CDR) антитела или его антигенсвязывающего фрагмента, который связывает полипептид, который увеличивает период полувыведения в сыворотке in vivo, может быть сформатирован в неиммуноглобулиновую структуру, которая сохраняет антигенсвязывающую специфичность антитела или антигенсвязывающего фрагмента. Композиции лекарственного средства по изобретению могут содержать такую неиммуноглобулиновую связывающую группировку. Такие неиммуноглобулиновые связывающие группировки можно получить с использованием любого подходящего способа, например, природные бактериальные рецепторы, такие как SpA, были использованы в качестве структурных каркасов для пересадки CDR, чтобы произвести полипептидсвязывающие группировки, которые специфически связывают эпитоп. Детали этой методики описаны в Заявке на Патент США №5831012, содержание которой включено в настоящий документ посредством ссылки. Другие подходящие структурные каркасы включают таковые, основанные на фибронектине и аффителах. Детали подходящих методик описаны в WO 98/58965. Другие подходящие структурные каркасы включают липокаллин и CTLA4, как описано в van den Beuken et al., J. Mol. Biol. 310:591-601 (2001), и структурные каркасы, такие как таковые, описанные в WO 00/69907 (Medical Research Council), которые основаны, например, на кольцевой структуре бактериального GroEL или других шаперонных полипептидов.

В некоторых вариантах воплощения, композиция лекарственного средства по изобретению содержит неиммуноглобулиновую связывающую группировку, которая имеет связывающую специфичность в отношении сывороточного альбумина, где неиммуноглобулиновая связывающая группировка содержит один, два или три из CDR из VH, VK или VHH, описанных в настоящем документе, и подходящий структурный каркас. В конкретных вариантах воплощения, неиммуноглобулиновая связывающая группировка содержит CDR3, но не CDR1 или CDR2 из VH, VK или VHH, описанных в настоящем документе, и подходящий структурный каркас. В других вариантах воплощения, неиммуноглобулиновая связывающая группировка содержит CDR1 и CDR2, но не CDR3 из VH, VK или VHH, описанных в настоящем документе, и подходящий структурный каркас. В других вариантах воплощения, неиммуноглобулиновая связывающая группировка содержит CDR1, CDR2 и CDR3 из VH, VK или VHH, описанных в настоящем документе, и подходящий структурный каркас. В других вариантах воплощения, композиция лекарственного средства содержит только CDR3 из VH, VK или VHH, описанных в настоящем документе, и лекарственное средство.

Композиции лекарственного средства по изобретению можно получить с использованием подходящих способов, таких как способы, описанные в настоящем документе для получения слитых конструкций лекарственного средства, конъюгатов лекарственного средства и нековалентных конъюгатов лекарственного средства. Дополнительно, композиции лекарственного средства по изобретению имеют преимущества и свойства, которые подробно описаны в настоящем документе в отношении слитых конструкций лекарственного средства, конъюгатов лекарственного средства и нековалентных конъюгатов лекарственного средства.

В изобретении предложены композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), которые имеют улучшенные фармакокинетические свойства (например, увеличение периода полувыведения в сыворотке) и другие преимущества по сравнению с отдельным лекарственным средством (неконъюгированное лекарственное средство, неслитое лекарственное средство). Конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства и слитые конструкции лекарственного средства содержат антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина, и одно или более желаемых лекарственных средств.

Как описано в настоящем документе, композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства) по изобретению могут иметь значительно увеличенный in vivo период полувыведения в сыворотке и/или увеличенную площадь под кривой (AUC) по сравнению с отдельным лекарственным средством. Кроме того, активность лекарственного средства обычно не изменяется существенно в композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства). Однако некоторое изменение активности композиции лекарственного средства по сравнению с отдельным лекарственным средством является приемлемым и обычно компенсируется улучшенными фармакокинетическими свойствами композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слияния лекарственного средства). Например, композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства) могут связывать мишень лекарственного средства с более низким сродством, чем лекарственное средство отдельно, но могут иметь почти эквивалентную или превосходящую эффективность по сравнению с отдельным лекарственным средством благодаря улучшенным фармакокинетическим свойствам (например, увеличенный in vivo период полувыведения в сыворотке, большая AUC) композиции лекарственного средства. Кроме того, можно вводить меньшие количества композиций лекарственного средства (например, конъюгатов лекарственного средства, нековалентных конъюгатов лекарственного средства и слитых конструкций лекарственного средства) для достижения желаемого терапевтического или диагностического эффекта. Предпочтительно, активность композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства) отличается от таковой отдельного лекарственного средства не более чем примерно в 100 раз, или не более чем примерно в 50 раз, или не более чем примерно в 10 раз, или не более чем примерно в 5 раз, или не более чем примерно в 4 раза, или не более чем примерно в 3 раза, или не более чем примерно в 2 раза. Например, лекарственное средство может иметь KD, Ki или нейтрализующую дозу (ND50), равную 1 нМ, а композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) может иметь KD, Ki или ND50, равную примерно 2 нМ, или примерно 3 нМ, или примерно 4 нМ, или примерно 5 нМ, или примерно 10 нМ.

Предпочтительно, активность композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства) не уменьшена существенно по сравнению с активностью лекарственного средства. В конкретных вариантах воплощения, активность композиции лекарственного средства уменьшена по сравнению с активностью лекарственного средства не более чем примерно на 10%, не более чем примерно на 9%, не более чем примерно на 8%, не более чем примерно на 7%, не более чем примерно на 6%, не более чем примерно на 5%, не более чем примерно на 4%, не более чем примерно на 3%, не более чем примерно на 2%, не более чем примерно на 1%, или является существенно неизменной. Альтернативно заявлено, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) сохраняет, по меньшей мере, примерно 90%, по меньшей мере, примерно 91%, по меньшей мере, примерно 92%, по меньшей мере, примерно 93%, по меньшей мере, примерно 94%, по меньшей мере, примерно 95%, по меньшей мере, примерно 96%, по меньшей мере, примерно 97%, по меньшей мере, примерно 98%, по меньшей мере, примерно 99% активности лекарственного средства, или существенно ту же активность, что и лекарственное средство. Предпочтительно, активность композиций лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства) и лекарственных средств устанавливают и/или сравнивают на основе «основы лекарственного средства».

Как описано и показано в настоящем документе, композиции лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) по изобретению могут иметь большую активность (например, активность in vivo), чем отдельное лекарственное средство. Например, как показано в Примере 6, DOM7m-16/IL-1ra был более эффективен при лечении артрита в модели на мышах, чем IL-1ra, при введении данных агентов в одинаковой дозе в пересчете на массу (10 мг/кг или 1 мг/кг). DOM7m-16/IL-1ra был более эффективен даже несмотря на то, что его молекулярная масса приблизительно в два раза больше, чем молекулярная масса IL-1ra. Таким образом, мыши, которые получали DOM7m-16/IL-1ra, получили только примерно половину IL-1ra (в качестве группировки в составе DOM7m-16/IL-1ra), по сравнению с мышами, которые получали IL-1ra.

В конкретных вариантах воплощения, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) имеет большую активность (например, активность in vivo), чем лекарственное средство, например, композиция лекарственного средства может иметь, по меньшей мере, примерно 100%, по меньшей мере, примерно 150%, по меньшей мере, примерно 200%, по меньшей мере, примерно 250%, по меньшей мере, примерно 300%, по меньшей мере, примерно 350%, по меньшей мере, примерно 400%, по меньшей мере, примерно 450%, или, по меньшей мере, примерно 500% активности лекарственного средства. Предпочтительно, активность композиций лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства) и лекарственных средств устанавливают и/или сравнивают на основе «основы лекарственного средства». Активность композиций лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства) и лекарственных средств можно устанавливать с использованием подходящих in vitro или in vivo систем. В конкретных вариантах воплощения, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) имеет большую активность, чем лекарственное средство, которое она содержит, как установлено in vivo. В других вариантах воплощения, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) имеет большую активность, чем лекарственное средство, которое она содержит, как установлено in vitro.

Композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), которые содержат доменное антитело (dAb), которое имеет связывающую специфичность в отношении сывороточного альбумина, предоставляют дополнительные преимущества. Доменные антитела очень стабильны, имеют малый размер по сравнению с антителами и другими антигенсвязывающими фрагментами антител, их можно получить с высокими выходами экспрессией в E.coli или дрожжах (например, Pichia pastoris), и, как описано в настоящем документе, антигенсвязывающие фрагменты антител, которые связывают сывороточный альбумин, можно легко выбрать из библиотек человеческого происхождения или любого желаемого вида. Соответственно, композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), которые содержат dAb, которое связывает сывороточный альбумин, можно получить легче, чем терапевтические агенты, которые обычно производят в клетках млекопитающих (например, человеческие, гуманизированные или химерные антитела), и можно использовать не иммуногенные dAbs (например, человеческое dAb можно использовать для слитой конструкции лекарственного средства или конъюгата лекарственного средства для лечения или диагностики заболеваний у человека).

Иммуногенность лекарственного средства можно уменьшить, если лекарственное средство представляет собой часть композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства), которая содержит полипептидсвязывающую группировку, которая связывает сывороточный альбумин (например, антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин). Соответственно, лекарственное средство может быть менее иммуногенным (чем отдельное лекарственное средство) или быть существенно не иммуногенным в контексте композиции лекарственного средства, которая содержит полипептидсвязывающую группировку, которая связывает сывороточный альбумин (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства). Таким образом, такие композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства) можно вводить субъекту повторно в течение промежутка времени с минимальной потерей эффективности вследствие выработки антилекарственных антител иммунной системой субъекта.

Дополнительно, композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), описанные в настоящем документе, могут иметь улучшенный профиль безопасности и меньше побочных эффектов, чем отдельное лекарственное средство. Например, в результате активности связывания сывороточного альбумина, присущей антигенсвязывающему фрагменту антитела, который имеет связывающую специфичность в отношении сывороточного альбумина, слитые конструкции лекарственного средства и конъюгаты (конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства) имеют увеличенное время нахождения в сосудистом кровотоке. Дополнительно, конъюгаты и слитые конструкции лекарственного средства в значительной степени не в состоянии преодолевать гематоэнцефалический барьер и аккумулироваться в центральной нервной системе после системного введения (например, внутрисосудистого введения). Соответственно, конъюгаты (конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства) и слитые конструкции лекарственного средства, которые содержат лекарственное средство, которое имеет неврологическую токсичность или нежелательные психотропные эффекты, можно вводить с большей безопасностью и уменьшенными побочными эффектами по сравнению с отдельно взятым лекарственным средством. Альтернативно, конъюгаты (конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства) и слитые конструкции лекарственного средства могут иметь уменьшенную токсичность в отношении конкретных органов (например, почек или печени), чем отдельно взятое лекарственное средство. Конъюгаты и слитые конструкции лекарственного средства, описанные в настоящем документе, можно также применять для секвестрирования лекарственного средства или мишени, которая связывает лекарственное средство (например, токсина), в сосудистом кровотоке, таким образом, уменьшая эффекты, оказываемые лекарственным средством или мишенью на ткани (например, ингибируя эффекты токсина).

Подходящие методы фармакокинетического анализа и установления периода полувыведения in vivo хорошо известны в данной области. Такие методы описаны, например, в Kenneth, A et al: Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists, и в Peters er al, Pharmacokinetic analysis: A Practical Approach (1996). Также сошлемся на "Pharmacokinetics", M Gibaldi & D Perron, опубликованном Marcel Dekker, 2nd Rev. edition (1982), где описаны фармакокинетические параметры, такие как t альфа и t бета полупериоды существования (t 1/2 альфа, t 1/2 бета) и площадь под кривой (AUC).

Полупериоды существования (t 1/2 альфа и t 1/2 бета) и AUC можно определить из кривой сывороточной концентрации конъюгата или слитой конструкции относительно времени. Можно использовать, например, аналитический пакет WinNonlin (доступен из Pharsight Corp., Mountain View, CA 94040, USA) для моделирования кривой. В первой фазе (альфа фазе) композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) претерпевает, в основном, распределение в организме пациента, с некоторым разрушением. Вторая фаза (бета фаза) представляет собой конечную фазу, когда композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) уже была распределена, и сывороточная концентрация уменьшается, поскольку композиция лекарственного средства выводится из организма пациента, t альфа период полувыведения представляет собой период полувыведения первой фазы, и t бета период полувыведения представляет собой период полувыведения второй фазы. Таким образом, в настоящем изобретении предложена композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слияние лекарственного средства) или композиция, содержащая композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства) в соответствии с изобретением, имеющая tα период полувыведения в интервале 15 минут или более. В одном варианте воплощения, нижняя граница интервала составляет 30 минут, 45 минут, 1 час, 2 часа, 3 часа, 4 часа, 5 часов, 6 часов, 7 часов, 8 часов, 9 часов, 10 часов, 11 часов или 12 часов. Дополнительно, или альтернативно, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) или композиция в соответствии с изобретением будет иметь to период полувыведения в интервале до и включая 12 часов. В одном варианте воплощения, верхняя граница интервала составляет 11, 10, 9, 8, 7, 6 или 5 часов. Пример подходящего интервала представляет собой от 1 до 6 часов, от 2 до 5 часов или от 3 до 4 часов.

Предпочтительно, в настоящем изобретении предложены композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), имеющие tβ период полувыведения в интервале 2,5 часа или более. В одном варианте воплощения, нижняя граница интервала составляет 3 часа, 4 часа, 5 часов, 6 часов, 7 часов, 8 часов, 9 часов, 10 часов, 11 часов или 12 часов. В некоторых вариантах воплощения, композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), имеют tβ период полувыведения в интервале до и включая 21 сутки. В одном варианте воплощения, верхняя граница интервала составляет 12 часов, 24 часа, 2 суток, 3 суток, 5 суток, 10 суток, 15 суток или 20 суток. В конкретных вариантах воплощения, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) в соответствии с изобретением будет иметь tβ период полувыведения в интервале от 12 до 60 часов. В дополнительном варианте воплощения, он будет в интервале от 12 до 48 часов. В еще одном дополнительном варианте воплощения, он будет в интервале от 12 до 26 часов.

Кроме того, или альтернативно вышеозначенным критериям, в настоящем изобретении предложены композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), имеющие значение AUC (площадь под кривой) в интервале 0,01 мг·мин/мл или более, или 1 мг·мин/мл или более. В одном варианте воплощения, нижняя граница интервала составляет 0,01, 0,1, 1, 5, 10, 15, 20, 30, 100, 200 или 300 мг·мин/мл. В конкретных вариантах воплощения, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) имеет AUC в интервале до 600 мг·мин/мл. В одном варианте воплощения, верхняя граница интервала составляет 500, 400, 300, 200, 150, 100, 75 или 50 мг·мин/мл. В других вариантах воплощения, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) имеет AUC в интервале, выбранном из группы, состоящей из следующего: от 15 до 150 мг·мин/мл, от 15 до 100 мг·мин/мл, от 15 до 75 мг·мин/мл, от 15 до 50 мг·мин/мл, от 0,01 до 50 мг·мин/мл, от 0,1 до 50 мг·мин/мл, от 1 до 50 мг·мин/мл, от 5 до 50 мг·мин/мл и от 10 до 50 мг·мин/мл.

Изобретение относится к композициям лекарственного средства (например, конъюгатам лекарственного средства, нековалентным конъюгатам лекарственного средства, слитым конструкциям лекарственного средства), которые содержат лекарственное средство и полипептидсвязывающую группировку, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. В предпочтительных вариантах воплощения композиций лекарственного средства, полипептидсвязывающая группировка, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, имеет связывающую специфичность в отношении сывороточного альбумина.

В некоторых вариантах воплощения, композиция лекарственного средства содержит лекарственное средство, которое связано ковалентно с полипептидсвязывающей группировкой, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. В данных вариантах воплощения, лекарственное средство может быть связано ковалентно с полипептидсвязывающим доменом в любом подходящем положении, таком как аминоконец, карбоксиконец или через подходящие аминокислотные боковые цепочки (например, Ј аминогруппа лизина или тиольная группа цистеина).

В других вариантах воплощения, композиция лекарственного средства содержит лекарственное средство, которое связано нековалентно с полипептидсвязывающей группировкой, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo. В таких вариантах воплощения, лекарственное средство может быть нековалентно связано с антигенсвязывающим фрагментом напрямую (например, путем электростатического взаимодействия, гидрофобного взаимодействия) или непрямым путем (например, посредством нековалентного связывания комплементарных связывающих партнеров (например, биотина и авидина), где один партнер ковалентно связан с лекарственным средством, и комплементарный связывающий партнер ковалентно связан с антигенсвязывающим фрагментом). Если используют комплементарные связывающие партнеры, один из связывающих партнеров может быть ковалентно связан с лекарственным средством напрямую или через подходящую линкерную группировку, и комплементарный связывающий партнер может быть ковалентно связан с полипептидсвязывающим доменом напрямую или через подходящую линкерную группировку.

В других вариантах воплощения, композиция лекарственного средства представляет собой слитый белок, который содержит полипептидсвязывающую группировку, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, и полипептидное лекарственное средство. Слитые белки содержат непрерывную полипептидную цепь, при этом указанная цепь содержит полипептидсвязывающую группировку, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, в качестве первой группировки, и полипептидное лекарственное средство в качестве второй группировки, которые присутствуют в виде отдельных частей (группировок) полипептидной цепи. Первая и вторая группировки могут быть напрямую связаны друг с другом пептидной связью или связаны посредством подходящей аминокислоты, или пептидного или полипептидного линкера. При необходимости могут присутствовать дополнительные группировки (например, третья, четвертая) и/или линкерные последовательности. Первая группировка может находиться в N-концевом положении, С-концевом положении или располагаться внутри относительно второй группировки (т.е. полипептидного лекарственного средства). В конкретных вариантах воплощения, слитый белок содержит одну или более полипептидсвязывающих группировок, которые содержат связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, и одну или более группировок полипептидного лекарственного средства. В этих вариантах воплощения, слитый белок может содержать от одной до примерно десяти (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10) группировок полипептидного лекарственного средства, которые могут быть одинаковыми или разными, и от одной до примерно двадцати (например, 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20) полипептидсвязывающих группировок, которые содержат связывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, которые могут быть одинаковыми или разными.

Полипептидсвязывающие группировки, которые содержат связывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, и группировки полипептидного лекарственного средства могут находиться в любом желаемом положении. Например, продвигаясь от аминоконца к карбоксиконцу, группировки могут находиться в следующем порядке: одна или более полипептидсвязывающих группировок, одна или более группировок полипептидного лекарственного средства, одна или более полипептидсвязывающих группировок. В другом примере, продвигаясь от аминоконца к карбоксиконцу, группировки могут находиться в следующем порядке: одна или более полипептидсвязывающих группировок, одна или более группировок полипептидного лекарственного средства, одна или более полипептидсвязывающих группировок, одна или более группировок полипептидного лекарственного средства, одна или более полипептидсвязывающих группировок. Как описано в настоящем документе, полипептидсвязывающие группировки и группировки полипептидного лекарственного средства могут быть напрямую связаны друг с другом пептидной связью или связаны посредством подходящей аминокислоты, или пептидного или полипептидного линкера.

В конкретных вариантах воплощения, слитый белок представляет собой непрерывную полипептидную цепь, которая имеет формулу (от аминоконца к карбоксиконцу):

a-(P)n2-b-(X)n1-c(Q)n3-d или a-(Q)n3-b-(X)n1-c-(P)n2-d,

где Х представляет собой полипептидное лекарственное средство;

каждая из Р и Q независимо представляет собой полипептидсвязывающую группировку, которая содержит связывающий сайт, который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo;

каждый из а, b, с и d независимо отсутствует или состоит из от одного до примерно 100 остатков аминокислот;

n1, n2 и n3 представляют количество присутствующих X, Р или Q группировок, соответственно;

n1 равно от одного до примерно 10;

n2 равно от нуля до примерно 10; и

n3 равно от нуля до примерно 10,

при условии, что оба n2 и n3 не равны нулю; и

при условии, что, когда оба n1 и n2 равны одному и n3 равно нулю, Х не содержит цепочку антитела или фрагмент цепочки антитела.

В некоторых вариантах воплощения, n2 равно одному, двум, трем, четырем, пяти или шести, и n3 равно нулю. В других вариантах воплощения, n3 равно одному, двум, трем, четырем, пяти или шести, и n2 равно нулю. В других вариантах воплощения, каждый из n1, n2 и n3 равен одному.

В конкретных вариантах воплощения, Х не содержит цепочку антитела или фрагмент цепочки антитела.

В предпочтительных вариантах воплощения, каждая из Р и Q независимо представляет собой полипептидсвязывающую группировку, которая имеет связывающую специфичность в отношении сывороточного альбумина.

В особенно предпочтительных вариантах воплощения, композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства), содержит полипептидсвязывающую группировку, которая содержит связывающий сайт (например, антигенсвязывающий сайт), который имеет связывающую специфичность в отношении полипептида, который увеличивает период полувыведения в сыворотке in vivo, где полипептидсвязывающий домен представляет собой антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина.

Антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин

Конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства и слитые конструкции лекарственного средства по изобретению содержат (т.е. один или более) антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин. Антигенсвязывающий фрагмент может иметь связывающую специфичность в отношении сывороточного альбумина животного, которому будут вводить конъюгат лекарственного средства или слитую конструкцию лекарственного средства. Предпочтительно, антигенсвязывающий фрагмент имеет связывающую специфичность в отношении сывороточного альбумина человека. Однако предусмотрены ветеринарные применения, и антигенсвязывающий фрагмент может иметь связывающую специфичность в отношении сывороточного альбумина от желаемого животного, например сывороточного альбумина от собаки, кошки, лошади, коровы, курицы, овцы, свиньи, козла, оленя, норки и тому подобное. В некоторых вариантах воплощения, антигенсвязывающий фрагмент имеет связывающую специфичность в отношении сывороточного альбумина более чем одного вида. Например, как описано в настоящем документе, были получены человеческие dAbs, которые имеют связывающую специфичность в отношении сывороточного альбумина крыс и сывороточного альбумина мышей, и dAb, которое имеет связывающую специфичность в отношении сывороточного альбумина крыс, мышей и человека (Таблица 1 и Фиг.7). Такие dAb предоставляют преимущество проведения доклинических и клинических испытаний, используя одинаковые конъюгат лекарственного средства или слитую конструкцию лекарственного средства, и устраняют необходимость проведения доклинических испытаний с подходящей суррогатной слитой конструкцией лекарственного средства или конъюгатом лекарственного средства.

Антигенсвязывающие фрагменты, пригодные для применения по изобретению, включают, например, Fab фрагменты, Fab' фрагменты, F(ab')2 фрагменты, Fv фрагменты (включая одноцепочечный Fv (scFv) и Fv, связанные дисульфидной связью), единичный вариабельный домен и dAbs (VH, VL). Такие антигенсвязывающие фрагменты можно получить любым подходящим способом, таким так протеолиз антитела с использованием пепсина, папаина или другой протеазы, имеющей необходимую специфичность расщепления, или с использованием рекомбинантных технологий. Например, можно получить Fv фрагменты путем расщепления антитела подходящей протеазой или используя технологию рекомбинантной ДНК. Например, можно получить нуклеиновую кислоту, которая кодирует вариабельный участок легкой цепи и вариабельный участок тяжелой цепи, которые соединены подходящим пептидным линкером, таким как цепочка из от двух до примерно двадцати глицильных остатков. Нуклеиновую кислоту можно внедрить в подходящего хозяина (например, E.соli) с использованием любой подходящей методики (например, трансфекция, трансформация, инфекция), и хозяина можно содержать в условиях, подходящих для экспрессии одноцепочечного Fv фрагмента. Можно получить множество антигенсвязывающих фрагментов антител с использованием генов антител, в которых один или более терминирующих кодонов были введены выше природного терминирующего сайта. Например, можно разработать экспрессирующую конструкцию, кодирующую F(ab')2 участок тяжелой цепи иммуноглобулина, путем введения трансляционного терминирующего кодона на 3' конце последовательности, кодирующей шарнирный участок тяжелой цепи. Конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства и слитые конструкции лекарственного средства по изобретению могут содержать отдельные тяжелые и легкие цепи антител, которые связывают сывороточный альбумин, или участки отдельных цепей, которые связывают сывороточный альбумин (например, одиночные VH, VK или Vλ).

Антитела и их антигенсвязывающие фрагменты, которые связывают желаемый сывороточный альбумин (например, человеческий сывороточный альбумин), можно выбрать из подходящей коллекции природных или искусственных антител или полученных против подходящего иммуногена в пригодном хозяине. Например, антитела можно получить иммунизацией подходящего хозяина (например, мышь, трансгенная мышь, способная продуцировать антитела человека, крыса, кролик, курица, козел, не человекообразная обезьяна (например, макака)) сывороточным альбумином (например, выделенным или очищенным человеческим сывороточным альбумином) или пептидом сывороточного альбумина (например, пептидом, содержащим, по меньшей мере, примерно 8, 9, 10, 11, 12, 15, 20, 25, 30, 33, 35, 37 или 40 аминокислотных остатков). Антитела и антигенсвязывающие фрагменты, которые связывают сывороточный альбумин, можно также выбрать из библиотеки рекомбинантных антител или антигенсвязывающих фрагментов, таких как фаговая дисплейная библиотека. Такие библиотеки могут содержать антитела или антигенсвязывающие фрагменты антител, которые содержат природные или искусственные аминокислотные последовательности. Например, библиотека может содержать Fab фрагменты, которые содержат искусственные CDRs (например, случайные аминокислотные последовательности) и человеческие каркасные области (иммуноглобулина). (См., например, Патент США №6300064 (Knappik, etal.).) В других примерах, библиотека содержит scFv фрагменты или dAbs (одиночный VH, одиночный VK или одиночный Vλ) с разнообразием последовательности в одном или более CDRs. (См., например, WO 99/20749 (Tomlinson и Winter), WO 03/002609 A2 (Winter et al.), WO 2004/003019 A2 (Winter et al.).)

Подходящие антитела и их антигенсвязывающие фрагменты, которые связывают сывороточный альбумин, включают, например, человеческие антитела и их антигенсвязывающие фрагменты, гуманизованные антитела и их антигенсвязывающие фрагменты, химерные антитела и их антигенсвязывающие фрагменты, антитела и их антигенсвязывающие фрагменты грызунов (например, мышей, крыс) и Camelid антитела и их антигенсвязывающие фрагменты. В конкретных вариантах воплощения, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства и слитые конструкции лекарственного средства содержат Camelid VHH, который связывает сывороточный альбумин. Camelid VHHs представляют собой полипептиды одиночного вариабельного домена иммуноглобулина, которые происходят от антител тяжелой цепи, которые естественным образом лишены легких цепей. Такие антитела существуют в видах Camelid, включая верблюда, ламу, альпака, дромедара и гуанако. Молекулы VHH примерно в десять раз меньше, чем молекулы IgG, и, будучи одиночными полипептидами, являются очень стабильными и устойчивыми в жестких условиях pH и температуры. Подходящие Camelid VHH, которые связывают сывороточный альбумин, включают таковые, описанные в WO 2004/041862 (Ablynx N.V.) и в настоящем документе (Фиг.15 и SEQ ID NOs:77-88). В конкретных вариантах воплощения, Camelid VHH связывает человеческий сывороточный альбумин и содержит аминокислотную последовательность, которая имеет, по меньшей мере, примерно 80%, или по меньшей мере, примерно 85%, или, по меньшей мере, примерно 96%, или, по меньшей мере, примерно 97%, или, по меньшей мере, примерно 98%, или, по меньшей мере, примерно 99% идентичности с SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, SEQ ID NO:80, SEQ ID NO:81, SEQ ID NO:82, SEQ ID NO:83, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86, SEQ ID NO:87 или SEQ ID NO:88. Идентичность аминокислотной последовательности, предпочтительно, устанавливают с использованием подходящего алгоритма выравнивания последовательности и значений параметра по умолчанию, таких как BLAST P (Karlin и Altschul, Pmc. Natl. Acad. Sci. USA 87(6):2264-2268 (1990)).

Подготовку иммунизирующего антигена и получение поликлональных и моноклональных антител можно осуществить с использованием любых подходящих методик. Было описано множество способов. (См., например, Kohler etal., Nature, 256: 495-497 (1975) и Eur. J. Immunol. 6: 511-519 (1976); Milstein et al„ Nature 266: 550-552 (1977); Koprovski et al., Патент США №4172124; Harlow, Е. и D. Lane, 1988, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory: Cold Spring Harbor, NY); Current Protocols In Molecular Biology, Vol.2 (Supplement 27, Summer" 94), Ausubel, F.M. et al., Eds., (John Wiley & Sons: New York, NY), Chapter 11, (1991).) Обычно, если хотят получить моноклональное антитело, получают гибридому слиянием подходящих клеток из иммортализованной клеточной линии (например, клеточная линия миеломы, такая как SP2/0, Р3Х63Аg8.653 или гетеромиелома) с клетками-хозяевами антител. Клетки-хозяева антител можно получить из периферической крови или, предпочтительно, селезенки или лимфатических узлов человека, трансгенных животных, способных продуцировать человеческие антитела, или других подходящих животных, иммунизированных представляющим интерес антигеном. Клетки, которые продуцируют антитела человеческого происхождения (например, человеческое антитело), можно получить с использованием подходящих способов, например, слияние клетки-хозяина человеческих антител и гетеромиеломы или триомы, или иммортализация активированной человеческой В клетки путем инфицирования Epstein Ван-вирусом. (См., например, Патент США №6197582 (Trakht); Niedbala et al., Hybridoma, 17:299-304 (1998); Zanella et al., J. Immunol. Methods, 156:205-215 (1992); Gustafsson et al., Hum Antibodies Hybridomas, 2:26-32 (1991).) Слитые или иммортализованные клетки-хозяева антител (гибридомы) можно выделить с использованием селективных условий культивирования и клонировать методом серийных разведении. Клетки, которые продуцируют антитела с желаемой специфичностью, можно идентифицировать при помощи подходящего метода анализа (например, ELISA).

Антитела также можно получить напрямую (например, синтезировать или клонировать) из изолированной антиген-специфической клетки-хозяина антитела (например, клетка из периферической крови или, предпочтительно, селезенки или лимфатических узлов, детерминированная для продуцирования антитела с желаемой специфичностью) человека, трансгенных животных, способных продуцировать человеческие антитела, или других подходящих животных, иммунизированных представляющим интерес антигеном (см., например, Патент США №5627052 (Schrader)).

Если конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства или слитая конструкция лекарственного средства предназначена для введения человеку, антитело или его антигенсвязывающий фрагмент, который связывает сывороточный альбумин (например, человеческий сывороточный альбумин), может представлять собой человеческое, гуманизированное или химерное антитело или антигенсвязывающий фрагмент такого антитела. Эти типы антител и антигенсвязывающих фрагментов являются менее иммуногенными или не иммуногенными у человека и предоставляют хорошо известные преимущества. Например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства или слитые конструкции лекарственного средства, которые содержат антигенсвязывающий фрагмент человеческого, гуманизированного или химерного антитела, можно вводить человеку многократно с меньшей эффективностью или без потери эффективности (в сравнении с другими полностью иммуногенными антителами) благодаря формированию человеческих антител, которые связывают конъюгат лекарственного средства или слитую конструкцию лекарственного средства. Если конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства или слитая конструкция лекарственного средства предназначена для ветеринарного введения, можно применять аналогичные антитела или антигенсвязывающие фрагменты. Например, CDRs от мышиного или человеческого антитела можно перенести на каркасные области иммуноглобулина от желаемого животного, такого как лошадь или корова.

Человеческие антитела и нуклеиновые кислоты, их кодирующие, можно получить, например, от человека или от трансгенных животных, способных продуцировать человеческие антитела. Трансгенные животные, способные продуцировать человеческие антитела (например, мыши), представляют собой животных, способных продуцировать набор человеческих антител, таких как XENOMOUSE (Abgenix, Fremont, CA), HUMAB-MOUSE, KIRIN TC MOUSE или KM-MOUSE (MEDAREX, Princeton, NJ). Как правило, геном трансгенных животных, способных продуцировать человеческие антитела, был изменен с целью включить трансген, содержащий ДНК из локуса человеческого иммуноглобулина, который может претерпевать функциональную перестройку. Эндогенный локус иммуноглобулина в трансгенном животном, способном продуцировать человеческие антитела, может быть разрушен или удален, чтобы устранить способность животного продуцировать антитела, кодируемые эндогенным геном. Подходящие способы получения трансгенных животных, способных продуцировать человеческие антитела, хорошо известны в данной области. (См., например, Патенты США №5939598 и 6075181 (Kucherlapati еt аl.), Патенты США №5569825, 5545806, 5625126, 5633425, 5661016 и 5789650 (Lonberg et al.), Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90: 2552-2555 (1993), Jakobovits et al., Nature, 362: 255-258 (1993), Jakobovits et al. WO 98/50433, Jakobovits et al. WO 98/24893, Lonberg et al. WO 98/24884, Lonberg er al. WO 97/13852, Lonberg et al. WO 94/25585, Lonberg et al. EP 0814259 A2, Lonberg et al. GB 2272440 A, Lonberg er al., Nature 368:856-859 (1994), Lonberg et al., Int Rev Immunol 13(1):65-93 (1995), Kucherlapati et al/. WO 96/34096, Kucherlapati et al. EP 0463151 B1, Kucherlapati et al. EP 0710719 A1, Surani et al. Патент США №5545807, Bruggemann et al. WO 90/04036, Bruggemann et al. EP 0438474 B1, Taylorera/., Int. Immunol. 6(4)579-591 (1994), Taylorera/., Nucleic Acids Research 20(23):6287-6295 (1992), Green era/.. Nature Genetics 7:13-21 (1994), Mendez er al., Nature Genetics 15:146-156 (1997), Tuaillon e/ al., Proc Natl Acad Sci USA 90(8):3720-3724 (1993) и Fishwild er al., Nat Biotechnol 14(7):845-851 (1996), содержание каждой из вышеупомянутых публикаций полностью включено в настоящий документ посредством ссылки.)

Трансгенных животных, способных продуцировать человеческие антитела, можно иммунизировать подходящим антигеном (например, человеческим сывороточным альбумином), и клетки-хозяева антител можно выделять и сливать для образования гибридом, используя обычные способы. Гибридомы, которые продуцируют человеческие антитела, имеющие желаемые характеристики (например, специфичность, сродство), можно идентифицировать, используя любой подходящий метод анализа (например, ELISA), и, при желании, отобрать и субклонировать с использованием подходящих методик культивирования.

Гуманизированные антитела и другие антитела с перенесенным CDR можно получить, используя любой подходящий способ. CDRs от антитела с перенесенным CDR могут являться производными от подходящего антитела, которое связывает сывороточный альбумин (обозначаемое как донорское антитело). Другие источники подходящих CDRs включают природные и искусственные антитела, специфические к сывороточному альбумину, полученные из человеческого и не из человеческого источника, такого как грызун (например, мышь, крыса, кролик), курица, свинья, козел, примат кроме человека (например, обезьяна) или библиотека.

Каркасные области гуманизированного антитела, предпочтительно, имеют человеческое происхождение и могут быть производными от любого вариабельного участка человеческого антитела, имеющего сходство последовательности с аналогичным или эквивалентным участком (например, вариабельный участок тяжелой цепи или вариабельный участок легкой цепи) антигенсвязывающего участка донорского антитела. Другие источники каркасных областей человеческого происхождения включают консенсусные последовательности человеческого вариабельного участка. (См., например, Kettleborough, C.A. et al., Protein Engineering 4:773-783 (1991); Carter et al., WO 94/04679; Kabat, E.A., et al., Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, U.S. Government Printing Office (1991)). Другие типы антител с перенесенными CDR могут содержать каркасные области подходящего происхождения, такие как каркасные области, кодируемые сегментами генов антител эмбрионального типа от лошади, коровы, собаки, кошки и тому подобное.

Каркасные области человеческого происхождения могут включать замещения или замены аминокислот, такие как «обратные мутации», которые заменяют остаток аминокислоты в каркасной области человеческого или животного происхождения остатком из соответствующей позиции донорского антитела. Можно выполнить одну или более мутаций в каркасной области, включая делеции, вставки или замещения одной или более аминокислот. Варианты можно получить при помощи разнообразных подходящих способов, включая мутагенез человеческих цепочек от не человеческого донора или акцептора. (См., например, Патенты США №5693762 (Queen et al.) и 5859205 (Adair et al.), содержание которых полностью включено в настоящий документ посредством ссылки.)

Постоянные участки антител, цепей антител (например, тяжелая цепь, легкая цепь) или их фрагментов или частей, если таковые присутствуют, могут происходить от любого подходящего источника. Например, постоянные участки человеческих, гуманизированных и определенных химерных антител, цепей антител (например, тяжелая цепь, легкая цепь) или их фрагментов или частей, если таковые присутствуют, могут быть человеческого происхождения и могут происходить от любого подходящего человеческого антитела или цепочки антитела. Например, постоянный участок человеческого происхождения или его часть могут происходить от человеческой κ или λ легкой цепи и/или человеческой γ (например, γ1, γ2, γ3, γ4), µ, α (например, α1, α2), δ или ε тяжелой цепи, включая аллельные варианты. В конкретных вариантах воплощения, антитело или антигенсвязывающий фрагмент (например, антитело человеческого происхождения, человеческое антитело) могут включать аминокислотные замещения или замены, которые изменяют или приспосабливают функцию (например, эффекторную функцию). Например, можно разработать постоянный участок человеческого происхождения (например, γ1 постоянный участок, γ2 постоянный участок), чтобы уменьшить активацию комплемента и/или связывание Fc рецептора. (См., например, Патенты США №5648260 (Winter еt al.), 5624821 (Winter et al.) и 5834597 (Tso et al.), содержание которых полностью включено в настоящий документ посредством ссылки.) Предпочтительно, аминокислотная последовательность постоянного участка человеческого происхождения, который содержит такие аминокислотные замещения или замены, является, по меньшей мере, примерно на 95% идентичной полной длине аминокислотной последовательности неизмененного постоянного участка человеческого происхождения, более предпочтительно, является, по меньшей мере, примерно на 99% идентичной полной длине аминокислотной последовательности неизмененного постоянного участка человеческого происхождения.

Гуманизированные антитела, антитела с перенесенным CDR или антигенсвязывающие фрагменты гуманизированного или антитела с перенесенным CDR можно получить с использованием любого подходящего способа. Несколько таких способов хорошо известны в данной области. (См., например, Патент США №5225539 (Winter), Патент США №5530101 (Queen et аl.).) Участки гуманизированного антитела или антитела с перенесенным CDR (например, CDRs, каркасная область, постоянный участок) могут быть получены или являться производными напрямую от подходящих антител (например, путем de novo синтеза участка), либо можно получить и экспрессировать нуклеиновые кислоты, кодирующие антитело или его цепь, имеющие желаемое свойство (например, связывает сывороточный альбумин). Чтобы получить участок цепи, можно ввести один или более терминирующих кодонов в желаемом положении. Например, последовательности нуклеиновых кислот (например, ДНК), кодирующих гуманизированные или CDR-перенесенные вариабельные участки, можно сконструировать с использованием ПЦР (полимеразная цепная реакция) мутагенезных методов для изменения существующих ДНК последовательностей. (См., например, Kamman, M., et al., Nucl. Acids Res. 17:5404 (1989).) ПЦР-праймеры, кодирующие новые CDRs, можно гибридизировать с матрицей ДНК предварительно гуманизированного вариабельного участка, который основан на том же самом, или очень схожем, человеческом вариабельном участке (Sato, К., et al., Cancer Research 53:851-856 (1993)). Если схожая ДНК-последовательность недоступна для использования в качестве матрицы, можно сконструировать нуклеиновую кислоту, содержащую последовательность, кодирующую последовательность вариабельного участка, из синтетических олигонуклеотидов (см, например, Kolbinger, F., Protein Engineering 8:971-980 (1993)). В нуклеиновую кислоту можно также включить последовательность, кодирующую сигнальный пептид (например, синтетическим путем, при вставке в вектор). Можно использовать последовательность природного сигнального пептида от акцепторного антитела, последовательность сигнального пептида от другого антитела или другую подходящую последовательность (см., например, Kettleborough, C.A., Protein Engineering 4:773-783 (1991)). Используя данные методы или другие подходящие методы, легко можно получить варианты. В одном варианте воплощения, клонированные вариабельные участки можно подвергнуть мутации и можно отобрать последовательности, кодирующие варианты с желаемой специфичностью (например, из фаговой библиотеки; см., например, Патент США №5514548 (Krebber et al.) и WO 93/06213 (Hoogenboom et al.)).

Антитело или антигенсвязывающий фрагмент, который связывает сывороточный альбумин, может представлять собой химерное антитело или антигенсвязывающий фрагмент химерного антитела. Химерное антитело или его антигенсвязывающий фрагмент содержит вариабельный участок от одного вида (например, мышь) и, по меньшей мере, часть постоянного участка от другого вида (например, человек). Химерные антитела и антигенсвязывающие фрагменты химерных антител можно получить любым подходящим способом. Несколько подходящих способов хорошо известны в данной области. (См., например, Патент США №4816567 (Cabilly et аl.), Патент США №5116946 (Capon et al.).)

Предпочтительный способ получения антигенсвязывающих фрагментов антител, которые связывают сывороточный альбумин, включает выбор антигенсвязывающего фрагмента (например, scFvs, dAb), который имеет связывающую специфичность в отношении желаемого сывороточного альбумина, из набора антигенсвязывающих фрагментов. Например, как описано в настоящем документе, dAbs, которые связывают сывороточный альбумин, можно выбрать из подходящей фаговой дисплейной библиотеки. Был описан ряд подходящих бактериофаговых дисплейных библиотек и методов отбора (например, моновалентная дисплейная и многовалентная дисплейная системы). (См., например, Griffiths et al., Патент США №6555313 В1 (включено в настоящий документ посредством ссылки); Johnson et al., Патент США №5733743 (включено в настоящий документ посредством ссылки); McCafferty et al., Патент США №5969108 (включено в настоящий документ посредством ссылки); Mulligan-Kehoe, Патент США №5702892 (включено в настоящий документ посредством ссылки); Winter, G. et al., Annu. Rev. Immunol. 12:433-455 (1994); Soumillion, P. et al., Appl. Biochem. Biotechnol. 47(2-3): 175-189 (1994); Castagnoli, L. el al., Comb. Chem. High Throughput Screen, 4(2): 121-133 (2001); WO 99/20749 (Tomlinson и Winter); WO 03/002609 A2 (Winter et al.); WO 2004/003019A2 (Winter et al.).) Полипептиды, показанные в бактериофаговой библиотеке, могут быть отображены на любом подходящем бактериофаге, таком как нитчатый фаг (например, fd, M13, F1), вирулентный фаг (например, Т4, Т7, лямбда) или РНК-фаг (MS2), например, и отобраны с учетом связывания сывороточного альбумина (например, человеческого сывороточного альбумина).

Как правило, используют фаговую библиотеку, которая отображает набор полипептидов как слитых белков с подходящим фаговым оболочечным белком. Такую библиотеку можно получить любыми подходящими способами, такими как внедрение библиотеки фаговых векторов или фагемидных (phagemid) векторов, кодирующих отображенные антитела или их антигенсвязывающие фрагменты, в подходящие бактерии-хозяева и культивирование полученных в результате бактерий для продуцирования фага (например, используя подходящий хелперный фаг или комплементирующую плазмиду, при желании). Фаговую библиотеку можно выделить из такой культуры любым подходящим способом, таким как осаждение и центрифугирование.

Библиотека может содержать набор антител или их антигенсвязывающих фрагментов, который содержит любое желаемое количество из разнообразия аминокислотных последовательностей. Например, набор может содержать антитела или их антигенсвязывающие фрагменты, которые имеют аминокислотные последовательности, которые соответствуют природным антителам из желаемого организма, и/или могут содержать один или более участков из случайных или рандомизированных аминокислотных последовательностей (например, CDR последовательности). Антитела или их антигенсвязывающие фрагменты в таком наборе или библиотеке могут содержать определенные участки из случайной или рандомизированной аминокислотной последовательности и участки из обычной аминокислотной последовательности. В конкретных вариантах воплощения, все или существенным образом все полипептиды в наборе представляют собой желаемый тип антигенсвязывающего фрагмента антитела (например, человеческий VH или человеческий VL. Например, каждый полипептид в наборе может содержать VH, VL или Fv (например, одноцепочечный Fv).

Разнообразие аминокислотных последовательностей можно внедрить в любой желаемый участок антител или их антигенсвязывающих фрагментов любым подходящим способом. Например, разнообразие аминокислотных последовательностей можно внедрить в участок-мишень, такой как гипервариабельный участок вариабельного домена антитела, путем изготовления библиотеки нуклеиновых кислот, которые кодируют разнообразные (диверсифицированные) антитела или их антигенсвязывающие фрагменты, применяя любые подходящие методы мутагенеза (например, ПЦР с низкой точностью (low fidelity PCR), олигонуклеотид-опосредованный или сайт-направленный мутагенез, диверсификация с использованием NNK кодонов) или любой другой подходящий метод. При желании, можно рандомизировать участок антител или их антигенсвязывающих фрагментов, которые следует диверсифицировать.

Подходящую фаговую дисплейную библиотеку можно применить для отобранных антител или антигенсвязывающих фрагментов антител, которые связывают сывороточный альбумин и имеют другие выгодные свойства. Например, можно отобрать антитела или антигенсвязывающие фрагменты, которые устойчивы к агрегации, когда они пространственно развернуты. На агрегацию влияет концентрация полипептида, и, как считают, она возникает во многих случаях благодаря частично свернутым или развернутым промежуточным продуктам. Факторы и условия, которые благоприятствуют частично свернутым промежуточным продуктам, такие как повышенная температура и высокая полипептидная концентрация, способствуют необратимой агрегации. (Fink, A.L, Folding & Design 3:R1-R23 (1998).) Например, хранение очищенных полипептидов в концентрированной форме, такой как лиофилизированный препарат, часто приводит к необратимой агрегации, по меньшей мере, части полипептидов. Также, производство полипептида экспрессией в биологических системах, таких как E. соli, часто приводит к образованию внутриклеточных телец, которые содержат агрегаты полипептидов. Выделение активных полипептидов из внутриклеточных телец может быть очень трудным и может потребовать применения дополнительных стадий к биологической производственной системе, таких как стадия рефолдинга.

Антитела и антигенсвязывающие фрагменты, которые устойчивы к агрегации и обратимо разворачиваются при нагревании, можно отобрать из подходящей фаговой дисплейной библиотеки. Как правило, фаговую дисплейную библиотеку, содержащую набор отображенных антител или их антигенсвязывающих фрагментов, нагревают до температуры (Ts), при которой, по меньшей мере, часть отображенных антител или их антигенсвязывающих фрагментов становятся развернутыми, затем охлаждают до температуры (Те), где Ts>Tc, посредством чего, по меньшей мере, часть антител или их антигенсвязывающих фрагментов подверглась рефолдингу, и часть полипептидов подверглась агрегации. Затем, антитела или их антигенсвязывающие фрагменты, которые разворачиваются обратимо и связывают сывороточный альбумин, восстанавливают при температуре (Тr). Восстановленное антитело или его антигенсвязывающий фрагмент, который разворачивается обратимо, имеет температуру плавления (Тm), и предпочтительно, набор нагревали до Ts, охлаждали до Тc, и антитело или его антигенсвязывающий фрагмент, который разворачивается обратимо, выделяли при Тr, так что Ts>Tm>Tc и Ts>Tm>Tr. Обычно, фаговую дисплейную библиотеку нагревают до примерно 80°С и охлаждают до примерно комнатной температуры или примерно 4°С перед отбором. Антитела или их антигенсвязывающий фрагмент, которые разворачиваются обратимо и устойчивы к агрегации, также можно разработать или сконструировать заменой определенного аминокислотного остатка остатками, которые придают способность разворачиваться обратимо. (См., WO 2004/101790 (Jespers et аl.) и предварительную заявку на Патент США №№: 60/470340 (заявлена 14 мая 2003 г.) и 60/554021 (заявлена 17 мая 2004 г.) для подробного обсуждения способов отбора и для разработки или конструирования антител или их антигенсвязывающих фрагментов, которые разворачиваются обратимо. Содержание WO 2004/101790 и обеих вышеупомянутых предварительных заявок на Патент США включено в настоящий документ посредством ссылки.).

Антитела или их антигенсвязывающие фрагменты, которые разворачиваются обратимо и устойчивы к агрегации, предоставляют ряд преимуществ. Например, благодаря своей устойчивости к агрегации, антитела или их антигенсвязывающие фрагменты, которые разворачиваются обратимо, легко можно получать с высоким выходом в виде растворимых белков экспрессией в подходящих биологических продуцирующих системах, таких как E.coli. Кроме того, антитела или их антигенсвязывающие фрагменты, которые разворачиваются обратимо, можно формулировать и/или хранить при более высоких концентрациях, чем обычные полипептиды, а также с меньшей агрегацией и потерей активности. DOM7h-26 (SEQ ID NO:20) представляет собой человеческий VH, который разворачивается обратимо.

Предпочтительно, антитело или его антигенсвязывающий фрагмент, который связывает сывороточный альбумин, содержит вариабельный домен (VH, VK, Vλ), в котором одна или более каркасных областей (FR) содержат (а) аминокислотную последовательность человеческой каркасной области, (б) по меньшей мере, 8 смежных аминокислот из аминокислотной последовательности человеческой каркасной области, или (в) аминокислотную последовательность, кодируемую сегментом гена человеческого антитела эмбрионального типа, где указанные каркасные области представляют собой таковые, как установлено Kabat. В конкретных вариантах воплощения, аминокислотная последовательность одной или более каркасных областей представляет собой такую же, как и аминокислотная последовательность соответствующей каркасной области, кодируемой сегментом гена человеческого антитела эмбрионального типа, или аминокислотные последовательности одной или более указанных каркасных областей в совокупности содержат до 5 аминокислотных различий по сравнению с аминокислотной последовательностью указанной соответствующей каркасной области, кодируемой сегментом гена человеческого антитела эмбрионального типа.

В других вариантах воплощения, аминокислотные последовательности из FR1, FR2, FR3 и FR4 представляют собой такие же, как и аминокислотные последовательности соответствующих каркасных областей, кодируемых сегментом гена человеческого антитела эмбрионального типа, или аминокислотные последовательности из FR1, FR2, FR3 и FR4 в совокупности содержат до 10 аминокислотных различий по сравнению с аминокислотными последовательностями соответствующих каркасных областей, кодируемых указанными сегментами гена человеческого антитела эмбрионального типа. В других вариантах воплощения, аминокислотные последовательности из указанных FR1, FR2 и FR3 представляют собой такие же, как и аминокислотные последовательности соответствующих каркасных областей, кодируемых указанным сегментом гена человеческого антитела эмбрионального типа.

В конкретных вариантах воплощения, антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, содержит вариабельный домен иммуноглобулина (например, VH, VL, основанный на человеческой гаметной последовательности, и, при желании, может иметь один или более диверсифицированных участков, таких как гипервариабельные участки. Подходящая человеческая гаметная последовательность для VH включает, например, последовательности, кодируемые VH сегментами гена DP4, DP7, DP8, DP9, DP10, DP31, DP33, DP45, DP46, DP47, DP49, DP50, DP51, DP53, DP54, DP65, DP66, DP67, DP68 и DP69, а также JH сегментами JH1, JH2, JH3, JH4, JH4b, JH5 и JH6. Подходящая человеческая гаметная последовательность для VL включает, например, последовательности, кодируемые VK сегментами гена DPK1, DPK2, DPK3, DPK4, DPK5, DPK6, DPK7, DPK8, DPK9, DPK10, DPK12, DPK13, DPK15, DPK16, DPK18, DPK19, DPK20, DPK21, DPK22, DPK23, DPK24, DPK25, DPK26 и DPK28, а также JK сегментами JK1, JK2, JK3, JK4 и JK5.

В конкретных вариантах воплощения, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства или слитая конструкция лекарственного средства не содержит антитело мыши, крысы и/или кролика, которое связывает сывороточный альбумин, или антигенсвязывающий фрагмент такого антитела.

Антигенсвязывающий фрагмент может связывать сывороточный альбумин с любым желаемым сродством, on rate и off rate (on rate - скорость ассоциации двух молекул, off rate - скорость диссоциации двух молекул). Сродство (KD), on rate (Кon или ka) и off rate (Кoff или kd), можно выбрать, чтобы получить желаемый период полувыведения в сыворотке для конкретного лекарственного средства. Например, может оказаться желательным получить максимальный период полувыведения в сыворотке для лекарственного средства, которое нейтрализует воспалительный медиатор хронического воспалительного заболевания (например, dAb, которое связывает и нейтрализует воспалительный цитокин), в то время как более короткий период полувыведения в сыворотке может быть желательным для лекарственного средства, которое обладает некоторой токсичностью (например, химиотерапевтический агент). Обычно, предпочтительной является быстрая on rate и быстрая или умеренная off rate для связывания сывороточного альбумина. Конъюгаты лекарственного средства и слитые конструкции лекарственного средства, которые содержат антигенсвязывающий фрагмент с данными характеристиками, будут быстро связывать сывороточный альбумин после введения, а также будут быстро диссоциировать и повторно связывать сывороточный альбумин. Данные характеристики будут уменьшать быстрое выведение лекарственного средства (например, почками), но, тем не менее, будут обеспечивать эффективную доставку и доступ к лекарственной мишени.

Антигенсвязывающий фрагмент, который связывает сывороточный альбумин (например, dAb), обычно связывается с KD, равным примерно от 1 нМ до примерно 500 мкМ. В некоторых вариантах воплощения, антигенсвязывающий фрагмент связывает сывороточный альбумин с KD (KD=Koff(kd)/Кon(ka)), равным от примерно 10 до примерно 100 нМ, или от примерно 100 нМ до примерно 500 нМ, или от примерно 500 нМ до примерно 5 мМ, как установлено поверхностным плазменным резонансом (например, используя прибор BIACORE). В конкретных вариантах воплощения, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства или слитая конструкция лекарственного средства содержит антигенсвязывающий фрагмент антитела (например, dAb), который связывает сывороточный альбумин (например, человеческий сывороточный альбумин) с KD, равным примерно 50 нМ, или примерно 70 нМ, или примерно 100 нМ, или примерно 150 нМ, или примерно 200 нМ. Улучшенные фармакокинетические свойства (например, пролонгированный 11/2 В, увеличенная AUC) конъюгатов лекарственного средства, нековалентных конъюгатов лекарственного средства и слитых конструкций лекарственного средства, описанных в настоящем документе, могут коррелировать со сродством антигенсвязывающего фрагмента, который связывает сывороточный альбумин. Соответственно, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства и слитые конструкции лекарственного средства, которые имеют улучшенные фармакокинетические свойства, могут, как правило, быть получены с использованием антигенсвязывающего фрагмента, который связывает сывороточный альбумин (например, человеческий сывороточный альбумин) с высоким сродством (например, KD примерно 500 нМ или меньше, примерно 250 нМ или меньше, примерно 100 нМ или меньше, примерно 50 нМ или меньше, примерно 10 нМ или меньше или примерно 1 нМ или меньше, или примерно 100 пМ или меньше).

Предпочтительно, лекарственное средство, которое конъюгировано или слито с антигенсвязывающим фрагментом, который связывает сывороточный альбумин, связывается со своей мишенью (лекарственная мишень) со сродством (KD), которое сильнее, чем сродство антигенсвязывающего фрагмента к сывороточному альбумину, и/или Koff (kd), которая быстрее, чем Кoff антигенсвязывающего фрагмента с сывороточным альбумином, что измерено поверхностным плазменным резонансом (например, используя прибор BIACORE). Например, лекарственное средство может связывать свою мишень со сродством, которое примерно от 1 до примерно 100000, или от примерно 100 до примерно 100000, или от примерно 1000 до примерно 100000, или от примерно 10000 до примерно 100000 раз сильнее, чем сродство антигенсвязывающего фрагмента, который связывает SA, к SA. Например, антигенсвязывающий фрагмент антитела, которое связывает SA, может связываться со сродством, равным примерно 10 мкМ, в то время как лекарственное средство связывает свою мишень со сродством, равным примерно 100 пМ.

В конкретных вариантах воплощения, антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, представляет собой dAb, который связывает человеческий сывороточный альбумин. Например, VK dAb, имеющий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26, или VH dAb, имеющий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23. В других вариантах воплощения, антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, представляет собой dAb, которое связывает человеческий сывороточный альбумин и содержит CDRs из любых вышеупомянутых аминокислотных последовательностей. В других вариантах воплощения, антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, представляет собой dAb, который связывает человеческий сывороточный альбумин и содержит аминокислотную последовательность, которая имеет, по меньшей мере, примерно 80%, или, по меньшей мере, примерно 85%, или, по меньшей мере, примерно 90%, или, по меньшей мере, примерно 95%, или, по меньшей мере, примерно 97%, или, по меньшей мере, примерно 98%, или, по меньшей мере, примерно 99% идентичности аминокислотной последовательности с SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 или SEQ ID NO:23. Идентичность аминокислотной последовательности, предпочтительно, устанавливают с использованием подходящего алгоритма выравнивания последовательности и значений параметра по умолчанию, таких как BLAST P (Karlin и Altschul, Proc. Natl. Acad. Sci. USA 87(6):2264-2268 (1990)).

Лекарственные средства

Конкретные композиции лекарственного средства по изобретению (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства) могут содержать любое лекарственное средство (например, малая органическая молекула, нуклеиновая кислота, полипептид), которое можно ввести индивидууму, чтобы произвести благоприятный терапевтический или диагностический эффект, например, посредством связывания с и/или изменения функции биологической молекулы-мишени у индивидуума. Другие композиции лекарственного средства по изобретению (например, слитые конструкции лекарственного средства) могут содержать полипептидное или пептидное лекарственное средство. В предпочтительных вариантах воплощения слитых конструкций лекарственного средства, лекарственное средство не содержит цепь антитела или фрагмент цепи антитела (например, VH, VK, Vλ). В частных вариантах воплощения, лекарственное средство выбирают из инсулинотропного агента и инкретина, глюкагон-подобного пептида 1, GLP-1 пептида, GLP-1 аналога, GLP-1 производного, PYY, PYY пептида, PYY аналога, PYY производного, Эксендин-3, Эксендин-3 пептида, Эксендин-3 аналога, Эксендин-3 производного, Эксендин-4, Эксендин-4 пептида, Эксендин-4 аналога, Эксендин-4 производного или комбинации двух или более этих агентов (например, GLP-1 пептид и PYY пептид).

Подходящие лекарственные средства для применения по изобретению включают, например, иммуносупрессанты (например, циклоспорин А, рапамицин, FK506, преднизон), противовирусные агенты (ацикловир, ганцикловир, индинавир), антибиотики (пенициллин, миноциклин, тетрациклин), противовоспалительные агенты (аспирин, ибупрофен, преднизон), цитотоксины или цитотоксические агенты (например, паклитаксел, цитокалазин В, грамицидин D, этидия бромид, эметин, митомицин С, этопозид, тенопозид, винкристин, винбластин, колхицин, доксорубицин, даунорубицин, дигидрокси антрациндион, митоксантрон, митрамицин, актиномицин D, 1-дигидротестостерон, глюкокортикоиды, прокаин, тетракаин, лидокаин, пропранолол, пуромицин и аналоги или гомологи любых из вышеназванных агентов. Подходящие лекарственные средства также включают антиметаболиты (например, метотрексат, 6-меркаптопурин, 6-тиогуанин, цитарабин, 5-фторурацила декарбазин), алкилирующие агенты (например, мехлоретамин, тиоэпахлорамбуцил, СС-1065, мелфалан, кармустин (BSNU), ломустин (CCNU), циклофосфамид, бусульфан, дибромоманнит, стрептозотоцин, митомицин С и цис-дихлородиамин платины (II) (DDP) цисплатин), антрациклины (например, даунорубицин (ранее дауномицин) и доксорубицин), антибиотики (например, дактиномицин (ранее актиномицин), блеомицин, митрамицин и антрамицин (АМС)), радионуклиды (например, йод-125, -126), иттрий (например, иттрий-90, -91) и празеодимий (например, празеодимий-144, -145), и ингибиторы протеазы (например, ингибиторы матриксных металлопротеиназ). Другие подходящие лекарственные средства представляют собой нуклеиновые кислоты, такие как антисенз-нуклеиновые кислоты и информационная РНК. Калихеамицин также является подходящим для применения по изобретению.

Подходящие лекарственные средства также включают анальгезирующие агенты, включая наркотики (например, кодеин, налмефен, налоксон, фентанил, меперидин, морфин, трамадол, пропоксифен, оксикодон, метадон, налбуфин), нестероидные противовоспалительные агенты (например, индометацин, кеторолак, артротек, ибупрофен, напроксен, салицилат, селекоксиб, рофекоксиб), ацетаминофен, капсаицин, зиконотид и тому подобное.

В конкретных вариантах воплощения, лекарственное средство представляет собой полипептидный токсин, например токсин, такой как абрин, рицин А, псевдомонадный эксотоксин или дифтерийный токсин. Другие подходящие полипептидные лекарственные средства включают антитела или антигенсвязывающие фрагменты (например, dAb) антител, полипептидные агонисты, активаторы, стимуляторы секреции, антагонисты или ингибиторы. Например, полипептидное или пептидное лекарственное средство может связывать и агонизировать или антагонизировать белок клеточной поверхности, такой как CD антиген, цитокиновый рецептор (например, интерлейкиновый рецептор, хемокиновый рецептор), адгезионную молекулу или ко-стимулирующую молекулу. Например, полипептидное лекарственное средство может связывать цитокин, факторы роста, цитокиновый рецептор, рецептор фактора роста и другие лиганды-мишени, которые включают, но не ограничены: АроЕ, Apo-SAA, BDNF, кардиотропин-1 (Cardiotrophin-1), CEA, CD40, лиганд CD40, CD56, CD38, CD138, EGF, рецептор EGF, ENA-78, Эотаксин (Eotaxin), Эотаксин-2, Эксодус-2 (Exodus-2), FAPα, FGF-кислотный, FGF-основной, фибробластный фактор роста-10, лиганд FLT3, Фракталкин (Fractalkine) (CX3C), GDNF, G-CSF, GM-CSF, GF-β1, человеческий сывороточный альбумин, инсулин, IFN-γ, IGF-I, IGF-II, IL-1α, IL-1β, рецептор IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8 (72 аминокислоты), IL-8 (77 аминокислот), IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18 (IGIF), Инхибин α (Inhibin α), Инхибин β, IP-10, кератиноцитарный фактор роста-2 (KGF-2), KGF, Лептин, LIF, Лимфотактин (Lymphotactin), Муллериан (Mullerian(ингибирующее вещество, моноцитный колониеингибирующий фактор, моноцитный белок-аттрактант, M-CSF, MDC (67 аминокислот), MDC (69 аминокислот), МСР-1 (MCAF), МСР-2, МСР-3, МСР-4, MDC (67 аминокислот), MDC (69 аминокислот), MIG, MIP-1α, MIP-1β, MIP-3α, MIP-3β, MIP-4, ингибирующий фактор-1 миелоидного предшественника (MPIF-1), NAP-2, Neurturin, ростовой фактор нервов, β-NGF, NT-3, NT-4, Онкостатин М (Oncostatin M), PDGF-AA, PDGF-AB, PDGF-BB, PF-4, RANTES, SDF1α, SDF1β, SCF, SCGF, фактор стволовых клеток (SCF), TARC, TGF-α, TGF-β, TGF-R2, TGF-β3, фактор некроза опухоли (TNF), TNF-α, TNF-β, TNF рецептор I, TNF рецептор II, TNIL-1, TPO, VEGF, VEGF A, VEGF B, VEGF C, VEGF D, VEGF рецептор 1, VEGF рецептор 2, VEGF рецептор 3, GCP-2, GRO/MGSA, GRO-β, GRO-γ, HCC1, 1-309, HER 1, HER 2, HER 3 и HER 4. Понятно, что этот список ни в коей мере не является исчерпывающим.

Подходящие лекарственные средства также включают гормоны, включая гипофизарный гормон (РТН), адренокортикотропный гормон (АСТН), ренин, лютеинизирующий гормон-рилизинг-фактор (LHRH), гонадолиберин (GnRH), лютеинизирующий гормон (LH), фолликулостимулирующий гормон (FSH), альдостерон и тому подобное. Подходящие лекарственные средства также включают кератиноцитарный фактор роста, интерфероны (например, INF-α, INF-β, INF-γ), эритропоэтин (ЕРО), протеазы, эластазы, аналоги, агонисты и антагонисты LHRH, агонисты опиоидного рецептора, такие как агонисты каппа опиоидного рецептора (например, динорфин А), кальцитонин и аналоги кальцитонина, антидиуретический гормон (вазопрессин), антагонисты окситоцина, вазоактивный пептид кишечника, ингибиторы тромбина, фактор von Willebrand, поверхностно-активные вещества и яд улитки (например, зиконотид).

Подходящие лекарственные средства также включают пептиды и полипептиды, которые имеют противоопухолевые виды активности (например, ингибирование пролиферации, ингибирование роста, индуцирование апоптоза, ингибирование метастазирования, ингибирование адгезии, ингибирование реваскуляризации). Несколько таких пептидов и полипептидов известны в данной области. (См., например, Janin Y.L., Amino Acids, 25:1-40 (2003). Содержание этой ссылки, особенно пептиды и полипептиды, описанные в данном документе, включено во всей полноте в настоящее описание посредством ссылки.) Аминокислотные последовательности нескольких таких пептидов представлены в Таблице 8.

Другие подходящие лекарственные средства включают пептиды и полипептиды, которые имеют противовирусную активность. Несколько таких пептидов и полипептидов известны в данной области, например, пептиды и полипептиды, раскрытые в Giannecchini, et al., J Viro., 77(6):3724-33 (2003); Wang, J., et al., Clin Chem (2003); Hilleman, M.R, Vaccine, 21(32):4626-49 (2003); Tziveleka, LA, et al., Curr Top Med Chem, 3(13):1512-35 (2003); Poritz, M.A., etal., Virology, 313(1):170-83 (2003); Oevermann, A., et al., Antiviral Res, 59(7):23-33 (2003); Cole, A.M. etal.. Curr Pharm Des, 9(18):1463-73 (2003); Pinon, J.D., et al., Virol, 77(5):3281-90 (2003); Sia, S.K., et al., Proc Natl Acad Sci USA, 99(23):14664-9 (2002); Bahbouhi, В., etal.. Biochem J, 66(Pt 3):863-72 (2002); de Soultrait, V.R., et al., J Mol Biol, 18(1):45-58 (2002); Witherell, G., Curr Opin Investig Drugs, 2(3):340-7 (2001); Ruff, M.R., et al., Antiviral Res, 52(1):63-75 (2001); Bultmann, H., et al., J. Virol, 75(6):2634-45 (2001); Egal, M., et al., Int J Antimicrob Agents, 13(1):57-60 (1999); и Robinson, W.E., Jr., J Leukoc Biol, 63(1):94-100 (1998). Содержание этих ссылок, особенно пептиды и полипептиды, описанные в данных документах, включено во всей полноте в настоящее описание посредством ссылки. Данные пептиды и полипептиды представляют собой примеры лекарственных средств, которые можно применять в композициях, слитых конструкциях лекарственного средства, конъюгатах лекарственного средства, нековалентных конъюгатах лекарственного средства по настоящему изобретению.

Полипептидное лекарственное средство может также представлять собой цитокин, или фактор роста, или растворимую часть рецептора (например, рецептора цитокина, рецептора фактора роста, рецептора гормона), или другой полипептид, такой как полипептиды, перечисленные выше. Например, подходящие полипептидные лекарственные средства также включают агонисты и антагонисты рецептора (например, рецептора фактора роста, рецептора цитокина, рецептора гормона), такие как рецепторный антагонист интерлейкина 1 (Eisenberg et el., Nature 343:341-346 (1990)), агонисты рецептора тромбопоэтина (например, GW395058 (de Serres et al., Stem Cells 17:316-326 (1999)), антагонисты рецептора меланокортина (например, MCR-4 антагонисты (Cepoi et al., Brain Res. 1000:64-71 (2004)), ангинекс, 6DBF7 (Mayo et al., J. Biol. Chem. 278:45746-45752 (2003)), миметики хемокина (например, RANTES миметики (Nardese et al., Nat. Struct. Biol. 8:611-615 (2001)), гормон роста (например, человеческий гормон роста), аналоги гормона роста и стимуляторы секреции гормона роста (например, СР-424391 (MacAndrew et al., Eur. J. Pharmacol. 432:195-202 (2001)), миметики гормона роста высвобождающего гормона (например, МК-677 (Chapman et al., J. Clin. Endocrinol. Metab. 82:3455-3463 (1997)), ингибиторы взаимодействия клеточной адгезионной молекулы (например, LFA-1/ICAM-1, VLA-1/VCAM-1 (Yusuf-Makagiansar et al., Med. Res. Rev. 22:146-167 (2002)), миметики интерферона (например, SYR6 (Sato et al., Biochem. J. 371(Pt.2):603-608 (2003), миметики герцептина (Nature Biotechnol. 18:137 (2000)), ингибиторы презентации антигена (Bolin et al., J. Med. Chem. 43:2135:2148 (2000)), GPIIB/IIIA антагонисты (например, FK633 (Aoki et al., Thromb. Res. 81:439-450 (1996)), alphavbeta3 антагонисты (например, 8С56631 (Engleman et al., J. Clin. Invest. 99:2284-2292 (1997)), миметики эритропоэтина (например, ЕМР1 (Johnson etal., Biochemistry 37:3699-3710 (1998)), антагонисты опиоидного рецептора (например, [(2S, 3R)-TMT1]DPDPE (Liao et al., J. Med. Chem. 41:4767-4776 (1998)), кроветворные (гематопоэтические) факторы (например, эритропоэтин (ЕРО), гранулоцитный колониестимулирующий фактор (GM-CSF)).

Дополнительные подходящие пептидные и полипептидные лекарственные средства включают пептидные антагонисты, которые связывают человеческий рецептор IL-1 первого типа (например, AF 11377 (FEWTPGYWQPYALPL, SEQ ID NO:56), AF11869 (FEWTPGYWQJYALPL, SEQ ID NO:57 (J=1-азетидин-2-карбоновая кислота), FEWTPGYWQJY (SEQ ID NO:58), FEWTPGWYQJY (SEQ ID NO:59), FEWTPGWYQJYALPL (SEQ ID NO:60) или любую из вышеозначенных последовательностей, возможно, содержащих ацилированный аминоконец и/или аминированный карбоксильный конец (Akeson et al., J. Biol. Chem. 271:30517-305123 (1996)), пептидные антагонисты TNF-альфа-опосредованной цитотоксичности (например, таковые, описанные в Chirinos-Rojas et al, J. Immunol. 161:5621-5626 (1998)), пептидные агонисты рецептора эритропоэтина (например, таковые, описанные в McConnel et al., Biol. Chem. 379:1279-1286 (1998) или Wrighton et al., Science 273:458-464 (1996)), глюкагон-подобный пептид-1 (GLP-1, например, GLP-1(7-37), GLP-1(7-36)амид и их аналоги (см., например, Ritzel U. et al., J. Endocrinology 159:93-102 (1998)) и интерфероны (например, INF-α, INF-β, INF-λ). Дополнительные подходящие полипептидные и пептидные лекарственные средства включают ингибиторы интегрина (например, RGD пептиды, такие как Н-Glu[цикло(Arg-Gly-Asp-D-Phe-Lys)]2 (Janssen, M.L, et al., Cancer Research 62:6146-6151 (2002)), цикло(Arg-Gly-Asp-D-Phe-Lys) (Kantlehner M., et al., Agnew. Chem. Int. Ed. 38:560 (1999)), цикло(Arg-Gly-Asp-D-Tyr-Lys) (Haubner, R., etal., J. Nucl. Med. 42:326-336 (2001)), белки, инактивирующие рибосому (RIPs), такие как Сапорин (например, SEQ ID NO:67), ингибиторы матриксной металлопротеиназы (например, Патент США №5616605), и противовирусные пептиды и полипептиды, такие как слитые ингибиторы HIV (например, Т-1249 и Т-20 (FUZEON® (энфувиртид); Trimeris Inc.), и растворимые антагонисты рецепторов, такие как иммуноадгезины (например, LFA3-Ig, CTLA4-Ig).

Противомикробные полипептидные и пептидные лекарственные средства также пригодны для применения по изобретению. Примеры подходящих противомикробных полипептидных и пептидных лекарственных средств включают аденорегулин, дермцидин-1 L, кателицидины (например, кателицидин-подобный пептид, человеческий LL-37/hCAP-18), дефенсины, включая α-дефенсины (например, человеческий нейтрофильный пептид 1 (HNP-1), HNP-2, HNP-3, HNP-4, человеческий дефенсин 5, человеческий дефенсин 6), β-дефенсины (например, человеческий β-дефенсин-1, человеческий θ-дефенсин-2) и θ-дефенсины (например, θ-дефенсин-1), гистатины (например, гистатин 1, гистатин 3, гистатин 5), пептид - производное лактоферрицина и родственные пептиды (см., Tomita M., et al., Acta Paediatr. Jpn. 36:585-591 (1994) и Strom, M.S., etal. Biochem Cell вiоl. 80:65-74 (2002)).

В предпочтительном варианте воплощения изобретения лекарственные средства представляют собой инсулинотропные лекарственные средства. Примеры подходящих инсулинотропных лекарственных средств включают GLP-1, производное GLP-1, аналоги GLP-1 или производное аналога GLP-1. Дополнительно они включают Эксендин-4, аналоги Эксендин-4 и производные Эксендин-4, а также Эксендин-3, производные Эксендин-3 и аналоги Эксендин-3.

Другие подходящие лекарственные средства включают Пептид YY (3-36) или аналоги. Пептид YY (PYY) представляет собой пептидный амид из 36 остатков, выделенный впервые из свиного кишечника и локализованный в эндокриноцитах желудочно-кишечного тракта и поджелудочной железы (Tatemoto, et al. Proc. Natl. Acad. Sci. 79:2514, 1982). Пептид YY имеет N-концевой и С-концевой тирозиновые амиды; соответственно, эти два тирозина дают PYY его имя (Y представляет аминокислоту тирозин в пептидной номенклатуре). Кроме того, PYY делит ряд центральных и периферических регуляторных функций со своим гомологичным пептидом нейропептидом Y (NPY), который был впервые выделен из мозга свиньи (Tatemoto, Proc. Natl. Acad. Sci. 79:5485, 1982). В противоположность клеточному местонахождению PYY, NPY находится в подслизистых нейронах и нейронах, относящихся к мышечной оболочке кишечника, которые иннервируют слизистые оболочки и гладкомышечные слои, соответственно (Ekblad et al. Neuroscience 20:169, 1987). Полагают, что PYY, а также NPY ингибируют перистальтику кишечника и кровоток (Laburthe, Trends Endocrinol. Metab. 1:168, 1990), и полагают, что они также ослабляют базальную (Сох еt al. Br. J. Pharmacol. 101:247, 1990) и индуцированную стимуляторами секреции кишечную секрецию у крыс (Lundberg et al. Proc. Natl. Acad. Sci. USA 79:4471, 1982), а также стимулируют всасывание в кишечнике (MacFadyen et al. Neuropeptides 7:219, 1986). Все вместе эти наблюдения предлагают, что PYY и NPY высвобождаются в кровоток после принятия пищи (Adrian et al. Gastroenterology 89:1070, 1985; Balasubramaniam et al. Neuropeptides 14:209, 1989) и, таким образом, играют физиологическую роль в регулировании кишечной секреции и всасывания.

В кишечном эпителии крыс была охарактеризована PYY рецепторная система высокого сродства, которая проявляет немного большее сродство к PYY, нежели к NPY (Laburthe et al. Endocrinology 118:1910, 1986) и, как показано, является негативно связанной с аденилат-циклазой (Servin et al. Endocrinology 124:692, 1989). Исследования взаимосвязи структура-активность с использованием нескольких подпоследовательностей (частичных последовательностей) привели к идентификации PYY(22-36) в качестве активного сайта для взаимодействия с кишечными PYY рецепторами (Balsubramaniam et al. Pept. Res. 1:32, 1988).

Дополнительно, PYY был вовлечен в ряд физиологических видов активности, включая поглощение питательных веществ (Bilcheik et al. Digestive Disease Week 506:623, 1993), клеточную пролиферацию (Laburthe, Trends Endocrinol. Metab. 1:168, 1990; Voisin et al. J. Biol. Chem, 1993), липолиз (расщепление жиров) (Valet et al., J. Clin. Invest. 291, 1990) и сужение кровеносных сосудов (Lundberg etal., Proc. Natl. Acad. Sci., USA 79: 4471, 1982).

В WO 03/057235 и WO 03/026591 описан способ уменьшения потребления калорий, потребления пищи и понижения аппетита путем введения PYY или агониста и GLP-1. Эти публикации включены в настоящий документ во всей полноте посредством ссылки, особенно для приведения примеров лекарственных средств на основе PYY и GLP-1 и способов, которые можно применять по настоящему изобретению.

Дополнительные другие лекарственные средства, подходящие для применения в изобретении, включают инсулин, Резистин (Resistin), Лептин (Leptin), антагонист MC3R/MC4R, антагонист AgRP, Аполипопротеин A-IV, Enterostatin, Гастрин-Высвобождающий Пептид (GRP), IGF1, BMP-9, IL-22, RegIV, интерферон альфа, INGAP пептид, соматостатин, амилин, нейрулин, интерферон бета, гибриды интерферона, адипонектин, эндоканнабиноиды, пептид С, WNT10b, Орексин-А (Orexin-A), адренокортикотропин, Энтеростатин (Enterostatin), Холецистокинин (Cholecystokinin), оксинтомодулин, меланоцитстимулирующие гормоны, меланокортин, меланинконцентрирующий гормон, ВВ-2, NPY Y2 агонисты, NPY Y5/Y1 антагонисты, ОХМ, Gal-1 R антагонисты, MCH-1R антагонисты, МС-3/4 агонисты, BRS-3 агонисты, панкреатический полипептид, фрагмент антитела против грелина, нейротрофический фактор на основе мозга, человеческий гормон роста, паратиреоидный гормон, фолликулостимулирующий гормон, желудочный ингибиторный пептид или его аналог.

Слитые конструкции лекарственного средства

Слитые конструкции лекарственного средства по изобретению представляют собой слитые белки, которые содержат непрерывную полипептидную цепь, причем указанная цепь содержит антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, в качестве первой группировки, связанную со второй группировкой, которая представляет собой полипептидное лекарственное средство. Первая и вторая группировки могут быть напрямую связаны друг с другом пептидной связью или связаны посредством подходящей аминокислоты, или пептидного или полипептидного линкера. Дополнительные группировки (например, третья, четвертая) и/или линкерные последовательности могут присутствовать при необходимости. Первая группировка может находиться в N-концевом положении, С-концевом положении или внутри по отношению ко второй группировке (т.е. полипептидному лекарственному средству). В конкретных вариантах воплощения, каждая группировка может присутствовать в более чем одной копии. Например, слитая конструкция лекарственного средства может содержать две или более первых группировок, каждая из которых содержит антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин (например, VH, который связывает человеческий сывороточный альбумин, и VL, который связывает человеческий сывороточный альбумин, или два или более VHs или VLs, которые связывают человеческий сывороточный альбумин).

В некоторых вариантах воплощения, слитая конструкция лекарственного средства представляет собой непрерывную полипептидную цепь, которая имеет формулу:

a-(X)m-b-(Y)n2-c-(Z)n3-d или a-(Z)n3-b-(Y)n2-c-(X)n1-d,

где Х представляет собой полипептидное лекарственное средство, которое имеет связывающую специфичность в отношении первой мишени;

Y представляет собой одноцепочечный антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина;

Z представляет собой полипептидное лекарственное средство, которое имеет связывающую специфичность в отношении второй мишени;

Каждое из а, b, с и d независимо отсутствует либо имеет от одного до примерно 100 аминокислотных остатков;

n1 равно от одного до примерно 10;

n2 равно от одного до примерно 10; и

n3 равно от нуля до примерно 10,

при условии, что, если оба n1 и n2 равны одному, а n3 равно нулю, Х не содержит цепь антитела или фрагмент цепи антитела.

В одном варианте воплощения, ни X, ни Z не содержит цепь антитела или фрагмент цепи антитела. В одном варианте воплощения, n1 равно одному, n3 равно одному и n2 равно двум, трем, четырем, пяти, шести, семи, восьми или девяти. Предпочтительно, Y представляет собой вариабельный домен тяжелой цепи иммуноглобулина (VH), который имеет связывающую специфичность в отношении сывороточного альбумина, или вариабельный домен легкой цепи иммуноглобулина (VL), который имеет связывающую специфичность в отношении сывороточного альбумина. Более предпочтительно, Y представляет собой dAb (например, VH, VK или Vλ), которое связывает человеческий сывороточный альбумин. В конкретном варианте воплощения, Х или Z представляет собой человеческий GLP-1 или производные GLP-1 или их аналог.

В конкретных вариантах воплощения, Y содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26. В других вариантах воплощения, Y содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23.

В других вариантах воплощения, слитая конструкция лекарственного средства содержит группировки X' и Y', где X' представляет собой полипептидное лекарственное средство при условии, что X' не содержит цепь антитела или фрагмент цепи антитела, и Y' представляет собой одноцепочечный антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина. Предпочтительно, Y' представляет собой вариабельный домен тяжелой цепи иммуноглобулина (VH), который имеет связывающую специфичность в отношении сывороточного альбумина, или вариабельный домен легкой цепи иммуноглобулина (VL), который имеет связывающую специфичность в отношении сывороточного альбумина. Более предпочтительно, Y' представляет собой dAb (например, VH, VK или Vλ), которое связывает человеческий сывороточный альбумин. X' может быть расположена на аминоконце по отношению к Y', или Y' может быть расположена на аминоконце по отношению к X'. В некоторых вариантах воплощения, X' и Y' разделены аминокислотой или пептидным или полипептидным линкером, который содержит от двух до примерно 100 аминокислот. В конкретном варианте воплощения, X' представляет собой человеческий GLP-1 или производное GLP-1 или их аналоги.

В конкретных вариантах воплощения, Y' содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26. В других вариантах воплощения, Y' содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23.

В конкретных вариантах воплощения, слитая конструкция лекарственного средства содержит dAb, которое связывает сывороточный альбумин и человеческий IL-1ra (например, SEQ ID NO:28). Предпочтительно, dAb связывает человеческий сывороточный альбумин и содержит человеческие каркасные области.

В других вариантах воплощения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит функциональный вариант человеческого IL-1ra, который имеет, по меньшей мере, примерно 80%, или, по меньшей мере, примерно 85%, или, по меньшей мере, примерно 90%, или, по меньшей мере, примерно 95%, или, по меньшей мере, примерно 96%, или, по меньшей мере, примерно 97%, или, по меньшей мере, примерно 98%, или, по меньшей мере, примерно 99% идентичности аминокислотной последовательности с зрелой формой человеческого IL-1ra, состоящего из 152 аминокислот, и является антагонистом рецептора типа 1 человеческого интерлейкина-1. (См., Eisenberg et al; Nature 343:341-346 (1990).) Вариант может содержать одну или более дополнительных аминокислот (например, содержать 153 или 154 или более аминокислот). Слитые конструкции лекарственного средства по изобретению можно получить любыми подходящими способами. Например, некоторые варианты воплощения можно получить путем вставки нуклеиновой кислоты, кодирующей слитую конструкцию лекарственного средства, в подходящий экспрессирующий вектор. Полученную в результате конструкцию затем внедряют в подходящую клетку-хозяина для экспрессии. После экспрессии слитый белок можно выделить или очистить из клеточного лизата или, предпочтительно, из культуральной среды или периплазмы, используя любые подходящие способы. (См., например, Current Protocols in Molecular Biology (Ausubel, F.M. et al., eds., Vol.2, Suppl. 26, pp.16.4.1-16.7.8 (1991)).

В дополнительном варианте воплощения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит инсулинотропный агент.В предпочтительном варианте воплощения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит GLP-1 или аналог или пептид GLP-1. В более предпочтительном варианте воплощения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит Ser8GLP-1 (7-36) амид.

В дополнительном варианте воплощения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит аналог GLP-1, имеющий одно или более следующих замещений: Val8 или Pro9.

Предпочтительно, аналог GLP-1 представляет собой Pro9GLP-1(7-36) или Pro9GLP-1(7-37). Дополнительно аналог или пептид GLP-1 могут включать любое из следующих С-концевых удлинений: PSS, PSSGAP или PSSGAPPPS.

В другом варианте воплощения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит аналог GLP-1, содержащий последовательность Формулы I:

His7-Xaa8-Xaa9-Glyl0-Xaall-Phel2-Thrl3-Xaal4-Aspl5-Xaal6-Xaal7-Xaal8-Xaal9-Xaa20-Xaa21-Xaa22-Xaa23-Xaa24-Xaa25-Xaa26-Xaa27-Phe28-Ile29-Xaa30-Xaa31-Xaa32-Xaa33-Хаа34-Хаа35-Хаа36-Хаа37-Хаа38-Хаа39-Хаа40-Хаа41-Хаа42-Хаа43-Хаа44-Хаа45

Формула I - SEQ ID NO:172,

где

Хаа в положении 8 представляет собой Ala, Gly, Ser, Thr, Leu, Ile, Val, Glu, Asp или Lys;

Хаа в положении 9 представляет собой Glu или Asp;

Хаа в положении 11 представляет собой Thr, Ala, Gly, Ser, Leu, Ile, Val, Glu, Asp или Lys;

Хаа в положении 14 представляет собой Ser, Ala, Gly, Thr, Leu, Ile, Val, Glu, Asp или Lys;

Хаа в положении 16 представляет собой Val, Ala, Gly, Ser, Thr, Leu, Ile, Туr, Glu, Asp, Trp или Lys;

Хаа в положении 17 представляет собой Ser, Ala, Gly, Thr, Leu, Ile, Val,

Glu, Asp или Lys; Хаа в положении 18 представляет собой Ser, Ala, Gly, Thr, Leu, Ile, Val, Glu, Asp, Trp, Tyr или Lys;

Хаа в положении 19 представляет собой Tyr, Phe, Trp, Glu, Asp, Gin или Lys;

Хаа в положении 20 представляет собой Leu, Ala, Gly, Ser, Thr, Ile, Val, Glu, Asp, Met, Trp, Tyr или Lys;

Хаа в положении 21 представляет собой Glu, Asp или Lys;

Хаа в положении 22 представляет собой Gly, Ala, Ser, Thr, Leu, Ile, Val, Glu, Asp или Lys;

Хаа в положении 23 представляет собой Gln, Asn, Arg, Glu, Asp или Lys;

Хаа в положении 24 представляет собой Ala, Gly, Ser, Thr, Leu, Ile, Val, Arg, Glu, Asp или Lys;

Хаа в положении 25 представляет собой Ala, Gly, Ser, Thr, Leu, Ile, Val, Glu, Asp или Lys;

Хаа в положении 26 представляет собой Lys, Arg, Gin, Glu, Asp или His;

Хаа в положении 27 представляет собой Leu, Glu, Asp или Lys;

Хаа в положении 30 представляет собой Ala, Gly, Ser, Thr, Leu, Ile, Val, Glu, Asp Lys;

Хаа в положении 31 представляет собой Trp, Phe, Tyr, Glu, Asp Lys;

Хаа в положении 32 представляет собой Leu, Gly, Ala, Ser, Thr, Ile, Val, Glu, Asp или Lys;

Хаа в положении 33 представляет собой Val, Gly, Ala, Ser, Thr, Leu, Ile, Glu, Asp или Lys;

Хаа в положении 34 представляет собой Asn, Lys, Arg, Glu, Asp или His;

Хаа в положении 35 представляет собой Gly, Ala, Ser, Thr, Leu, Ile, Val, Glu, Asp или Lys;

Хаа в положении 36 представляет собой Gly, Arg, Lys, Glu, Asp или His;

Хаа в положении 37 представляет собой Pro, Gly, Ala, Ser, Thr, Leu, Ile, Val, Glu, Asp или Lys или удалена;

Хаа в положении 38 представляет собой Ser, Arg, Lys, Glu, Asp или His или удалена;

Хаа в положении 39 представляет собой Ser, Arg, Lys, Glu, Asp или His или удалена;

Хаа в положении 40 представляет собой Gly, Asp, Glu или Lys или удалена;

Хаа в положении 41 представляет собой Ala, Phe, Trp, Туr, Glu, Asp или Lys или удалена;

Хаа в положении 42 представляет собой Ser, Pro, Lys, Glu или Asp или удалена;

Хаа в положении 43 представляет собой Ser, Pro, Glu, Asp или Lys или удалена;

Хаа в положении 44 представляет собой Gly, Pro, Glu, Asp или Lys или удалена;

и Хаа в положении 45 представляет собой Ala, Ser, Val, Glu, Asp или Lys или удалена, при условии, что, когда аминокислота в положении 37, 38, 39, 40, 41, 42, 43 или 44 удалена, тогда каждая аминокислота после той аминокислоты также удалена.

В другом варианте воплощения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит аналог GLP-1, который содержит аминокислотную последовательность Формулы (II):

Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaal6-Ser-Xaal8-Xaal9-Xaa20-Glu-Xaa22-Xaa23-Ala-Xaa25-Xaa26-Xaa27-Phe-Ile-Xaa30-Trp-Leu-Xaa33-Хаа34-Хаа35-Хаа36-Хаа37-Хаа38-Хаа39-Хаа40-Хаа41-Хаа42-Хаа43-Хаа44-Хаа45-Хаа46

Формула (II) - SEQ ID NO:173,

где

Хаа7 представляет собой L-гистидин, D-гистидин, дезаминогистидин, 2-амино- гистидин, β-гидрокси-гистидин, гомогистидин, Nα-ацетил-гистидин, α-фторометил-гистидин, α-метил-гистидин, 3-пиридилаланин, 2-пиридилаланин или 4-пиридилаланин;

Хаа8 представляет собой Ala, Gly, Val, Leu, lie, Lys, Aib, (1-аминоциклопропил)карбоновую кислоту, (1-аминоциклобутил)карбоновую кислоту, (1-аминоциклопентил)карбоновую кислоту, (1-аминоциклогексил)карбоновую кислоту, (1 -аминоциклогептил)карбоновую кислоту или (1-аминоциклооктил)карбоновую кислоту;

Хаа16 представляет собой Val или Leu;

Хаа18 представляет собой Ser, Lys или Arg;

Хаа19 представляет собой Туr или Gln;

Хаа20 представляет собой Leu или Met;

Хаа22 представляет собой Gly, Glu или Aib;

Хаа23 представляет собой Gln, Glu, Lys или Arg;

Хаа25 представляет собой Ala или Val;

Хаа26 представляет собой Lys, Glu или Arg;

Хаа27 представляет собой Glu или Leu;

Хаа30 представляет собой Ala, Glu или Arg;

Хаа33 представляет собой Val или Lys;

Хаа34 представляет собой Lys, Glu, Asn или Arg;

Хаа35 представляет собой Gly или Aib;

Хаа36 представляет собой Arg, Gly или Lys;

Хаа37 представляет собой Gly, Ala, Glu, Pro, Lys, амид или отсутствует;

Хаа38 представляет собой Lys, Ser, амид или отсутствует;

Хаа39 представляет собой Ser, Lys, амид или отсутствует;

Хаа40 представляет собой Gly, амид или отсутствует;

Хаа41 представляет собой Ala, амид или отсутствует;

Хаа42 представляет собой Pro, амид или отсутствует;

Хаа43 представляет собой Pro, амид или отсутствует;

Хаа44 представляет собой Pro, амид или отсутствует;

Хаа45 представляет собой Ser, амид или отсутствует;

Хаа46 представляет собой амид или отсутствует, при условии, что, если Хаа38, Хаа39, Хаа40, Хаа41, Хаа42, Хаа43, Хаа44, Хаа45 или Хаа46 отсутствует, тогда каждый последующий аминокислотный остаток тоже отсутствует.

В другом варианте воплощения изобретения, слитая конструкция лекарственного средства или конъюгат лекарственного средства содержит пептид GLP-1, содержащий аминокислотную последовательность Формулы (III):

Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Xaa18-Tyr-Leu-Glu-Xaa22-Xaa23-Ala-Ala-Xaa26-Glu-Phe-lle-Xaa30-Tip-Leu-Val-Xaa34-Xaa35-Xaa36-Xaa37-Xaa38

Формула (III) - SEQ ID NO:174,

где

Хаа7 представляет собой L-гистидин, D-гистидин, дезамино-гистидин, 2-амино-гистидин, β-гидрокси-гистидин, гомогистидин, N'1-ацетил-гистидин, α-фторометил-гистидин, α-метил-гистидин, 3-пиридилаланин, 2-пиридилаланин или 4-пиридилаланин;

Хаа8 представляет собой Ala, Gly, Val, Leu, Ile, Lys, α-аминоизомасляную кислоту (Aib), (1-аминоциклопропил)карбоновую кислоту, (1-аминоциклобутил)карбоновую кислоту, (1-аминоциклопентил)карбоновую кислоту, (1-аминоциклогексил)карбоновую кислоту, (1-аминоциклогептил)карбоновую кислоту или (1-аминоциклооктил)карбоновую кислоту;

Хаа18 представляет собой Ser, Lys или Arg;

Хаа22 представляет собой Gly, Glu или Aib;

Хаа23 представляет собой Gln, Glu, Lys или Arg;

Хаа26 представляет собой Lys, Glu или Arg;

Хаа30 представляет собой Ala, Glu или Arg;

Хаа34 представляет собой Lys, Glu или Arg;

Хаа35 представляет собой Gly или Aib;

Хаа36 представляет собой Arg или Lys;

Хаа37 представляет собой Gly, Ala, Glu или Lys;

Хаа38 представляет собой Lys, амид или отсутствует.

В дополнительном другом варианте воплощения изобретения, пептид GLP-1 выбирают из группы, состоящей из: GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)-амид, GLP-1 (7-37), GLP-1 (7-38), GLP-1 (7-39), GLP-1 (7-40), GLP-1 (7-41), или его аналога или пептида.

В другом варианте воплощения изобретения, пептид GLP-1 представляет собой GLP-1 (А-В), где А представляет собой целое число от 1 до 7, а В представляет собой целое число от 37 до 45, или его аналог, содержащий один альбуминсвязывающий остаток, прикрепленный через гидрофильный спейсер к С-концевому аминокислотному остатку, и, возможно, второй альбуминсвязывающий остаток, прикрепленный к одному из других аминокислотных остатков.

В другом варианте воплощения, пептид GLP-1 содержит не более чем пятнадцать аминокислотных остатков, которые были заменены, добавлены или удалены по сравнению с GLP-1 (7-37), или не более чем десять аминокислотных остатков, которые были заменены, добавлены или удалены по сравнению с GLP-1 (7-37).

В другом варианте воплощения, пептид GLP-1 содержит не более чем шесть (предпочтительно, не более чем 5, 4, 3, 2 или 1) аминокислотных остатков, которые были заменены, добавлены или удалены по сравнению с GLP-1 (7-37).

В другом варианте воплощения, пептид GLP-1 содержит не более чем 4 (предпочтительно, не более чем 3, 2 или 1) аминокислотных остатков, которые не кодируются генетическим кодом.

В другом варианте воплощения, пептид GLP-1 представляет собой защищенный DPPIV пептид GLP-1.

В другом варианте воплощения, инсулинотропный агент стабилизирован при помощи DPPIV.

В другом варианте воплощения, пептид GLP-1 содержит остаток а-аминоизомасляной кислоты (Aib) в положении 8.

В другом варианте воплощения, аминокислотный остаток в положении 7 указанного пептида GLP-1 выбран из группы, состоящей из D-гистидина, дезамино-гистидина, 2-амино-гистидина, β-гидрокси-гистидина, гомогистидина, Nα-ацетил-гистидина, α-фторметил-гистидина, α-метил-гистидина, 3-пиридилаланина, 2-пиридилаланина и 4-пиридилаланина.

В другом варианте воплощения, пептид GLP-1 выбран из группы, состоящей из:

Arg26,34Lys36GLP-1(7-37), Gly8Arg26,34Lys36GLP-1(7-37), Aib8,35Lys37 GLP-1(7-37)-OH, Ala8Arg26,34Lys38GLP-1(7-38), Aib8,22,35Lys38GLP-1(7-38), Aib8Arg26,34Lys36GLP-1(7-36), Gly8Arg26,34Lys36GLP-1(7-37)-OH,

Aib8,22,35Lys37GLP-1(7-37)-NH2, Aib8Arg34GLP-1(7-37), Gly8Arg26,34Lys38GLP-1(7-38), Arg34GLP-1(7-37)-OH, Gly8Glu22,23,30Arg18,26,34Lys38GLP-1(7-38),

имидазолилпропионовая кислота7Asp18Aib22,35Lys38GLP-1(7-38), имидазолилпропионовая кислота7Aib22,35Lys38GLP-1(7-38}, [3-(5-имидaзoил)пpoпиoнил]7Aib8Arg26,34Lys38GLP-1(7-38) и Aib8,22Lys37GLP-1(7-38).

В другом варианте воплощения, пептид GLP-1 прикрепляют к гидрофильному спейсеру через аминокислотный остаток в положении 23, 26, 34, 36 или 38 нативного GLP-1 или аналога GLP-1.

В другом варианте воплощения, инсулинотропный агент представляет собой Lys20Экceндин-4(1-39)-NH2.

В другом варианте воплощения, пептид GLP-1 представляет собой

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-

амид-SEQ ID NO:175.

В другом варианте воплощения, пептид GLP-1 представляет собой

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGX|

-SEQ ID NO:176,

где Х=Р или Y или его фрагмент или аналог.

В другом варианте воплощения изобретения, пептид GLP-1 представляет собой Arg18, Leu20, Gln34, Lys33 (Nε-(γ-aминoбyтиpoил(Nα-гeкcaдeкaнoил))) Эксендин-4-(7-45)-амид или Arg33, Leu20, Gin34, Lys18 (Nα-(&гамма;-aминoбyтиpoил(Nα-гeкcaдeкaнoил))) Эксендин-4-(7-45)-амид.

Примеры инсулинотропных агенaтов, которые могут быть полезными в качестве аналогов GLP-1 или производных GLP-1 или GLP-1-подобных лекарственных средств согласно настоящему изобретению, описаны в международной патентной заявке №WO 87/06941 (The General Hospital Corporation), которая относится к пептидному фрагменту, который содержит GLP-1 (7-37) и его функциональные производные, а также к его применению в качестве инсулинотропного агента (включено в настоящий документ посредством ссылки, особенно в части примеров лекарственных средств для применения в настоящем изобретении).

Дополнительные аналоги GLP-1 описаны в международной патентной заявке №90/11296 (The General Hospital Corporation), которая относится к пептидным фрагментам, которые содержат GLP-1 (7-36) и его функциональные производные и имеют инсулинотропную активность, которая превышает инсулинотропную активность GLP-1 (7-36) или GLP-1 (7-37), и к их применению в качестве инсулинотропных агентов (включено в настоящий документ посредством ссылки, особенно в части примеров лекарственных средств для применения в настоящем изобретении).

В Международной Заявке на Патент № WO 91/11457 (Buckley et al.) раскрыты аналоги активных GLP-1 пептидов 7-34, 7-35, 7-36 и 7-37, которые могут быть также полезными в качестве GLP-1 лекарственных средств согласно настоящему изобретению (включено в настоящий документ посредством ссылки, особенно в части примеров лекарственных средств для применения в настоящем изобретении).

Дополнительные Эксендин-аналоги, которые являются полезными для настоящего изобретения, описаны в РСТ заявках на патент WO 99/25728 (Beeley et al.), WO 99/25727 (Beeley et al.), WO 98/05351 (Young et al.), WO 99/40788 (Young et al.), WO 99/07404 (Beeley et al.) и WO 99/43708 (Knudsen et al.) (все включены в настоящий документ посредством ссылки, особенно в части примеров лекарственных средств для применения в настоящем изобретении).

Подходящие экспрессирующие векторы могут содержать ряд компонентов, например репликатор, ген селектируемого маркера, один или более элементов, регулирующих экспрессию, таких как элемент регулирования транскрипции (например, промотор, энхансер, терминатор) и/или один или более сигналов трансляции, сигнальную последовательность или лидерную последовательность и тому подобное. Элементы, регулирующие экспрессию, и сигнальная последовательность, если присутствуют, могут быть предоставлены вектором или другим источником. Например, транскрипционная и/или трансляционная контрольные последовательности клонированной нуклеиновой кислоты, кодирующей цепь антитела, можно использовать для направления экспрессии.

Можно предоставить промотор для экспрессии в желаемой клетке-хозяине. Промоторы могут быть конститутивные или индуцируемые. Например, промотор может быть функционально связан с нуклеиновой кислотой, кодирующей антитело, цепь антитела или его часть, так что он направляет транскрипцию нуклеиновой кислоты. Доступно множество подходящих промоторов для прокариотических (например, lac, tac, Т3, Т7 промоторы для E.соli) и эукариотических (например, ранний или поздний промотор обезьяньего вируса 40, промотор длинного концевого повтора вируса саркомы Rous, цитомегаловирусный промотор, аденовирусный поздний промотор) хозяев.

Кроме того, экспрессирующие векторы, как правило, содержат селектируемый маркер для выбора клеток-хозяев, несущих вектор, и, в случае воспроизводимого экспрессирующего вектора, репликатор. Гены, кодирующие продукты, которые придают устойчивость к антибиотикам или лекарственному средству, представляют собой обычные селектируемые маркеры и могут применяться в прокариотических (например, ген лактамазы (устойчивость к ампициллину), Tet ген для устойчивости к тетрациклину) и эукариотических клетках (например, неомицин (G418 или генетицин), gpt (микофеноловая кислота), гены устойчивости к ампициллину или гигромицину). Дигидрофолатредуктазные маркерные гены позволяют осуществить селекцию с использованием метотрексата в различных хозяевах. Гены, кодирующие генетический продукт ауксотрофных маркеров хозяина (например, LEU2, URA3, HIS3), часто используют в качестве селектируемых маркеров у дрожжей. Также предусмотрено использование вирусных (например, бакуловирус) или фаговых векторов и векторов, которые способны интегрироваться в геном клетки-хозяина, таких как ретровирусные векторы. Подходящие экспрессирующие векторы для экспрессии в клетках млекопитающих и прокариотических клетках (E. соli), клетках насекомых (Drosophila Schnieder S2 клетки, Sf9) и дрожжей (Р. methanolica, P. pastoris, S. cerevisiae) хорошо известны в данной области.

Предложены рекомбинантные клетки-хозяева, которые экспрессируют слитую конструкцию лекарственного средства, и способ получения слитой конструкции лекарственного средства, как описано в настоящем документе. Рекомбинантная клетка-хозяин содержит рекомбинантную нуклеиновую кислоту, кодирующую слитую конструкцию лекарственного средства. Слитые конструкции лекарственного средства можно получать экспрессией рекомбинантной нуклеиновой кислоты, кодирующей белок, в подходящей клетке-хозяине, или используя другие подходящие способы. Например, экспрессирующие конструкции, описанные в настоящем документе, можно внедрить в подходящую клетку-хозяина, и полученную в результате клетку можно поддерживать (например, в культуре, в животном) при условиях, подходящих для экспрессии конструкций. Подходящие клетки-хозяева могут быть прокариотическими, включая бактериальные клетки, такие как Е.соli, В.subtilis и/или другие подходящие бактерии, эукариотическими, такие как клетки грибов или дрожжей (например, Pichia pastoris, Aspergillus species, Sacchammyces cerevisiae, Schizosaccharomyces pombe, Neurospora crassa) или другие низшие эукариотические клетки, а также клетками высших эукариотов, такие как таковые из насекомых (например, клетки насекомых Sf9 (WO 94/26087 (O'Connor)) или животных (например, COS клетки, такие как COS-1 (ATCC (Американская коллекция типовых культур) Регистрационный номер № CRL-1650) и COS-7 (ATCC Регистрационный номер № CRL-1651), СНО (например, ATCC Регистрационный номер № CRL-9096), 293 (ATCC Регистрационный номер № CRL-1573), HeLa (ATCC Регистрационный номер № CCL-2), CV1 (ATCC Регистрационный номер № CCL-70), WOP (Dailey et al., J. Virol. 54:739-749 (1985)), ЗТЗ, 293Т (Pear et al., Proc. Natl. Acad. Sci. U.S.A., 90:8392-8396 (1993)), NSO клетки, SP2/0, HuT 78 клетки и тому подобное (см., например, Ausubel, F.M. et al., eds. Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons Inc., (1993)).

Изобретение также включает способ получения слитой конструкции лекарственного средства, включающий поддержание рекомбинантной клетки-хозяина по изобретению в условиях, подходящих для экспрессии слитой конструкции лекарственного средства. Способ может дополнительно включать стадию выделения или восстановления слитой конструкции лекарственного средства, при желании. В другом варианте воплощения, компоненты слитой конструкции лекарственного средства, (например, dAb, которое связывает человеческий сывороточный альбумин, и IL-1ra) химически соединяют для создания непрерывной полипептидной цепи.

Конъюгаты

В другом аспекте, в изобретении предложены конъюгаты, содержащие антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, который связан с лекарственным средством. Такие конъюгаты включают «конъюгаты лекарственного средства», которые содержат антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, с которым лекарственное средство связано ковалентно, и «нековалентные конъюгаты лекарственного средства», которые содержат антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, с которым лекарственное средство связано нековалентно. Предпочтительно, конъюгаты являются достаточно стабильными, так что антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин, и лекарственное средство остаются существенным образом связанными (ковалентно или нековалентно) друг с другом в условиях in vivo (например, при введении человеку). Предпочтительно, не более чем примерно 20%, не более чем примерно 15%, не более чем примерно 10%, не более чем примерно 9%, не более чем примерно 8%, не более чем примерно 7%, не более чем примерно 6%, не более чем примерно 5%, не более чем примерно 4%, не более чем примерно 3%, не более чем примерно 2%, не более чем примерно 1% или существенным образом ни один из конъюгатов не диссоциирует или не разрушается, чтобы высвободить лекарственное средство и антигенсвязывающий фрагмент в условиях in vivo. Например, стабильность в условиях «in vivo» можно удобно оценивать инкубированием конъюгата лекарственного средства или нековалентного конъюгата лекарственного средства в течение 24 часов в сыворотке (например, человеческой сыворотке) при 37°С. В одном примере такого способа, равные количества конъюгата лекарственного средства и не конъюгированного лекарственного средства помещают в два различных флакона с сывороткой. Половину содержимого каждого флакона немедленно замораживают при -20°С, а другую половину инкубируют в течение 24 часов при 37°С. Затем все четыре образца можно проанализировать любым подходящим методом, таким как SDS-PAGE (полиакриламидный гель-электрофорез с додецилсульфатом натрия) и/или Вестерн блоттинг. Вестерн-блоты можно обработать с использованием антитела, которое связывает лекарственное средство. Все лекарственное средство в полосках конъюгата лекарственного средства будет перемещаться в соответствии с размером конъюгата лекарственного средства, если не произошло диссоциации. Для оценки стабильности в условиях «in vivo» можно использовать многие другие подходящие методы, например, анализируя образцы, приготовленные, как описано выше, подходящими аналитическими методами, такими как хроматография (например, гель-фильтрация, ионный обмен, обращенно-фазная хроматография), ELISA, масс-спектроскопия и тому подобное.

Конъюгаты лекарственного средства

В другом аспекте, в изобретении предложен конъюгат лекарственного средства, содержащий антигенсвязывающий фрагмент антитела, который имеет связывающую специфичность в отношении сывороточного альбумина, и лекарственное средство, которое ковалентно связано с указанным антигенсвязывающим фрагментом, при условии, что конъюгат лекарственного средства не является одиночной непрерывной полипептидной цепью.

В некоторых вариантах воплощения, конъюгат лекарственного средства содержит вариабельный домен тяжелой цепи иммуноглобулина (VH), который имеет связывающую специфичность в отношении сывороточного альбумина, или вариабельный домен легкой цепи иммуноглобулина (VL), который имеет связывающую специфичность в отношении сывороточного альбумина, а также лекарственное средство, которое ковалентно связано с указанным VH или VL, при условии, что конъюгат лекарственного средства не является одиночной непрерывной полипептидной цепью. Предпочтительно, конъюгат лекарственного средства содержит единичный VH, который связывает сывороточный альбумин, или единичный VL, который связывает сывороточный альбумин. В конкретных вариантах воплощения, конъюгат лекарственного средства содержит VK dAb, который связывает человеческий сывороточный альбумин и содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:26. В других вариантах воплощения, конъюгат лекарственного средства содержит VH dAb, который связывает человеческий сывороточный альбумин и содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 и SEQ ID NO:23.

Конъюгаты лекарственного средства могут содержать любое желаемое лекарственное средство и могут быть получены любыми подходящими способами. Например, лекарственное средство можно связать с антигенсвязывающим фрагментом антитела, которое связывает сывороточный альбумин, напрямую или непрямым путем через подходящую линкерную группировку в одном или более положениях, таких как аминоконец, карбоксиконец, или через аминокислотные боковые цепочки. В одном варианте воплощения, конъюгат лекарственного средства содержит dAb, которое связывает человеческий сывороточный альбумин, и полипептидное лекарственное средство (например, человеческий IL-1ra или функциональный вариант человеческого IL-1ra), и аминоконец полипептидного лекарственного средства (например, человеческого IL-1ra или функционального варианта человеческого IL-1ra) связан с карбоксиконцом dAb напрямую или через подходящую линкерную группировку. В другом варианте воплощения, конъюгат лекарственного средства содержит dAb, которое связывает человеческий сывороточный альбумин, и инсулинотропное лекарственное средство (например, GLP-1 или аналог GLP-1), и аминоконец инсулинотропного лекарственного средства является свободным (т.е. не соединен или не связан в конъюгате), а карбоксиконец связан с аминоконцом dAb напрямую или через подходящую линкерную группировку. В других вариантах воплощения, конъюгат лекарственного средства содержит dAb, которое связывает человеческий сывороточный альбумин, и два или более различных лекарственных средств, которые ковалентно связаны с dAb. Например, первое лекарственное средство может быть ковалентно связано (напрямую или непрямым путем) с карбоксильным концом dAb, а второе лекарственное средство может быть ковалентно связано (напрямую или непрямым путем) с аминоконцом или через аминогруппу боковой цепи (например, е аминогруппу лизина). В предпочтительном варианте воплощения, аминоконец инсулинотропного лекарственного средства (например, GLP-1 или аналога GLP-1) является свободным. Такие конъюгаты лекарственного средства можно получить с использованием хорошо известных способов селективного связывания. (См., например, Hermanson, G.T., Bioconjugate Techniques, Academic Press: San Diego, CA (1996).)

Можно использовать разнообразные способы конъюгирования лекарственных средств с антигенсвязывающим фрагментом антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина. Конкретный выбранный способ будет зависеть от лекарственного средства, которое подлежит конъюгированию. При желании, линкеры, которые содержат концевые функциональные группы, можно использовать для связывания антигенсвязывающего фрагмента и лекарственного средства. Обычно конъюгирование осуществляется в ходе реакции взаимодействия лекарственного средства, которое содержит реакционноспособную функциональную группу (или модифицировано, чтобы содержать реакционноспособную функциональную группу), с линкером или напрямую с антигенсвязывающим фрагментом антитела, которое связывает сывороточный альбумин. Ковалентные связи образуются в ходе реакции взаимодействия лекарственного средства, которое содержит (или модифицировано, чтобы содержать) химическую группировку или функциональную группу, которая может, при соответствующих условиях, взаимодействовать со второй химической группой, таким образом, образуя ковалентную связь. При желании, подходящую реакционноспособную химическую группу можно добавить к антигенсвязывающему фрагменту или к линкеру, используя любой подходящий способ. (См., например, Hermanson, G.T., Bioconjugate Techniques, Academic Press: San Diego, CA (1996).) Многие комбинации подходящих реакционноспособных химических групп известны в данной области, например, аминогруппа может взаимодействовать с электрофильной группой, такой как тозилат, мезилат, группа галогена (хлоро, бромо, фторо, иодо), N-гидроксисукцинимидиловый эфир (NHS) и тому подобное. Тиолы могут вступать во взаимодействие с малеимидом, иодоацетилом, акрилолилом, пиридилдисульфидами, тиолом 5-тиол-2-нитробензойной кислоты (TNB-тиолом) и тому подобным. Альдегидную функциональную группу можно соединить с амино- или гидразидсодержащими молекулами, и азидная группа может взаимодействовать с трехвалентной фосфатной группой для образования фосфорамидатных или фосфоримидных связей. Подходящие способы для введения активирующих групп в молекулы известны в данной области (см., например, Hermanson, G.T., Bioconjugate Techniques, Academic Press: San Diego, CA (1996).)

В некоторых вариантах воплощения, антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина, связывают с лекарственным средством в ходе реакции взаимодействия между двумя тиолами для образования дисульфидной связи. В других вариантах воплощения, антигенсвязывающий фрагмент антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина, связывают с лекарственным средством в ходе реакции взаимодействия между изотиоцианатной группой и первичным амином для получения связи изотиомочевины.

Подходящие линкерные группировки могут быть линейными или разветвленными и включают, например, тетраэтиленгликоль, C2-C12 алкилен, -NH-(CH2)p-NH- или -(СН2)р-NН- (где р равно от одного до двенадцати), -СН2-O-CH2-CH2-O-CH2-CH2-O-CH-NH-, полипептидную цепь, содержащую от одной до примерно 100 (предпочтительно, от одной до примерно 12) аминокислот, и тому подобное.

Нековалентные конъюгаты лекарственного средства

Некоторые нековалентные связи (например, водородные связи, силы Ван-дер-Ваальса) могут производить стабильные, высокоспецифичные межмолекулярные соединения. Например, силы молекулярного распознавания, достигаемые через многочисленные нековалентные связи между комплементарными связывающими партнерами, лежат в основе многих важных биологических взаимодействий, таких как связывание ферментов со своими субстратами, распознавание антигенов антителами, связывание лигандов со своими рецепторами и стабилизация трехмерной пространственной структуры белков и пептидов. Соответственно, такие слабые нековалентные взаимодействия (например, водородное связывание, силы Ван-дер-Ваальса, электростатические взаимодействия, гидрофобные взаимодействия и тому подобное) можно использовать для того, чтобы связывать лекарственное средство с антигенсвязывающим фрагментом антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина.

Предпочтительно, нековалентная связь, соединяющая антигенсвязывающий фрагмент и лекарственное средство, должна быть достаточно сильной, чтобы антигенсвязывающий фрагмент и лекарственное средство оставались существенным образом связанными друг с другом в условиях in vivo (например, при введении человеку). Обычно, нековалентная связь, соединяющая антигенсвязывающий фрагмент и лекарственное средство, имеет прочность, равную, по меньшей мере, примерно 1010 М-1. В предпочтительных вариантах воплощения, прочность нековалентной связи составляет, по меньшей мере, примерно 1011 М-1, по меньшей мере, примерно 1012 М-1, по меньшей мере, примерно 1013 М-1, по меньшей мере, примерно 1014 М-1 или, по меньшей мере, примерно 1015 М-1. Как известно, взаимодействия между биотином и авидином и между биотином и стрептавидином являются очень эффективными и стабильными при различных условиях, и, как описано в настоящем документе, нековалентные связи между биотином и авидином или между биотином и стрептавидином можно применять для получения нековалентного конъюгата лекарственного средства по изобретению.

Нековалентную связь можно сформировать напрямую между антигенсвязывающим фрагментом антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина, и лекарственным средством, либо можно сформировать между подходящими комплементарными связывающими партнерами (например, биотином и авидином или стрептавидином), где один партнер ковалентно связан с лекарственным средством, а комплементарный связывающий партнер ковалентно связан с антигенсвязывающим фрагментом. Если используют комплементарные связывающие партнеры, то один из связывающих партнеров может быть ковалентно связан с лекарственным средством напрямую или через подходящую линкерную группировку, и комплементарный связывающий партнер может быть ковалентно связан с антигенсвязывающим фрагментом антитела, которое связывает сывороточный альбумин, напрямую или через подходящую линкерную группировку.

Комплементарные связывающие партнеры представляют собой пары молекул, которые селективно связываются друг с другом. Многие комплементарные связывающие партнеры известны в данной области, например, антитело (или его антигенсвязывающий фрагмент) и его когнатный (родственный) антиген или эпитоп, ферменты и их субстраты, а также рецепторы и их лиганды. Предпочтительными комплементарными связывающими партнерами являются биотин и авидин, а также биотин и стрептавидин.

Прямое или непрямое ковалентное связывание члена комплементарной связывающей пары с антигенсвязывающим фрагментом, который имеет связывающую специфичность в отношении сывороточного альбумина, или с лекарственным средством можно осуществить, как описано выше, например, путем взаимодействия комплементарного связывающего партнера, который содержит реакционноспособную функциональную группу (или модифицирован, чтобы содержать реакционноспособную функциональную группу), с антигенсвязывающим фрагментом антитела, которое связывает сывороточный альбумин, при помощи или без помощи линкера. Конкретный выбранный способ будет зависеть от соединений (например, лекарственное средство, комплементарный связывающий партнер, антигенсвязывающий фрагмент антитела, которое связывает сывороточный альбумин), которые следует конъюгировать. При желании, линкеры (например, гомобифункциональные линкеры, гетеробифункциональные линкеры), которые содержат концевые реакционноспособные функциональные группы, можно использовать для связывания антигенсвязывающего фрагмента и/или лекарственного средства с комплементарным связывающим партнером. В одном варианте воплощения, можно использовать гетеробифункциональный линкер, который содержит две различные реакционноспособные группировки. Гетеробифункциональный линкер можно выбрать таким образом, что одна из реакционноспособных группировок будет вступать во взаимодействие с антигенсвязывающим фрагментом антитела, которое имеет связывающую специфичность в отношении сывороточного альбумина, или лекарственным средством, а другая реакционноспособная группировка будет вступать во взаимодействие с комплементарным связывающим партнером. Можно использовать любой подходящий линкер (например, гетеробифункциональный линкер), и много таких линкеров известно в данной области и доступно из коммерческих источников (например, Pierce Biotechnology, Inc., IL).

Композиции и Терапевтические и Диагностические Методы

Предложены композиции, содержащие композиции лекарственного средства по изобретению (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), включая фармацевтические или физиологические композиции (например, для медицинского и/или ветеринарного применения). Фармацевтические или физиологические композиции содержат одну или более композиций лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) и фармацевтически или физиологически приемлемый носитель. Обычно такие носители включают водные или водно-спиртовые растворы, эмульсии или суспензии, включая физиологический раствор и/или буферизованные среды. Парентеральные носители включают раствор хлорида натрия, декстрозу Рингера, декстрозу и хлорид натрия и лактат Рингера. Подходящие физиологически приемлемые вспомогательные вещества, если необходимо поддерживать полипептидный комплекс в суспензии, можно выбрать из загустителей, таких как карбоксиметилцеллюлоза, поливинилпирролидон, желатин и альгинаты. Внутривенные носители включают плазмозамещающие растворы и питающие и электролитные инфузионные растворы, такие как таковые, основанные на декстрозе Рингера. Могут также присутствовать консерванты и другие добавки, такие как антимикробные, антиокислительные, хелатирующие агенты и инертные газы (Mack (1982) Remington's Pharmaceutical Sciences, 16th Edition).

Композиции могут содержать желаемое количество композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства). Например, композиции могут содержать от примерно 5% до примерно 99% конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства или слитой конструкции лекарственного средства, по массе. В конкретных вариантах воплощения, композиция может содержать от примерно 10% до примерно 99%, или от примерно 20% до примерно 99%, или от примерно 30% до примерно 99%, или от примерно 40% до примерно 99%, или от примерно 50% до примерно 99%, или от примерно 60% до примерно 99%, или от примерно 70% до примерно 99%, или от примерно 80% до примерно 99%, или от примерно 90% до примерно 99%, или от примерно 95% до примерно 99% композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства), по массе. В одном примере, композиция высушена при замораживании в глубоком вакууме (лиофилизирована).

Композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), описанные в настоящем документе, как правило, найдут применение при предотвращении, ослаблении или лечении воспалительных состояний (например, острых и/или хронических воспалительных заболеваний), таких как хроническое обструктивное заболевание легких (например, хронический бронхит, хронический обструктивный бронхит, эмфизема), аллергическая гиперчувствительность, рак, бактериальная или вирусная инфекция, пневмония, такая как бактериальная пневмония (например, стафилококковая пневмония), аутоиммунные заболевания (которые включают, но не ограничены, диабет I типа, рассеянный склероз, артрит (например, остеоартрит, ревматоидный артрит, ювенильный ревматоидный артрит, псориатический артрит, волчаночный артрит, спондилоартропатия, (например, анкилозирующий спондилоартрит или болезнь Бехтерева), системная красная волчанка, воспалительная болезнь кишечника (например, болезнь Крона, неспецифический язвенный колит), синдром Бехчета и злокачественная миастения), эндометриоз, псориаз, спайки брюшной полости (например, после хирургических операций брюшной полости), астма и септический шок. Композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), описанные в настоящем документе, можно применять для предотвращения, ослабления или лечения боли, такой как хроническая или острая травматическая боль, хроническая или острая невропатическая боль, острая или хроническая мышечно-скелетная боль, хроническая или острая боль при раке и тому подобное. Композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), описанные в настоящем документе, можно также вводить в диагностических целях.

Злокачественные новообразования, которые можно предотвращать, подавлять или лечить, применяя композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), описанные в настоящем документе, включают лимфомы (например, В-клеточная лимфома, острая миелоидная лимфома, ходжкинская лимфома, неходжкинская лимфома), миеломы (например, множественная миелома), рак легких (например, мелкоклеточная карцинома легкого, немелкоклеточная карцинома легкого), колоректальный рак, рак головы и шеи, рак поджелудочной железы, рак печени, рак желудка, рак молочной железы, рак яичника, рак мочевого пузыря, лейкозы (например, острый миелобластный лейкоз, хронический миелобластный лейкоз, острый лимфоцитарный лейкоз, хронический лимфоцитарный лейкоз), аденокарциномы, рак почки, рак кроветворной системы (например, миелодиспластический синдром, миелопролиферативные нарушения (например, истинная полицитемия, эссенциальная (или первичная) тромбоцитемия, идиопатический миелофиброз)) и тому подобное.

Композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства), описанные в настоящем документе, также пригодны для применения при предотвращении, ослаблении или лечении эндометриоза, фиброза, бесплодия, преждевременных родов, эректильной дисфункции, остеопороза, диабета (например, диабета II типа), нарушения роста, ВИЧ инфекции, синдрома дыхательной недостаточности, новообразований и энуреза.

В предпочтительном варианте воплощения, настоящее изобретение относится к применению соединения в соответствии с изобретением для изготовления лекарства для лечения гипергликемии, диабета 2 типа, нарушения толерантности к глюкозе, диабета 1 типа, ожирения, гипертензии, синдрома X, дислипидемии, (β-клеточного апоптоза, j3-ce) i симптома недостаточности, инфаркта миокарда, воспалительного синдрома кишечника, диспепсии, когнитивных расстройств, например усиления познавательных функций, нейропротективного действия, атеросклероза, ишемической болезни сердца и других сердечно-сосудистых заболеваний. В частных вариантах воплощения для этих показаний, лекарственное средство выбрано из инсулинотропного агента и инкретина, глюкагон-подобного пептида 1, GLP-1 пептида, GLP-1 аналога, GLP-1 производного, PYY, PYY пептида, PYY аналога, PYY производного, Эксендин-3, Эксендин-3 пептида, Эксендин-3 аналога, Эксендин-3 производного, Эксендин-4, Эксендин-4 пептида, Эксендин-4 аналога, Эксендин-4 производного или комбинации двух или более этих агентов (например, GLP-1 пептид и PYY пептид).

В другом варианте воплощения, настоящее изобретение относится к применению соединения в соответствии с изобретением для изготовления лекарства для лечения синдрома тонкого кишечника, воспалительного синдрома кишечника или болезни Крона. В частных вариантах воплощения для этих показаний, лекарственное средство выбрано из инсулинотропного агента и инкретина, глюкагон-подобного пептида 1, GLP-1 пептида, GLP-1 аналога, GLP-1 производного, PYY, PYY пептида, PYY аналога, PYY производного, Эксендин-3, Эксендин-3 пептида, Эксендин-3 аналога, Эксендин-3 производного, Эксендин-4, Эксендин-4 пептида, Эксендин-4 аналога, Эксендин-4 производного или комбинации двух или более этих агентов (например, GLP-1 пептид и PYY пептид).

В другом варианте воплощения, настоящее изобретение относится к применению соединения в соответствии с изобретением для изготовления лекарства для лечения гипергликемии, диабета 1 типа, диабета 2 типа или недостатка β-клеток. В частных вариантах воплощения для этих показаний, лекарственное средство выбрано из инсулинотропного агента и инкретина, глюкагон-подобного пептида 1, GLP-1 пептида, GLP-1 аналога, GLP-1 производного, PYY, PYY пептида, PYY аналога, PYY производного, Эксендин-3, Эксендин-3 пептида, Эксендин-3 аналога, Эксендин-3 производного, Эксендин-4. Эксендин-4 пептида, Эксендин-4 аналога, Эксендин-4 производного или комбинации двух или более этих агентов (например, GLP-1 пептид и PYY пептид).

Лечение при помощи соединения в соответствии с настоящим изобретением можно также объединить со вторым или большим количеством фармакологически активных соединений, которые могут быть, а могут не быть частью конъюгата или слитой конструкции лекарственного средства. Например, активный агент, выбранный из противодиабетических агентов, средств против ожирения, средств, регулирующих аппетит, антигипертензивных средств, средств для лечения и/или предотвращения осложнений, вытекающих из или связанных с диабетом, и средств для лечения и/или предотвращения осложнений и нарушений, вытекающих из или связанных с ожирением. В настоящем контексте, выражение «противодиабетический агент» включает соединения для лечения и/или профилактики резистентности к инсулину и заболеваний, где резистентность к инсулину является патофизиологическим механизмом.

Примерами данных фармакологически активных соединений являются: Инсулин, агонисты GLP-1, сульфонилмочевины (например, толбутамид, глибенкламид, глипизид и гликлазид), бигуаниды, например метформин, меглитиниды, ингибиторы глюкозидазы (например, акорбоза), антагонисты глюкагона, ингибиторы DPP-IV (дипептидилпептидазы-IV), ингибиторы печеночных ферментов, вовлеченных в стимулирование глюконеогенеза и/или глюкогенолизиса, молуляторы усвоения глюкозы, тиазолидиндионы, такие как троглитазон и циглитазон, соединения, модифицирующие липидный обмен, такие как антигиперлипидемические агенты, как ингибиторы HMG СоА (статины), соединения, снижающие потребление пищи, агонисты RXR и средства, действующие на АТР-зависимый калиевый канал β-клеток (например, глибенкламид, глипизид, гликлазид и репаглинид); холестирамин, колестирол, клофибрат, гемфиброзил, ловастатин, правастатин, симвастатин, пробукол, декстротироксин, нетеглинид, репаглинид; р-блокаторы, такие как алпренолол, атенолол, тимолол, пиндолол, пропранолол и метопролол, ингибиторы АСЕ (ангиотензинконвертирующий фермент), такие как беназеприл, каптоприл, эналаприл, фозиноприл, лизиноприл, алатриоприл, квинаприл и рамиприл, блокаторы кальциевых каналов, такие как нифедипин, фелодипин, никардипин, исрадипин, нимодипин, дилтиазем и верапамил, а также α-блокаторы, такие как доксазозин, урапидил, празозин и теразозин; агонисты CART (кокаин- и амфетамин-регулируемый транскрипт), антагонисты NPY (нейропептид Y), агонисты МС4 (меланокортин 4), антагонисты орексина, агонисты TNF (фактор некроза опухоли), агонисты CRF (кортикотропин-высвобождающий фактор), антагонисты CRF BP (кортикотропин-высвобождающего фактора связывающий белок), агонисты урокортина, р3 агонисты, агонисты MSH (меланоцит-стимулирующий гормон), антагонисты МСН (меланоцит-концентрирующий гормон), агонисты ССК (холецистокинин), ингибиторы обратного захвата серотонина, ингибиторы обратного захвата серотонина и норадреналина, смесь серотонин- и норадренергических соединений, агонисты 5НТ (серотонин), агонисты бомбезина, антагонисты галанина, гормон роста, гормон роста высвобождающие соединения, агонисты TRH (тиреотропин высвобождающий гормон), модуляторы UCP 2 или 3 (несвязывающий белок 2 или 3), агонисты лептина, агонисты DA (бромокриптин, допрексин), ингибиторы липазы/амилазы, модуляторы RXR (рецептор ретиноида X), агонисты TR (3; антагонисты гистамина Н3.

Дополнительно инсулин может находиться в форме одного из следующих аналогов: АзрВ28-человеческий инсулин, LysB28, РroВ29-человеческий инсулин, LysB3 GluВ29-человеческий инсулин, GlyA21, ArgВ31, ArgВ32-человеческий инсулин и des (B30) человеческий инсулин.

Дополнительно другие активные лекарственные средства включают человеческий гормон роста или его аналог, паратиреоидный гормон или его аналог, фактор роста, такой как тромбоцитарный фактор роста (PDGF), трансформирующий фактор роста α (TGF-α), трансформирующий фактор роста β (TGF-β), эпидермальный фактор роста (EGF), васкулярный эндотелиальный фактор роста (VEGF), соматомедин, такой как инсулиновый фактор роста I (IGF-I), инсулиновый фактор роста II (IGF-II), эритропоэтин (ЕРО), тромбопоэтин (ТРО) или ангиопоэтин, интерферон, проурокиназу, урокиназу, тканевой активатор плазминогена (t-PA), ингибитор активатора плазминогена 1, ингибитор активатора плазминогена 2, фактор Виллебранда (von Willebrandt), цитокин, например, интерлейкин, такой как интерлейкин (IL) 1, IL-1 Ra, IL-2, IL-4, IL-5, IL-6, IL-9, IL-11, IL-12, IL-13, IL-15, IL-16, IL-17, IL-18, IL-20 или IL-21, колониестимулирующий фактор (CFS), такой как GM-CSF, фактор стволовых клеток, фактор некроза опухоли, такой как TNF-α, лимфотоксин-α, лимфотоксин-β, CD40L или CD30L, ингибитор протеазы, например, апротинин, человеческий фолликулостимулирующий гормон или его аналог, фермент, такой как супероксид дистмутаза, аспарагиназа, аргиназа, аргинин деаминаза, аденозин деаминаза, рибонуклеаза, каталаза, уриказа, билирубин оксидаза, трипсин, папайн, щелочная фосфатаза, β-глюкоронидаза, пуринового нуклеозида фосфорилаза или батроксобин, опиоид, например, эндорфины, энкефалины или опиоиды не природного происхождения, гормон или нейропептид, например, кальцитонин, глюкагон, гастрины, адренокортикотропный гормон (АСТН), холецистокинины, лютеинизирующий гормон, гонадолиберин, хорионический гонадотропин, кортикотропин-высвобождающий фактор, вазопрессин, окситоцин, противодиуретические гормоны, тиреотропный гормон, тиреотропин-высвобождающий гормон, релаксин, пролактин, пептид YY, нейропептид Y, панкреатический полипептид, лептин, CART (кокаин- и амфетамин-регулируемый транскрипт), CART-родственный пептид, перилипин, меланокортины (меланоцит-стимулирующие гормоны), такие как МС-4, меланин-концентрирующие гормоны, натрийуретические пептиды, адреномедуллин, эндотелин, секретин, амилин, вазоактивный кишечный пептид (VIP), гипофизарную аденилатциклазу активирующий полипептид (РАСАР), бомбезин, бомбезин-подобные пептиды, тимозин, гепаринсвязывающий белок, растворимый CD4, гипоталамический высвобождающий фактор, меланотонины и их аналоги.

Конъюгат лекарственного средства или слитая конструкция лекарственного средства, описанные в настоящем документе, можно также вводить в диагностических целях или в качестве радиофармацевтического средства.

В настоящей заявке термин «предотвращение» включает введение защитной композиции перед тем, как заболевание было вызвано. «Ослабление» относится к введению композиции после того, как заболевание было вызвано, но перед клинической манифестацией заболевания. «Лечение» включает введение защитной композиции после того, как симптомы заболевания стали очевидными.

Доступны модельные системы с использованием животных, которые можно использовать для скрининга эффективности композиций лекарственного средства (например, конъюгатов лекарственного средства, нековалентных конъюгатов лекарственного средства, слитых конструкций лекарственного средства) при защите от или лечении заболевания. Методы тестирования системной красной волчанки (SLE) у восприимчивых мышей известны в данной области (Knight et al. (1978) J. Exp. Med., 147: 1653; Reinersten et al. (1978) New Eng. J. Med., 299: 515). Злокачественную миастению (MG) испытывают на SJL/J мышах женского пола индуцированием заболевания при помощи растворимого AchR белка от другого вида (Lindstrom et al. (1988) Adv. Immunol., 42: 233). Артрит индуцируют у восприимчивого штамма мышей инъецированием коллагена II типа (Stuart et al. (1984) Ann. Rev. Immunol., 42: 233). Описана модель, в которой синергический артрит индуцируют у восприимчивых крыс инъецированием белка теплового шока из микобактерий (Van Eden et al. (1988) Nature, 331: 171). Эффективность для лечения остеоартрита можно оценивать в мышиной или крысиной модели, в которой артрит индуцируют внутрисуставной инъекцией коллагеназы (Blom, A.B. et al., Osteoarthritis Cartilage 12:627-635 (2004)). Тиреоидит индуцируют у мышей путем введения тироглобулина, как описано (Маrоn et al. (1980) J. Exp. Med., 152: 1115). Инсулинозависимый сахарный диабет (IDDM) наступает естественным путем или может быть индуцирован у определенных штаммов мышей, таких как таковые, описанные у Kanasawa et al. (1984) Diabetologia, 27: 113. Экспериментальная аутоиммунная энцефалопатия (ЕАЕ) у мышей и крыс служит в качестве модели рассеянного склероза (MS) человека. В этой модели демиелинирующее заболевание индуцируют путем введения основного миелинового белка (см. Paterson (1986) Textbook of Immunopathology, Mischerer al., eds., Grune and Stratton, New York, pp.179-213; McFarlin etal. (1973) Science, 179: 478 и Satoh etal. (1987) J. Immunol., 138: 179).

Композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства) по настоящему изобретению можно применять в качестве отдельно вводимых композиций или в сочетании с другими агентами. Последние могут включать различные иммунотерапевтические лекарственные средства, такие как циклоспорин, метотрексат, адриамицин или цисплатин, иммунотоксины и тому подобное. Фармацевтические композиции могут включать «коктейли» из различных цитотоксических или других средств в сочетании с композицией лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) по настоящему изобретению или комбинациями композиций лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства) в соответствии с настоящим изобретением, содержащих различные лекарственные средства.

Композиции лекарственного средства (например, конъюгаты лекарственного средства, нековалентные конъюгаты лекарственного средства, слитые конструкции лекарственного средства) можно вводить любому индивидууму или субъекту в соответствии с любой подходящей методикой. Возможно множество путей введения, включая, например пероральный, диетический, местный, трансдермальный, ректальный, парентеральный (например, внутривенная, внутриартериальная, внутримышечная, подкожная, внутрикожная, внутрибрюшинная, интратекальная (в полость позвоночного канала), внутрисуставная инъекция) и ингаляционный (например, интрабронхиальная, интраназальная или пероральная ингаляция, интраназальные капли) пути введения, в зависимости от композиции лекарственного средства и заболевания или состояния, которое следует лечить. Введение, как назначено, может быть местным или системным. Предпочтительный способ введения может изменяться в зависимости от выбранной композиции лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) и состояния (например, заболевание), которое подвергается лечению. Дозировка и частота введения будут зависеть от возраста, пола и состояния пациента, сопутствующего введения других лекарственных средств, противопоказаний и других параметров, которые следует принимать во внимание клиницисту. Вводят терапевтически эффективное количество композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства). Терапевтически эффективное количество представляет собой количество, достаточное для достижения желаемого терапевтического эффекта при условиях введения.

В предпочтительном варианте воплощения изобретения, фармацевтические композиции, содержащие GLP-1 лекарственное средство или аналог или производное GLP-1 в соответствии с настоящим изобретением, можно ввести парентерально пациентам, нуждающимся в таком лечении. Парентеральное введение можно осуществлять подкожной, внутримышечной или внутривенной инъекцией посредством шприца, возможно, шприца-ручки. Альтернативно, парентеральное введение можно осуществить посредством инфузионного насоса. Дополнительной возможностью является композиция, которая может представлять собой порошок или жидкость для введения GLP-1 лекарственного средства или аналога или производного GLP-1 в форме назального или легочного спрея. В качестве еще одной дополнительной возможности, GLP-1 лекарственное средство или аналог или производное GLP-1 по изобретению можно также вводить трансдермально, например, из пластыря, возможно, пластыря для проведения электрофореза, или через слизистые оболочки, например, букально. В других вариантах воплощения, композиции вводят перорально, например, в виде пилюли, капсулы, напитка (например, продаваемого в качестве напитка для потери массы тела для лечения ожирения).

Композицию для парентерального введения GLP-1 соединений можно, например, получать, как описано в WO 03/002136 (включено в настоящий документ посредством ссылки).

Композицию для назального введения определенных пептидов можно, например, получать, как описано в Европейском патенте №272097 (выдан компании Novo Nordisk A/S) или в WO 93/18785 (все включены в настоящий документ посредством ссылки).

В настоящем документе определено, что термин «субъект» или «индивидуум» включает животных, таких как млекопитающие, включая, но не ограничено, приматы (например, человек), коровы, овцы, козлы, лошади, собаки, кошки, кролики, морские свинки, крысы, мыши или другие бычий, овечий, конский, собачий, кошачий виды, виды грызунов или мышей.

Композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства) можно вводить в виде нейтрального соединения или в виде соли. Соли соединений (например, композиций лекарственного средства, конъюгатов лекарственного средства, нековалентных конъюгатов лекарственного средства, слитых конструкций лекарственного средства), содержащих аминогруппу или другую основную группу, можно получать, например, взаимодействием с подходящей органической или неорганической кислотой, такой как хлороводород, бромоводород, уксусная кислота, перхлорная кислота и тому подобное. Соединения с четвертичной аммониевой группой также содержат противоион, такой как хлорид, бромид, иодид, ацетат, перхлорат и тому подобное. Соли соединений, содержащих группу карбоновой кислоты или другую кислотную функциональную группу, можно получать путем взаимодействия с подходящим основанием, например, гидроксидом. Соли кислотных функциональных групп содержат противокатион, такой как натрий, калий и тому подобное.

В изобретении также предложен набор для применения при введении композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства) субъекту (например, пациенту), содержащий композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства), устройство для доставки лекарственного средства и, возможно, инструкцию по применению. Композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства) можно предоставить в виде лекарственной формы, такой как препарат, высушенный замораживанием в грубоком вакууме. В конкретных вариантах воплощения, устройство для доставки лекарственного средства выбирают из группы, состоящей из шприца, ингалятора, устройства для интраназального или глазного введения (например, аэрозольный баллончик, флакон-капельница для глаз или носа) и безыгольного инъектора.

Композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства) по данному изобретению можно лиофилизировать для хранения и растворять в подходящем носителе перед применением. Можно использовать любой подходящий способ лиофилизации (например, распылительная сушка, сушка в слое) и/или методики растворения. Специалистам ясно, что лиофилизация и растворение могут приводить к различным степеням потери активности антител (например, в отношении обычных иммуноглобулинов, IgМ антитела имеют тенденцию к большей потере активности, чем IgG антитела) и что применяемые количества, возможно, необходимо регулировать для компенсации потери активности. В конкретном варианте воплощения, в изобретении предложена композиция, содержащая лиофилизированную (высушенную замораживанием в глубоком вакууме) композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства), как описано в настоящем документе. Предпочтительно, лиофилизированная (высушенная замораживанием в глубоком вакууме) композиция лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитая конструкция лекарственного средства) теряет не более чем примерно 20%, или не более чем примерно 25%, или не более чем примерно 30%, или не более чем примерно 35%, или не более чем примерно 40%, или не более чем примерно 45%, или не более чем примерно 50% своей активности (например, связывающей активности в отношении сывороточного альбумина) при регидратации. Активность представляет собой количество композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства), требуемого для оказания эффекта композиции лекарственного средства перед тем, как она была лиофилизирована. Например, количество конъюгата лекарственного средства или слитой конструкции лекарственного средства, необходимого для достижения и поддержания желаемой сывороточной концентрации в течение желаемого промежутка времени. Активность композиции лекарственного средства (например, конъюгата лекарственного средства, нековалентного конъюгата лекарственного средства, слитой конструкции лекарственного средства) можно определить, используя любой подходящий метод, перед лиофилизацией, и активность можно определить, используя тот же самый метод, после регидратации для определения величины потери активности.

Композиции, содержащие композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства) или его коктейль, можно вводить для профилактического и/или терапевтического применения. При конкретных терапевтических применениях, количество, достаточное для достижения желаемого терапевтического или профилактического эффекта при условиях введения, такого как, по меньшей мере, частичное ингибирование, ослабление, модуляция, уничтожение или некоторый другой измеряемый параметр, популяции выбранных клеток, определяют как «терапевтически-эффективное количество, или доза». Количества, необходимые для достижения этой дозировки, будут зависеть от тяжести заболевания и общего состояния собственной иммунной системы пациента и общего состояния здоровья, но обычно варьируют от примерно 10 мкг/кг до примерно 80 мкг/кг, или от примерно 0,005 до 5,0 мг конъюгата лекарственного средства или слитой конструкции лекарственного средства на килограмм массы тела, причем более традиционно применяют дозы от 0,05 до 2,0 мг/кг/доза. Например, композицию лекарственного средства (например, слитую конструкцию лекарственного средства, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства) по изобретению можно вводить ежедневно (например, до четырех введений в день), через каждые два дня, через каждые три дня, дважды в неделю, один раз в неделю, один раз через каждые две недели, один раз в месяц или один раз через каждые два месяца в дозе, например, от примерно 10 мкг/кг до примерно 80 мкг/кг, от примерно 100 мкг/кг до примерно 80 мг/кг, от примерно 1 мг/кг до примерно 80 мг/кг, от примерно 1 мг/кг до примерно 70 мг/кг, от примерно 1 мг/кг до примерно 60 мг/кг, от примерно 1 мг/кг до примерно 50 мг/кг, от примерно 1 мг/кг до примерно 40 мкг/кг, от примерно 1 мг/кг до примерно 30 мг/кг, от примерно 1 мг/кг до примерно 20 мг/кг, от примерно 1 мг/кг до примерно 10 мг/кг, от примерно 10 мкг/кг до примерно 10 мг/кг, от примерно 10 мкг/кг до примерно 5 мг/кг, от примерно 10 мкг/кг до примерно 2,5 мг/кг, примерно 1 мг/кг, примерно 2 мг/кг, примерно 3 мг/кг, примерно 4 мг/кг, примерно 5 мг/кг, примерно 6 мг/кг, примерно 7 мг/кг, примерно 8 мг/кг, примерно 9 мг/кг или примерно 10 мг/кг.

Для профилактического применения, композиции, содержащие композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства) или его коктейли, можно также вводить в схожих или незначительно меньших дозах. Композицию, содержащую композицию лекарственного средства (например, конъюгат лекарственного средства, нековалентный конъюгат лекарственного средства, слитую конструкцию лекарственного средства) в соответствии с настоящим изобретением, можно использовать при профилактическом и терапевтическом применении для помощи при изменении, инактивации, уничтожении или удалении избирательной популяции клеток-мишеней у млекопитающих.

ПРИМЕРЫ

Антагонист рецептора интерлейкина 1 (IL1-ra) представляет собой антагонист, который блокирует биологическую активность IL-1 путем конкурентноего ингибирования связывания IL-1 с рецептором первого типа интерлейкина-1 (IL-1R1). Выработка IL-1 индуцируется в ответ на раздражители, связанные с воспалением, и опосредует различные физиологические реакции, включая воспалительные и иммунологические реакции. IL-1 обладает различными видами активности, включая разрушение хрящевой ткани и стимулирование резорбции кости. У пациентов с ревматоидным артритом (RA) количество местно вырабатываемого IL-1 повышено, и уровни природного IL1-ra недостаточны для конкурирования с этими аномально увеличенными количествами. Доступны несколько видов лечения RA, включая симптом-модифицирующие противоревматические лекарственные препараты (DMARDS), такие как метотрексат, и биологические лекарственные средства, такие как KINERET® (anakinra, Amgen).

KINERET® (anakinra, Amgen) представляет собой рекомбинантную, негликозилированную форму антагониста рецептора человеческого интерлейкина-1, который состоит из 153 аминокислот и имеет молекулярную массу 17,3 кДа. (Аминокислотная последовательность KINERET® (anakinra, Amgen) соответствует 152 аминокислотам в природном IL-1ra и дополнительному N-концевому метионину.) KINERET® (anakinra, Amgen) показан для уменьшения признаков и симптомов умеренного до тяжелого ревматоидного артрита у пациентов в возрасте 18 лет или старше, кому не помогла терапия при помощи DMARDs. Дозировка представляет собой однократную подкожную инъекцию 100 мг медикамента один раз в сутки. Tβ1/2 составляет 4-6 часов, и у 71% пациентов возникают побочные реакции в месте инъекции через 14-28 дней.

Авторами изобретения продемонстрировано, что связывание терапевтического полипептида с dAb, связывающим сывороточный альбумин, приводит к соединению, которое (1) имеет активность, схожую с отдельным терапевтическим полипептидом, и (2) также связывает сывороточный альбумин. Кроме того, в настоящем изобретении предложен способ создания варианта терапевтического полипептида, имеющего длительный период полувыведения в сыворотке. Например, мы присоединили dAb, связывающее сывороточный альбумин, к IL1-ra, что приводит к соединению, имеющему более длительный период полувыведения в сыворотке, чем IL1-ra отдельно.

Пример 1. Выбор доменовых антител, которые связывают мышиный, крысиный и человеческий сывороточный альбумин

Данный пример объясняет способ изготовления антитела с единичным доменом (dAb), направленного против сывороточного альбумина. Описан выбор dAbs против мышиного сывороточного альбумина (MSA), человеческого сывороточного альбумина (HSA) и крысиного сывороточного альбумина (RSA).

dAb против мышиного сывороточного альбумина были выбраны, как описано в WO 2004/003019 А2. Использовали три дисплейные библиотеки антител человеческого бактериофага. Каждая из библиотек была основана на единичной человеческой каркасной области для VH (V3-23/DP47 и JH4b) или VK (o12/o2/DPK9 и Jk1) с разнообразием в боковой цепи, кодируемым NNK кодонами, внедренными в гипервариабельные участки (CDR1, CDR2 и CDR3).

Библиотека 1 (VH):

Разнообразие в положениях: Н30, Н31, Н33, Н35, Н50, Н52, Н52а, Н53, Н55, Н56, Н58, Н95, Н97, Н98.

Размер библиотеки: 6,2×109

Библиотека 2 (VH):

Разнообразие в положениях: Н30, Н31, Н33, Н35, Н50, Н52, Н52а, Н53, Н55, Н56, Н58, Н95, Н97, Н98, Н99, Н100, Н100А, Н100В.

Размер библиотеки: 4,3×109

Библиотека 3 (VK):

Разнообразие в положениях: L30, L31, L32, L34, L50, L53, L91, L92, L93, L94, L96.

Размер библиотеки: 2×109

Библиотеки VH и VK были предварительно выбраны по признаку связывания с протеином А и протеином L, соответственно, принадлежащих общим лигандам, таким образом, что большинство клонов в выбранных библиотеках являлись функциональными. Размер библиотек, показанных выше, соответствует размерам после предварительной селекции.

Были выполнены два этапа селекции на сывороточном альбумине, используя отдельно каждую из библиотек. Для каждой селекции антиген наносили в виде покрытия на иммунопробирку (типа nunc) в 4 мл PBS (физиологический раствор с фосфатным буфером) в концентрации 100 мкг/мл. Во время первого этапа каждая из трех библиотек была разделена отдельно методом пэннинга (отсортирована) против HSA (Sigma) или MSA (Sigma). На втором этапе выбора, бактериофаг из каждой шести выборок, отобранных на первом этапе, был отсортирован против (1) снова того же самого антигена (например, 1-й этап MSA, 2-й этап MSA) и (2) против реципрокного (соответствующего) антигена (например, 1-й этап MSA, 2-й этап HSA), что привело в конце концов к двенадцати выборкам по результатам 2-го этапа. В каждом случае, после второго этапа селекции 48 клонов были протестированы на связывание HSA и MSA. Растворимые фрагменты dAb получали, как описано Harrison et al, Methods Enzymol. 1996; 267: 83-109 для фрагментов scFv, и соблюдали стандартный протокол ELISA (Hoogenboom etal. (1991) Nucleic Acids Res., 19: 4133) за исключением того, что 2% Твин-PBS использовали в качестве блокирующего буфера, а связанные dAbs детектировали при помощи либо протеин L-HRP (Sigma) (для VKS), либо протеин A-HRP (Amersham Pharmacia Biotech) (для VHs).

dAb, которые производили сигнал выше базовой линии, обозначающий связывание с MSA, HSA или с обоими, тестировали в ELISA нерастворимой форме на связывание одного пластика, но все были специфическими в отношении сывороточного альбумина. Клоны затем секвенировали (см. Таблица 1), обнаружив, что была идентифицирована 21 уникальная dAb последовательность. Минимальное сходство (на аминокислотном уровне) между отобранными VK dAb клонами составляло 86,25% ((69/80)×100; результат получен, когда все диверсифицированные остатки являются различными, например, клоны 24 и 34). Минимальное сходство между отобранными VH dAb клонами составляло 94% ((127/136)×100).

Затем, dAbs, связывающие сывороточный альбумин, тестировали на их способность захватывать биотинилированный антиген из раствора. Соблюдали протокол ELISA (как вышеназванный), за исключением того, что планшет ELISA покрывали при помощи 1 мкг/мл протеина L (для клонов VK) и 1 мкг/мл протеина А (для клонов VH). Растворимое dAb захватывали из раствора, как и в протоколе, и детектирование проводили при помощи биотинилированного MSA или HSA и стрептавидин HRP. Биотинилированный MSA и HSA приготовили в соответствии с инструкциями производителя, с целью достижения в среднем 2 биотинов на молекулу сывороточного альбумина. Идентифицировали двадцать четыре клона, которые захватывали биотинилированный MSA из раствора в ELISA. Два из этих клонов (клоны 2 и 38 ниже) также захватывали биотинилированный HSA. Затем, dAbs тестировали на их способность связывать MSA, нанесенный в виде покрытия на СМ5 чип прибора Biacore. Были обнаружены восемь клонов, которые связывали MSA на Biacore.

dAb против человеческого сывороточного альбумина и крысиного сывороточного альбумина отобрали, как описано ранее для анти-MSA dAbs, за исключением следующих модификаций протокола: Фаговая библиотека синтетических VH доменов представляла собой библиотеку 4G, которая основана на человеческом VH3, содержащем DP47 ген эмбрионального типа и сегмент JH4. Разнообразие в следующих конкретных положениях внесли мутагенезом (используя NNK кодоны; нумерация согласно Kabat (The Kabat Database of Sequences of Proteins of Immunological Interest, Kabat База Данных Последовательностей Белков, представляющих Иммунологический Интерес)) в CDR1: 30, 31, 33, 35; в CDR2: 50, 52, 52а, 53, 55, 56; и в CDR3: 4-12 диверсифицированных остатков, например Н95, Н96, Н97 и Н98 в 4G НИ и Н95, Н96, Н97, Н98, Н99, Н100, Н100а, Н100b, Н100с, Н100а, Н100е и H100f в 4G Н19. Последние три CDR3 остатка представляют собой FDY, так что длина CDR3 варьирует от 7-15 остатков. Библиотека содержит >1×1010 отдельных клонов.

Субпопуляцию VH и VK библиотек предварительно отобрали по связыванию протеина А и протеина L, соответственно, типовых лигандов, так что большинство клонов в неотобранных библиотеках являлись функциональными. Размеры библиотек, представленных выше, соответствуют размерам после предварительной селекции.

Были выполнены два этапа селекции на крысином и человеческом сывороточном альбумине, используя отдельно субпопуляции VH и VK библиотек. Для каждой селекции антиген либо (1) наносили в виде покрытия на иммунопробирку (типа nunc) в 4 мл PBS в концентрации 100 мкг/мл либо (2) биотинилировали и затем использовали для растворимой селекции, за которой следовал захват на стрептавидиновых зернах (на 1-м этапе) и нейтравидиновых зернах (на 2-м этапе). (См. Таблицу 1 по поводу деталей селекционной стратегии, примененной для изолирования каждого клона.) В каждом случае, после второго этапа селекции 24 бактериофаговых клона были исследованы на связывание HSA или RSA.

Если значительная часть клонов в одной из выборок была позитивной в фаговой ELISA, затем ДНК из этой выборки клонировали в экспрессирующий вектор для получения растворимого dAb и отбирали индивидуальные колонии. Растворимые фрагменты dAb получали, как описано Harrison et al (Methods Enzymol. 1996; 267:83-109) для scFv фрагментов, а также соблюдали стандартный протокол ELISA (Hoogenboom et al. (1991) Nucleic Acids Res., 19: 4133) за исключением того, что 2% Твин-PBS использовали в качестве блокирующего буфера, а связанные dAbs детектировали при помощи анти-тус-HRP. Клоны, которые оказались позитивными в ELISA, затем подвергли скринингу на связывание MSA, RSA или HSA, используя прибор поверхностного плазменного резонанса BIACORE (Biacore AB). dAbs, которые связывали MSA, RSA или HSA, анализировали далее. Затем клоны секвенировали и идентифицировали уникальные последовательности dAb.

Таблица 1
Протоколы селекции для dAb, которые связывают сывороточный альбумин
dAb Библиотека R1 селекция R2 селекция Связывание на Biacore
DOM7r-1 4G VK 10 мкг/мл на пробирку RSA 10 мкг/мл на пробирку RSA RSA
DOM7r-3 4G VK 10 мкг/мл на пробирку RSA 10 мкг/мл на пробирку RSA RSA
DOM7r-4 4G VK 10 мкг/мл на пробирку RSA 10 мкг/мл на пробирку RSA RSA, MSA
DOM7r-5 4G VK 10 мкг/мл на пробирку RSA 10 мкг/мл на пробирку RSA RSA
DOM7r-7 4G VK 10 мкг/мл на пробирку RSA 10 мкг/мл на пробирку RSA RSA, MSA
DOM7r-8 4G VK 10 мкг/мл на пробирку RSA 10 мкг/мл на пробирку RSA RSA, MSA
DOM7h-1 4G VK 10 мкг/мл на пробирку HSA 10 мкг/мл на пробирку HSA HSA
DOM7h-2 4G VK Растворимый 100 нМ HSA Растворимый 50 нМ HSA HSA
DOM7h-3 4G VK 10 мкг/мл на пробирку HSA 10 мкг/мл на пробирку HSA -
DOM7h-4 4G VK 10 мкг/мл на пробирку HSA 10 мкг/мл на пробирку HSA -
DOM7h-6 4G VK
DOM7h-7 4G VK
DOM7h-8 4G VK Растворимый 200 нМ HSA Растворимый 50 нМ RSA HSA, RSA,
MSA
DOM7r-13 4G VK Растворимый 200 нМ HSA Растворимый 50 нМ RSA RSA, MSA
DOM7r-14 4G VK Растворимый 200 нМ HSA Растворимый 50 нМ RSA RSA, MSA
DOM7h-21 4G VH 100 м кг/мл HSA на пробирку 100 мкг/мл HSA на пробирку HSA
DOM7h-22 4G VH 100 мкг/мл HSA на пробирку 100 мкг/мл HSA на пробирку HSA
DOM7h-23 4G VH 100 мкг/мл HSA на пробирку 100 мкг/мл HSA на пробирку HSA
DOM7h-24 4G VH 100 мкг/мл HSA на пробирку 100 мкг/мл HSA на пробирку HSA
DOM7h-25 4G VH 100 мкг/мл HSA на пробирку 100 мкг/мл HSA на пробирку HSA
DOM7h-26 4G VH 100 мкг/мл HSA на пробирку 100 мкг/мл HSA на пробирку HSA
DOM7h-27 4G VH 100 мкг/мл HSA на пробирку 100 мкг/мл HSA на пробирку HSA

dAb, которые связывали сывороточный альбумин на BIACORE чипе (Biacore AB), затем анализировали дополнительно для получения информации о сродстве. Анализ осуществляли с использованием СМ5 чипа (карбоксиметилированный декстрановый матрикс), который покрывали сывороточным альбумином. Поток клеток 1 представлял собой непокрытый заблокированный негативный контроль, поток клеток 2 был покрыт при помощи HSA, поток клеток 3 был покрыт при помощи RSA и поток клеток 4 был покрыт при помощи MSA. Сывороточные альбумины иммобилизовали в ацетатном буфере, рН 5,5, используя BIACORE компьютерную систему для покрытия Wizard, которая была запрограммирована для получения 500 резонансных единиц (RUs) покрытого материала. Каждое представляющее интерес dAb экспрессировали в периплазме Е. соli в масштабе 200 мл-500 мл и очищали из супернатанта, применяя абсорбцию культуральной среды при протеин А-ламинарной аффинной хроматографии (Amersham, UK) для VHS и протеин L-агарозной аффинной хроматографии (Affitech, Norway) для VK8, с последующим элюированием глицином при рН 2,2 и заменой буфера на PBS. Приготовили ряд концентраций dAb (в диапазоне от 5 нМ до 5 мкМ) разбавлением в BIACORE HBS-EP буфере и пропустили потоком вдоль BIACORE чипа.

Сродство (KD) рассчитывали на основе кривых самописца BIACORE путем сопоставления on-rate и off-rate кривых с кривыми самописца, полученными от концентраций dAb в области KD. Идентифицировали dAbs с диапазоном различных значений сродства к сывороточному альбумину. В диапазоне 10-100 нМ находились сродство DOM7h-8 к HSA, DOM7h-2 к HSA и DOM7r-1 к RSA. В диапазоне от 100 нМ до 500 нМ находились сродство DOM7h-7 к HSA, DOM7h-8 к RSA и DOM7h-26 к HSA. В диапазоне от 500 нМ до 5 мкМ находились сродство DOM7h-23 к HSA и DOM7h-1 к HSA. Примеры кривых самописца представлены на Фиг.6А-6С.

Пример 2. Форматирование антител против сывороточного альбумина в виде слитой конструкции с антагонистом рецептора IL-1 (IL-1ra)

В этом примере описан способ получения слитого белка, содержащего IL-1ra и dAb, которое связывает сывороточный альбумин. Были сделаны две слитых конструкции, одна с dAb N-концом от IL-1ra (MSA16IL1-ra) и одна с dAb С-концом от IL-1ra (IL1-raMSA 16). Последовательности слитых конструкций и вектор представлены на Фиг.2С и 2D. Также получили контрольную слитую конструкцию, которая не связывала MSA, и ее последовательность представлена на Фиг.2Е.

KINERET (anakinra, Amgen) имеет короткий период полувыведения, равный 4-6 часам, и рекомендованный режим дозировки требует ежедневных инъекций. Этот режим приводит к возникновению побочных реакций в месте инъекции через 14-28 дней в 71% случаев. Следовательно, форма человеческого IL-1ra, который имеет более продолжительный период полувыведения в сыворотке, имела бы преимущества и могла бы увеличить эффективность и уменьшить частоту дозировки. Для фармацевтического препарата эти оба свойства являются желательными.

Клонирование

Кратко, были разработаны два множественных сайта клонирования (MCSs), как подробно описано ниже, и вставлены в экспрессирующий вектор с Т7 промотором. Были разработаны сайты рестрикции для вставки ILI-ra, dAb, GAS лидерной последовательности и линкера. Один (MCS 1+3) кодирует белок с dAb N-концом от IL-1ra, и другой (MCS 2+4) кодирует белок с dAb С-концом от IL1-ra.

Клонирующий сайт 1+3 для слитой конструкции dAblL1-ra

Ndel, вставка, Sail, NotI, вставка, Xhol, BamHI

gcgcatatgttagtgcgtcgacgtcaaaaggccatagcgggcggccgctgcaggtctcgagtgcgatggatcc

(SEQ ID NO:35)

Клонирующий сайт 2+4 для слитой конструкции ILI-radAb

Ndel, вставка, StUI, Sad, вставка, Sail, NotI, TAA TAA BamHI gcgcatatgttaagcgaggccttctggagagagctcaggagtgtcgacggacatccagatgacccaggcggccgctaa taaggatccaatgc (SEQ ID NO:36)

GAS лидерную последовательность затем вставили в каждый вектор путем расщепления MCS с использованием подходящих рестрикционных ферментов и лигирования отожженных праймеров, кодирующих лидерную последовательность. Затем схожим образом вставляли линкерную ДНК, кодирующую линкер. ДНК, кодирующую IL-1ra, получали методом ПЦР (полимеразная цепная реакция) (используя праймеры, разработанные для добавления требуемых рестрикционных сайтов) из сДНК-клона и вставляли в ТОРО клонирующий вектор. После подтверждения правильной последовательности секвенированием нуклеиновой кислоты ДНК, кодирующую IL-1ra, вырезали из ТОПО вектора и лигировали в векторы, содержащие лидерную последовательность и линкер. Наконец, ДНК, кодирующую dAb, вырезали из вектора, экспрессирующего dAb, и вставили в векторы обработкой вставки (очищенной при помощи гель-хроматографии) и вектора при помощи SaIl/Notl.

Экспрессия и очистка

MSA16IL1-ra, IL1-raMSA16 и dummyIL-1ra (холостой IL-1ra) экспрессировали в периплазме E. coli и очищали из супернатанта, применяя абсорбцию культуральной среды при протеин L-агарозной аффинной хроматографии (Affitech, Norway) с последующим элюированием глицином при рН 2,2. Очищенные dAbs затем анализировали при помощи SDS-PAGE с последующим окрашиванием кумасси. Для одного из белков (IL-1raMSA 16) более 90% белка оказалось ожидаемого размера, и, вследствие этого, он был проанализирован на наличие активности без дальнейшей очистки. Другие белки (MSA16IL1-ra и dummyIL-1ra) были контаминированы полосой меньшего размера и, вследствие этого, были далее очищены при помощи жидкостной ионообменной хроматографии быстрого разрешения (FPLC) на ионообменной колонке RESOURSEQ при рН 9. Белок элюировали линейным градиентом 0-500 мМ NaCl. После SDS-PAGE анализа фракции, содержащие белок ожидаемого размера, объединили, получив объединенную фракцию более чем 90% чистоты. Этот белок использовали для дальнейшего анализа.

Пример 3. Определение активности слитой конструкции dAb IL1-ra in vitro MRC-5 IL-8 анализ

Слитые конструкции MSA16IL-1ra тестировали на способность нейтрализовать индукцию секреции иммуноглобулина IL-8 иммуноглобулином IL-1 в MRC-5 клетках (АТСС Регистрационный номер No. CCL-171; Американская Коллекция Типовых Культур, Manassas, VA). Метод адаптирован из Akeson, L. et al (1996) Journal of Biological Chemistry 271, 30517-30523, в котором описана индукция иммуноглобулина IL-8 иммуноглобулином IL-1 в HUVEC, клетки MRC-5 использовали вместо HUVEC клеточной линии. Вкратце, MRC-5 клетки, посеянные в планшетах для микротитрования, инкубировали в течение ночи в присутствии dAblL-1ra слитых белков или IL-1rа контроля и IL-1 (100 пг/мл). После окончания инкубации супернатант отделяли от клеток аспирированием и измеряли концентрацию IL-8 при помощи «сэндвич» ELISA (R&D Systems).

Активность IL-1rа в слитых белках приводила к уменьшению секреции IL-8. Уменьшение секреции IL-8 в результате активности MSA16IL1-ra слитой конструкции и активности IL-1raMSA16 слитой конструкции сравнивали с уменьшением, увиденным при IL-1ra контроле (рекомбинантный человеческий IL-1rа, R&D Systems). Определяли нейтрализующую дозу 50 (ND50) каждого из тестированных белков и представили результаты в Таблице 2.

Таблица 2
Белок ND50
IL-1ra 0,5 нМ
MSA16IL-1ra 2 нМ
IL-1raMSA16 8 нМ

Результатами продемонстрировано, что IL-1ra оставался активным как часть слитой конструкции с dAb антителом против сывороточного альбумина. Белок MSA16IL-1ra дополнительно исследовали, чтобы оценить его фармакокинетику (РК исследование).

Сывороточный альбумин, анти-IL-1ra «сэндвич» ELISA Три слитых конструкции dAb/IL-1ra тестировали на способность связывать сывороточный альбумин с одновременным детектированием при помощи моноклонального анти-IL1-ra антитела. Изученные слитые конструкции представляли собой MSA16IL-1ra, IL-1raMSA16 и dummylL-lra. Вкратце, планшет ELISA покрывали в течение ночи слоем мышиного сывороточного альбумина в концентрации 10 мкг/мл, промывали 5 раз при помощи 0,05% Твин-PBS и затем блокировали в течение 1 часа при помощи 4% Marvel PBS (MPBS). После окончания блокирования планшет промывали 5 раз при помощи 0,05% Твин-PBS и затем инкубировали в течение 1 часа в присутствии каждой из слитых конструкций dAb/IL-1ra, разбавленных в 4% MPBS. Каждую слитую конструкцию инкубировали в концентрации 1 мкМ и при 7 последовательных 4-кратных разведениях (т.е. уменьшение концентрации до 60 пМ). После инкубирования планшеты промывали 5 раз при помощи 0,05% Твин-PBS и затем инкубировали в течение 1 часа в присутствии рекомендованного производителем разведения кроличьего поликлонального антитела (ab-2573) против антагониста рецептора человеческого IL-1 (Abeam, UK), разбавленного в 4% MPBS. После этого инкубирования, планшеты промывали 5 раз при помощи 0,05% Твин-PBS и затем инкубировали в течение 1 часа в присутствии 1/2000 разведения вторичного антитела (антикроличий IgG-HRP), разбавленного в 4% MPBS. После инкубирования в присутствии вторичного антитела, планшеты промывали 3 раза при помощи 0,05% Твин-PBS и 2 раза при помощи PBS и затем проявляли при помощи 50 мкл на лунку ТМВ микролуночного пероксидазного субстрата (KPL, МА) и останавливали реакцию при помощи 50 мкл на лунку HCL. Абсорбцию считывали при 450 нМ.

Оба белка MSA16IL-1ra и IL-1raMSA16 детектировали на уровне, более чем в два раза превышающем базовый уровень в концентрации 1 мкМ в «сэндвич» ELISA. Белок MSA16IL-1ra детектировали на уровне, в два раза превышающем базовый уровень или выше, при разведениях до 3,9 нМ, в то время как белок IL-1raMSA16 детектировали на уровне, в два раза превышающем базовый уровень, только при разведениях до 500 нМ. Связывание слитой конструкции MSA16IL-1ra с сывороточным альбумином, как показано, является специфическим для сывороточного альбумина, поскольку контрольная конструкция (dummyIL-1ra) не связывала сывороточный альбумин.

Пример 4. Определение периода полувыведения в сыворотке слитых конструкций лекарственного средства при изучении РК на мышах.

А. Определение на мышах периода полувыведения в сыворотке MSA-связывающего слитого белка с dAb/HA эпитопной меткой

MSA-связывающий слитый белок с dAb/HA эпитопной меткой экспрессировали в периплазме Е. coli и очищали, применяя абсорбцию культуральной среды при протеин L-агарозной аффинной хроматографии (Affitech, Norway) с последующим элюированием глицином при рН 2,2. Период полувыведения в сыворотке слитого белка определяли на мышах после однократной внутривенной (в/в) инъекции в концентрации приблизительно 1,5 мг/кг животным мужского пола штамма CD1. Анализ сывороточных концентраций проводили при помощи ELISA с использованием захвата козлиных анти-НА (Abeam, UK) и детекции протеин L-HRP конъюгата (Invitrogen, USA), который блокировали при помощи 4% Marvel. Промывку проводили при помощи 0,05% Твин-20, PBS. Стандартные кривые известных концентраций MSA-связывающей слитой конструкции dAb/HA установили в присутствии 1х мышиной сыворотки, чтобы обеспечить сравнимость с испытуемыми образцами. Моделирование при помощи однокомпонентной модели (WinNonlin Software, Pharsight Corp., USA) показало, что MSA-связывающий слитый белок dAb/HA эпитопной метки имел конечную фазу t1/2, равную 29,1 часа, и площадь под кривой, равную 559 час-мкг/мл. Этим продемонстрировано значительное улучшение по сравнению с прогнозируемым периодом полувыведения отдельного пептида с НА эпитопной меткой, который мог быть настолько коротким, что составлял бы всего несколько минут.

Результаты этого исследования с использованием НА эпитопной метки в качестве модели лекарственного средства демонстрируют, что in vivo период полувыведения в сыворотке лекарственного средства можно увеличить, если лекарственное средство изготовлено в виде слитой конструкции лекарственного средства или конъюгата лекарственного средства с антигенсвязывающим фрагментом (например, dAb) антитела, которое связывает сывороточный альбумин.

Также оценивали на мышах in vivo период полувыведения анти-MSA dAbs DOM7m-16 и DOM7m-26, а также контрольного dAb, которое не связывает MSA. Снова, DOM7m-16, DOM7m-26 и контрольное dAb содержали НА эпитопную метку, которая служит в качестве модели лекарственного средства (например, пептидное лекарственное средство). В данном исследовании, контрольное dAb, которое не связывает MSA, имело in vivo период полувыведения, равный 20 минутам, в то время как in vivo периоды полувыведения DOM7m-16 и DOM7m-26 были значительно увеличены. (Фиг.12) В дальнейших экспериментах на мышах было обнаружено, что DOM7m-16 имеет in vivo период полувыведения, равный 29,5 часа.

В другом исследовании, in vivo период полувыведения (t1/2β) DOM7h-8, который содержал НА эпитопную метку, оценивали на мышах. Моделирование при помощи двухкомпонентной модели (WinNonlin Software, Pharsight Corp., USA) показало, что DOM7h-8 имел t1/2p, равный 29,1 часа.

Результаты каждого из этих исследований с использованием НА эпитопной метки в качестве модели лекарственного средства (например, пептидного лекарственного средства) демонстрируют, что in vivo период полувыведения в сыворотке лекарственного средства можно значительно увеличить, если лекарственное средство изготовлено в виде слитой конструкции лекарственного средства или конъюгата лекарственного средства с антигенсвязывающим фрагментом (например, dAb) антитела, которое связывает сывороточный альбумин.

В. Определение на мышах периода полувыведения в сыворотке MSA-связывающего dAb/IL-1ra слитого белка

MSA-связывающий dAb/IL-1ra слитый белок (MSA16IL-1ra) экспрессировали в периплазме E. соli и очищали, применяя абсорбцию культуральной среды при протеин L-агарозной аффинной хроматографии (Affitech, Norway) с последующим элюированием глицином при рН 2,2. Период полувыведения в сыворотке MSA16IL-1ra (DOM7m-16/IL-1ra), слитой конструкции IL-1ra с dAb, которое не связывает MSA (dummy dAb/IL-1ra), и анти-MSA dAb, слитого с НА эпитопной меткой (DOM7m-16 НА метка), определяли на мышах после однократной в/в инъекции в концентрации приблизительно 1,5 мг/кг животным мужского пола штамма CD1.

Анализ сывороточных концентраций проводили при помощи IL-1ra «сэндвич» ELISA (R&D Systems, USA). Стандартные кривые известных концентраций dAb/IL-1ra слитой конструкции установили в присутствии 1х мышиной сыворотки, чтобы обеспечить сравнимость с испытуемыми образцами. Моделирование осуществляли при помощи WinNonlin фармакокинетической компьютерной программы (Pharsight Corp., USA).

Ожидалось, что слитая конструкция IL-1ra с анти-MSA dAb значительно бы увеличила период полувыведения в сыворотке в сравнении с контролем, который представлял собой слитую конструкцию dAb, не связывающего MSA, с IL-1ra. Прогнозировали, что не связывающая MSA контрольная слитая конструкция dAb/IL-1ra имеет короткий период полувыведения в сыворотке.

Результаты исследования представлены в Таблице 3 и показывают, что слитая конструкция IL-1ra с анти-MSA dAb (DOM7m-16/IL-1ra) имела период полувыведения в сыворотке, который был примерно в 10 раз длиннее, чем у слитой конструкции IL-1ra с dAb, которое не связывает MSA (dummy dAb/IL-1ra). Результатами также обнаружено, что получили более чем 200-кратное улучшение (увеличение) площади под кривой зависимости концентрации от времени для DOM7m-16/IL-1ra (AUC: 267 час-мкг/мл) по сравнению с dummy dAb/IL-1ra (AUC: 1,5 час·мкг/мл).

Таблица 3
Агент Период полувыведения в сыворотке
DOM7m-16/IL-1ra 4,3 часа
dummy dAb/IL-1ra 0,4 часа
DOM7m-16 HA метка 29 часов

Результаты данных исследований демонстрируют, что in vivo период полувыведения в сыворотке и AUC лекарственного средства можно значительно увеличить, если лекарственное средство изготовлено в виде слитой конструкции лекарственного средства или конъюгата лекарственного средства с антигенсвязывающим фрагментом (например, dAb) антитела, которое связывает сывороточный альбумин.

Пример 5. Определение на крысах периода полувыведения в сыворотке RSA-связывающих слитых белков с dAb/HA эпитопной меткой

Антикрысиные dAbs против сывороточного альбумина экспрессировали с С-концевыми НА метками в периплазме Е. coli и очищали, применяя абсорбцию культуральной среды при протеин L-агарозной аффинной хроматографии (Affitech, Norway) для VK dAbs и абсорбцию культуральной среды при протеин А-аффинной хроматографии для VH dAbs с последующим элюированием глицином при рН 2,2. Чтобы определить период полувыведения в сыворотке, группам из 4 крыс вводили однократно в/в инъекцию в концентрации 1,5 мг/кг на основе DOM7r-27, DOM7r-31, DOM7r-16, DOM7r-3 или контрольного dAb (HEL4), которое связывает посторонний антиген. Образцы сыворотки получали серийным кровопусканием из хвостовой вены в течение 7-суточного периода и анализировали при помощи «сэндвич» ELISA с использованием козлиных анти-НА (Abeam, Cambridge UK), адсорбированных на планшете ELISA, с последующей детекцией при помощи протеин A-HRP конъюгата (для VH dAbs) или протеин L-HRP конъюгата (для VK dAbs). Стандартные кривые известных концентраций dAb установили в присутствии 1х крысиной сыворотки, чтобы обеспечить сравнимость с испытуемыми образцами. Использовали моделирование при помощи двухкомпонентной модели (с примением WinNonlin фармакокинетической компьютерной программы (Pharsight Corp., USA)) для расчета t1/2p и площади под кривой (AUC) (Таблица 4).

Таблица 4
Агент Каркас Сродство (KD) к крысиному сывороточному альбумину t1/2β AUC (мкг·час/мл)
DOM7r-3 VK 12 нМ 13,7 часа 224
DOM7C-16 VK 1 мкМ 34,4 часа 170
DOM7r-27 VH 250 нМ 14,8 часа 78,9
DOM7r-31 VH 5 мкМ 5,96 часа 71,2

Результаты этого исследования на крысах с использованием НА эпитопной метки в качестве модели лекарственного средства (например, пептидного лекарственного средства) демонстрируют, что in vivo период полувыведения в сыворотке лекарственного средства можно значительно увеличить, если лекарственное средство изготовлено в виде слитой конструкции лекарственного средства или конъюгата лекарственного средства с антигенсвязывающим фрагментом (например, dAb) антитела, которое связывает сывороточный альбумин.

Прогнозирование периода полувыведения у человека

In vivo период полувыведения dAb, слитой конструкции лекарственного средства или конъюгата лекарственного средства у человека можно оценить, исходя из данных относительно периода полувыведения, полученных на животных, применяя аллометрическое масштабирование. Значения log in vivo периодов полувыведения, определенных у 3 животных, изображают в виде графика относительно значений log массы животного. Проводят линию по нанесенным точкам и используют тангенс угла наклона кривой и отрезок, отсекаемый кривой на координатной оси у, для расчета in vivo периода полувыведения у человека, применяя формулу:

log Y=log(a)+b log(W),

в которой Y представляет собой in vivo период полувыведения у человека, log(а) представляет собой отрезок, отсекаемый кривой на координатной оси у, b представляет собой тангенс угла наклона кривой и W представляет собой массу животного. Можно получить линию, используя данные относительно in vivo периода полувыведения, полученные у животных, которые весят примерно 35 граммов (например, мыши), примерно 260 граммов (например, крысы) и примерно 2710 граммов. Для этого расчета можно принять, что масса человека составляет 70000 граммов.

Пример 6. Эффективность анти-SA dAb/IL-1ra слитой конструкции лекарственного средства в коллаген-индуцированной модели артрита ревматоидного артрита у мышей

Оценивали эффективность слитой конструкции DOM7m-16/IL-1ra и эффективность IL-1ra в признанной модели ревматоидного артрита у мышей (коллаген-индуцированный артрит II типа (CIA) у DBA/1 мышей). В продолжение исследования, мышей содержали в лабораторном помещении в стандартных клетках 2 типа, которые размещались в контейнере типа Scantainer с подачей воздуха, очищенного при помощи высокоэфективных фильтров типа НЕРА, при 20-24°С с 12-часовым дневным, 12-часовым ночным циклом. Пищу (Harlan-Teklad универсальная диета 2016) и стерилизованную ультрафиолетом воду предоставляли в избытке. Мышей размещали в лабораторном помещении, по меньшей мере, за 7 дней до начала исследования, чтобы обеспечить надлежащую акклиматизацию.

DBA/1 мышам в возрасте 7-8 недель (получены от Taconic M and В, Domholtveg, Denmark) однократно инъекцировали эмульсию Arthrogen-CIA адъюванта и Arthrogen-CIA коллагена (оба MD biosciences), которые эмульгировали в соотношении 1:1 до получения стабильной эмульсии. Эмульсию считали стабильной, когда капля эмульсии, добавленной в химический стакан с водой, образовывала плотный комок. Затем мышам инъецировали эмульсию.

Через двадцать один день после инъецирования эмульсии 20 животных с наиболее прогрессировавшим артритическим заболеванием исключили из исследования, а оставшихся мышей разделили на группы по 10 животных (каждая группа включала 5 самцов и 5 самок). Мышей лечили, как показано в Таблице 5, и все виды терапии применяли в концентрации, рассчитанной таким образом, чтобы вводить 10 мл/кг.

Таблица 5
Группа Лечение
1 IL-1ra, 1 мг/кг (внутрибрюшинный (в/б) болюс)
2 IL-1ra, 10 мг/кг (в/б болюс)
3 DOM7m-16/IL-1ra, 1 мг/кг (в/б болюс)
4 DOM7m-16/IL-1ra, 10 мг/кг (в/б болюс)
5 ENBREL® (entarecept; Immunex Corporation), 5 мг/кг (в/б болюс)
6 Физиологический раствор (негативный контроль), 10 мл/кг (в/б болюс)
7 Дексаметазон (позитивный контроль), 0,4 мг/кг (подкожная инъекция)

Клинические показатели тяжести артрита регистрировали 3 раза в неделю, начиная с 21 суток по 49 сутки. Мышей подвергали эйтаназии на 49 сутки. Отдельных мышей подвергали эйтаназии ранее, если они представляли артритический показатель, равный 12 баллов или более, или имели серьезные прогрессирующие проблемы.

Для составления шкалы клинических показателей, каждую конечность оценивали в баллах в соответствии с критериями, приведенными ниже, и баллы для всех четырех конечностей складывали вместе, чтобы получить общий показатель в баллах для мыши. Данный метод приводил к получению показателя в баллах от 0 до 16 для каждой мыши. Оценочные критерии в баллах представляли собой: 0 = нормально; 1 = слабая, но достоверная краснота и опухание щиколотки или запястья, или явная краснота и опухание, ограниченные отдельными пальцами, независимо от количества пораженных пальцев; 2 = умеренная краснота и опухание щиколотки и запястья; 3 = сильная краснота и опухание целой лапы, включая пальцы; 4 = максимально воспаленная конечность с вовлечением многочисленных суставов.

Средние групповые артритические показатели в баллах рассчитывали для каждой группы, получавшей лечение, на каждые сутки лечения с использованием клинических показателей в баллах от отдельных мышей. Любым животным, удаленным из исследования по этическим причинам, присваивали максимальный балл, равный 16. Средние групповые артритические показатели в баллах представили в виде графика относительно времени (Фиг.13).

Статистический анализ средних групповых артритических показателей в баллах на 49 сутки выполнили с использованием Wilcoxon теста. Этим статистическим анализом обнаружено, что две группы, которые лечили при помощи DOM7m-16/IL-1ra (в количестве 1 мг/кг или 10 мг/кг (Группы 3 и 4)), значительно улучшили артритические показатели в баллах на 49 сутки (при Р<1% и Р<0,05% уровнях значимости, соответственно) в сравнении с контрольной группой, получавшей физиологический раствор (Группа 6). В отличие от этого, лечение при помощи IL-1ra в количестве 1 мг/кг (Группа 1) не привело к статистически достоверному улучшению артритического показателя в баллах на 49 сутки, в то время как лечение при помощи IL-1ra в количестве 10 мг/кг (Группа 2) привело к значительному улучшению при Р<5% уровне значимости. Лечение при помощи ENBREL® (entarecept; Immunex Corporation) (Группа 5) привело к значительному улучшению артритического показателя в баллах на 49 сутки при Р<10% уровне значимости.

Лечение при помощи DOM7m-16/IL-1ra в дозе 10 мг/кг (Группа 4) было эффективно в улучшении артритического показателя в баллах на 49 сутки (статистически достоверно при Р<0,5% уровне значимости) в сравнении со стандартным лечением при помощи ENBREL® (entarecept; Immunex Corporation) в количестве 5 мг/кг (Группа 5). Кроме того, лечение при помощи DOM7m-16/IL-1ra в меньшей дозе 1 мг/кг (Группа 3) было более эффективно в улучшении артритического показателя в баллах на 49 сутки, чем лечение при помощи отдельного IL-1ra в той же самой дозе (Группа 1) (статистически достоверно при Р<10% уровне значимости).

Результаты исследования показывают, что в определенных дозах DOM7m-16/IL-1ra был более эффективен, чем IL-1ra или ENBREL® (entarecept; Immunex Corporation) в данном исследовании. Отклик на лечение при помощи IL-1ra был, как ожидалось, дозозависимым, и отклик на лечение при помощи DOM7m-16/IL-1ra был также дозозависимым. Средние показатели в баллах при лечении с применением DOM7m-16/IL-1ra в количестве 1 мг/кг были последовательно ниже, чем средние показатели в баллах, полученные путем лечения с применением IL-1ra в количестве 10 мг/кг. Эти нанесенные на график результаты (Фиг.13) показывают, что лечение при помощи DOM7m-16/IL-1ra было примерно в 10 раз более эффективным, чем при помощи IL-1ra в данном исследовании.

Эту более высокую эффективность DOM7m-16/IL-1ra наблюдали даже при том, что DOM7m-16/IL-1ra слитый белок содержит примерно половину количества IL-1 рецепторсвязывающих эпитопов, нежели IL-1ra, в пересчете на массу (например, 1 мг DOM7m-16/IL-1ra (Молекулярная масса (М.м.) 31,2 кДа) содержит примерно половину количества IL-1 рецепторсвязывающих эпитопов, нежели 1 мг IL-1ra (М.м. 17,1 кДа).

Результатами данного исследования продемонстрировано, что dAb, которое связывает сывороточный альбумин, можно соединить с IL-1ra (клинически доказанная терапия для RA), и что полученная в результате слитая конструкция лекарственного средства имеет свойства длительного периода полувыведения в сыворотке (предоставленные за счет dAb), а также IL-1 рецепторсвязывающие свойства (предоставленные за счет IL-1ra). Благодаря времени циркуляции в сыворотке слитой конструкции лекарственного средства, доза DOM7m-16/IL-1ra, которая была эффективна при лечении CIA, была значительно уменьшена по сравнению с IL-1ra.

Результатами данного исследования продемонстрировано, что, в дополнение к преимуществам увеличенного периода полувыведения и увеличенной AUC, лекарственные средства, изготовленные в виде слитых конструкций лекарственного средства или конъюгатов лекарственного средства с антигенсвязывающим фрагментом (например, dAb) антитела, которое связывает сывороточный альбумин, представляют собой высокоэффективные терапевтические агенты, которые предоставляют преимущества по сравнению с отдельным лекарственным средством. Например, как продемонстрировано в модели CIA на мышах, более низкая доза слитой конструкции лекарственного средства была эффективна и ингибировала воспаление сустава и повреждение сустава, вызванные IL-1, в течение более длительного периода времени по сравнению с отдельным IL-1ra, а также предоставляла большую защиту от развития заболевания.

Пример 7. Анти-SA dAb/Сапорин нековалентный конъюгат лекарственного средства

Белок Сапорин, инактивирующий рибосому (противораковое лекарственное средство), является крайне устойчивым к действию денатурирующих агентов и протеаз и использовался в качестве целевого токсина к Т-лимфоцитам. Нековалентный конъюгат лекарственного средства получили путем соединения Сапорина и DOM7h-8 через биотин-стрептавидиновую связь. Результаты, полученные с этим нековалентным конъюгатом лекарственного средства, демонстрируют, что DOM7h-8 сохраняет свои характеристики связывания сывороточного альбумина при соединении с лекарственным средством.

Вариант DOM7h-8, называемый DOM7h-8cys, в котором С-концевой аргинин в положении 108 (аминокислота 108 из SEQ ID NO:24) был замещен остатком цистеина, получили экспрессией рекомбинантной нуклеиновой кислоты в НВ2151 клетках. Клетки культивировали и индуцировали при 30°С в экспрессирующей системе самоиндукции ТВ readymix (Merck KGa, Germany) в течение 72 часов перед выделением супернатанта центрифугированием. DOM7h-8cys очищали из супернатанта с применением аффинной хроматографии на протеин L-агарозе. Затем ионообменную смолу промывали 10 объемами колонки 2×PBS и элюировали DOM7h-8cys 0,1 М глицином, рН 2. Элюированный DOM7h-8cys нейтрализовали при помощи 0,2 × объем Tris рН 8 и концентрировали до концентрации 1 мг/мл (используя концентратор CENTRICON с рабочим объемом 20 мл (Millipore Corp., MA)).

В концентрированном DOM7h-8cys заменили буфер на PBS с использованием NAP5 диализующей колонки (GE Healthcare/Amersham Biosciences, NJ) и определили концентрацию. dAb затем биотинилировали (через первичные амины), используя EZ-LINK сульфо-МН8-1-С-биотин (Pierce Biotechnology Inc., IL). Биотинилированное dAb смешивали с субстратом стрептавидин-сапорин в 1:1 молярном соотношении.

Чтобы подтвердить образование комплекса dAb/сапорин, использовали «сэндвич» ELISA для детекции интактных комплексов. Наносили человеческий сывороточный альбумин (HAS) на половину лунок ELISA планшета (Nunc, NY) в течение ночи в концентрации 10 мкг/мл в объеме 100 мкл на лунку. После инкубирования в течение ночи планшет промывали трижды при помощи PBS, 0,05% Твин, и затем весь планшет блокировали в течение 2 часов при помощи 2% PBS. После блокирования планшет промывали трижды при помощи PBS, 0,05% Твин, и затем инкубировали в течение 1 часа в присутствии DOM7h-8/сапорин нековалентного конъюгата, разбавленного до 0,5 мкМ в 2% Твин-PBS. В качестве контроля, на том же самом планшете ELISA инкубировали несвязанный сапорин в концентрации 0,5 мкМ и несвязанный DOM7h-8 в концентрации 0,5 мкМ в 2% Твин-PBS. Дополнительным контролем являлись те же самые три разбавленных белка, инкубированных на лунках ELISA планшета, не покрытых при помощи HSA и блокированных при помощи 2% Твин. После инкубирования планшет промывали трижды при помощи PBS, 0,05% Твин, и затем инкубировали в течение 1 часа в присутствии 1/2000 разведения козлиного антисапорин поликлонального антитела (Advanced Therapeutic Systems), разбавленного в 2% Твин-PBS. После инкубирования планшет промывали трижды при помощи PBS, 0,05% Твин, и затем инкубировали в течение 1 часа в присутствии вторичного детекторного антитела (из 1/2000 антикозлиного Ig HRP конъюгата). После инкубирования планшет промывали трижды при помощи PBS, 0,05% Твин, и один раз при помощи PBS и осушивали встряхиванием на бумаге. ELISA проявляли при помощи 100 мкл 3,3',5,5'-тетраметилбензидина в качестве субстрата и реакцию останавливали при помощи 50 мкл 1М хлороводородной кислоты. Наличие нековалентных конъюгатов DOM7h-8 и сапорина подтверждали сравнением OD600 конъюгата с OD600 любой из неконъюгированных частей.

Таблица 6
DOM7h-8/сапорин DOM7h-8 отдельно Сапорин отдельно
OD600 (планшет покрыт при помощи HAS) 0,311 0,060 0,079
OD600 (планшет блокирован при помощи 2% Твин-PBS) 0,078 0,068 0,075

Результатами данного исследования продемонстрировано, что лекарственное средство можно конъюгировать с антигенсвязывающим фрагментом антитела, которое связывает сывороточный альбумин, и что конъюгированный антигенсвязывающий фрагмент сохраняет активность связывания сывороточного альбумина. Кроме того, благодаря стабильности и прочности биотин-стрептавидиновой комбинации, результатами показано, что можно получать ковалентно связанные и нековалентно связанные конъюгаты, которые сохраняют активность связывания сывороточного альбумина, принадлежащую антигенсвязывающему фрагменту антитела, которое связывает сывороточный альбумин.

Пример 8. Анти-SA dAb/Флуоресцеин конъюгат

Флуоресцеинизотиоцианат (FITC) может быть поперечно связан с амино, сульфгидрил, имидазоил, тирозил или карбонильной группами белка. Он имеет молекулярную массу 389 Да, которая сравнима по размеру со многими малыми молекулами лекарственных средств. Результаты, полученные с этим конъюгатом, демонстрируют, что анти-SA dAb поддерживает свои характеристики связывания сывороточного альбумина при соединении с малой химической структурой, и показывают, что малые молекулы лекарственных средств можно конъюгировать с анти-SA dAbs.

Концентрированный DOM7h-8cys получали, как описано в Примере 7. В концентрированном dAb заменили буфер на 50 мМ борат, рН 8 (связывающий буфер) с использованием NAP5 диализующей колонки (GE Healthcare/Amersham Biosciences, NJ) и концентрировали до концентрации 2,3 мг/мл, используя концентратор CENTRICON с рабочим объемом 2 мл (Millipore Corp., MA). FITC (Pierce Biotechnology Inc.) разбавили до концентрации 10 мг/мл в диметилформамиде (DMF) в соответствии с инструкциями производителя и затем смешали с dAb в связывающем буфере в молярном соотношении 24:1 FITC:dAb. Реакцию проводили в течение 30 минут. В этот момент избыток непрореагировавшего FITC удалили из реакции с использованием PDIO диализующей колонки (GE Healthcare/Amersham Biosciences, NJ), которую предварительно уравновешивали при помощи PBS, и элюировали DOM7h-8cys/ FITC конъюгат при помощи PBS.

Чтобы подтвердить, что реакция соединения FITC/dAb прошла успешно, использовали «сэндвич» ELISA для детекции связанного dAb. Наносили человеческий сывороточный альбумин (HSA) на половину лунок ELISA планшета (Nunc, NY) в течение ночи в концентрации 10 мкг/мл в объеме 100 мкл на лунку. После инкубирования в течение ночи весь планшет промывали трижды при помощи PBS, 0,05% Твин, и затем все лунки блокировали в течение 2 часов при помощи 2% Твин-PBS. После блокирования планшет промывали трижды при помощи PBS, 0,05% Твин, и затем инкубировали в течение 1 часа в присутствии DOM7h-8cys/FITC, разбавленного до концентрации 1 мкМ в 2% Твин-PBS. В качестве контроля, на том же самом планшете ELISA инкубировали контрольное FITC-связанное антитело в концентрации 1 мкМ и несвязанный DOM7h-8 в концентрации 1 мкМ в 2% Твин-PBS. Дополнительным контролем являлись те же самые три разбавленных белка, инкубированных на лунках ELISA планшета, не покрытых при помощи HSA и блокированных при помощи 2% Твин. После инкубирования планшет промывали трижды при помощи PBS, 0,05% Твин, и затем инкубировали в течение 1 часа в присутствии 1/500 разведения крысиного анти-FITC антитела (Serotec), разбавленного в 2% Твин-PBS. После инкубирования планшет промывали трижды при помощи PBS, 0,05% Твин, и затем инкубировали в течение 1 часа в присутствии вторичного детекторного антитела, разбавленного в 2% Твин-PBS (1/5000 антикрысиный Ig HRP конъюгат). После инкубирования планшет промывали трижды при помощи PBS, 0,05% Твин, и один раз при помощи PBS и осушивали встряхиванием на бумаге. ELISA проявляли при помощи 100 мкл на лунку 3,3',5,5'-тетраметилбензидина в качестве субстрата и реакцию останавливали при помощи 50 мкл на лунку 1 М хлористоводородной кислоты. Наличие конъюгатов DOM7h-8 и FITC подтверждали сравнением OD600 конъюгата с OD600 любой из неконъюгированных частей.

Таблица 7
DOM7h-8/ FITC DOM7h-8 отдельно FITC-связанное антитело (негативный контроль)
OD600 (планшет покрыт при помощи HSA) 0,380 0,042 0,049
OD600 (планшет блокирован при помощи 2% Твин-PBS) 0,041 0,041 0,045

Пример 9. Анти-SA dAb/пептид конъюгаты

Многие пептиды имеют терапевтические эффекты. Модельные пептиды с N- или С-концевым цистеином можно соединить с dAb против сывороточного альбумина.

В данном случае, будут использованы четыре различных пептида: пептид 1 YPYDVPDYAKKKKKKC (SEQ ID NO:68); пептид 2 CKKKKKKYPYDVPDYA (SEQ ID NO:69); пептид 3 HHHHHHKKKKKKC (SEQ ID NO:70) и пептид 4: СККККККНННННН (SEQ ID NO:71). Пептиды 1 и 2 включают последовательность гемагглютининовой метки (НА-метка), и пептиды 3 и 4 включают последовательность His-метки. Концентрированный DOM7h-8cys получают, как описано в Примере 7.

Концентрированное dAb восстанавливают при помощи 5 мМ дитиотреитола (DTT) и затем заменяют буфер на связывающий буфер (20 мМ BisTris рН 6,5, 5 мМ EDTA, 10% глицерина) с использованием NAP5 диализной колонки (GE Healthcare/Amersham Biosciences, NJ). Цистеины блокируют (чтобы предотвратить димеризацию dAb друг с другом) с использованием конечной концентрации 5 мМ дитиодипиридина, который добавляют к раствору dAb из исходного раствора с концентрацией 100 мМ дитиодипиридина в DMSO. dAb и дитиодипиридин выдерживают для протекания реакции связывания в течение 20-30 минут. Непрореагировавший дитиодипиридин затем удаляют с использованием РО10 диализной колонки, и dAb элюируют в связывающем буфере (20 мМ BisTris рН 6,5, 5 мМ EDTA, 10% глицерина). Полученный белок затем замораживают до необходимости.

Пептиды 1-4 отдельно растворяют в воде при концентрации 200 мкМ, восстанавливают с использованием 5 мМ DTT и затем обессоливают с использованием NAP5 диализной колонки (GE Healthcare/Amersham Biosciences, NJ). Каждый пептид затем добавляют к раствору восстановленного и блокированного dAb в соотношении 20:1 для осуществления соединения пептид-dAb. Чтобы подтвердить успешное проведение реакций соединения пептида и dAb, «сэндвич» ELISA используют для детектирования анти-SA dAb/пептид конъюгатов.

Наносят человеческий сывороточный альбумин на ELISA планшет (Nunc, NY) в течение ночи в концентрации 10 мкг/мл в объеме 100 мкл на лунку. После инкубирования в течение ночи планшет промывают трижды при помощи PBS, 0,05% Твин, и затем блокируют в течение 2 часов при помощи 4% Marvel PBS. После блокирования планшет промывают трижды при помощи PBS, 0,05% Твин, и затем инкубируют в течение 1 часа в присутствии DOM7h-8/пептидных конъюгатов, разбавленных до концентрации 1 мкМ в 4% Marvel PBS. В качестве контроля, на том же самом планшете ELISA инкубируют несвязанный пептид в концентрации 20 мкМ и несвязанный DOM7h-8 в концентрации 1 мкМ в 4% MPBS. После инкубирования планшет промывают трижды при помощи PBS, 0,05% Твин, и затем инкубируют в течение 1 часа в присутствии 1/2000 разведения козлиного анти-НА антитела (Abeam) для пептидов 1 и 2 и 1/2000 разведения Ni NTA-HRP (для пептидов 3 и 4), разбавленных в 4% Marvel PBS. После инкубирования планшет промывают трижды при помощи PBS, 0,05% Твин, и лунки с козлиным анти-НА антителом инкубируют в течение 1 часа в присутствии вторичного антикозлиного HRP антитела, разбавленного 1/2000 в 4% MPBS (другие лунки блокировали в течение 1 ч). После инкубирования планшет промывают трижды при помощи PBS, 0,05% Твин, и один раз при помощи PBS и осушают встряхиванием на бумаге. ELISA проявляют при помощи 3,3',5,5'-тетраметилбензидина в качестве субстрата и реакцию останавливают при помощи 1 М хлороводородной кислоты. Наличие конъюгатов DOM7h-8/пептидный конъюгат подтверждают сравнением OD600 конъюгата с OD600 любой из неконъюгированных частей.

Таблица 8
Противораковые пептиды
Категория пептида Пептидная последовательность Действие/применение
LH-RH агонисты и антагонисты p-Glu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 SEQ ID NO:89 Лечение злокачественных заболеваний, зависящих от половых гормонов
Гастрин-высвобождающий пептид p-Glu-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2 SEQ ID NO:90 Мелкоклеточная карцинома легкого
Соматостатин p-Ala-Gly-Cys-Lys-Asn-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys SEQ ID NO:91 Злокачественные новообразования (общие)
GH-RH Gln-Trp-Ala-Val-Gly-His-Leu-psi(CH2-NH)-Leu-NH2 (RC-3094) SEQ ID NO:92 Глиобластома, рак предстательной железы
VEGF Arg-Arg-Lys-Arg-Arg-Arg SEQ ID NO:93 Человеческий рак толстого кишечника
Ala-Thr-Trp-Leu-Pro-Pro-Arg SEQ ID NO:94 Пролиферация злокачественных клеток
Arg-Thr-Glu-Leu-Asn-Val-Gly-Ile-Asp-Phe-Asn-Trp-Glu-Tyr-Pro-Ala-Ser-Lys SEQ ID NO:95 Пролиферация и миграция злокачественных клеток
His-His-Glu-Val-Val-Lys-Phe-Met-Asp-Val-Tyr-Gln SEQ ID NO:96 Ингибирует ответ эндотелиальных клеток
Asn-Ile-Thr-Val-Thr-Leu-Lys-Lys-Phe-Pro-Leu SEQ ID NO:97 Ингибитор ангиогенеза
EGF Cys-His-Ser-Gly-Tyr-Val-Gly-Val-Arg-Cys Ингибирует EGF-основанную клеточную
SEQ ID NO:98 пролиферацию
Tyr-Cys-Asp-Gly-Phe-Tyr-Ala-Cys-Tyr-Met-Asp-Val-Nh2 SEQ ID NO:99 Связывает HER2
IL-6 Gly-Gly-Cys-Lys-Leu-Trp-Thr-Ile-Pro-Glu-Cys-Gly-Gly SEQ ID NO: 100 Ингибирует клеточный рост
IL-8 Ala-Val-Leu-Pro-Arg SEQ ID NO:101 Индукция апоптоза и противоопухолевый эффект in vivo
PDGF Tyr-Gly-Arg-Pro-Arg-Glu-Ser-Gly-Lys-Lys-Arg-Lys-Arg-Lys-Arg-Leu-Lys-Pro-Thr SEQ ID NO:102 Ингибирует рост злокачественной глиомы
TNF AcCys-Pro-Ser-Glu-Gly-Leu-Cys-NH2 SEQ ID NO:103 Ингибирует рост опухоли
Ac-Cys-Pro-Ser-Glu-Gly-Thr-Pro-Ser-Thr-His-Val-Leu-Cys-NH2 SEQ ID NO:104
Ac-Leu-Ala-Asn-Gly-Val-Glu SEQ ID NO:105
Pro-Gln-Ala-Glu-Gly-Gln-Leu-NH2 SEQ ID NO:106
Val-Ala-Asn-Pro-Gln-Ala-Glu-Gly-Gln-Leu SEQ ID NO:107
Циклический Lys-Gly-Asp-Gln-Leu-Ser SEQ ID NO:108
Циклический Tyr-Ser-Gln-Val-Leu-Phe-Lys-Gly SEQ ID NO:109
Альфа-фето Glu-Met-Thr-Pro-Val-Asn-Pro-Gly Ингибирует эстроген-
протеин SEQ ID NO:110 зависимые клетки рака груди
Сиалил-Льюис миметик Ile-Glu-Leu-Leu-Gln-Ala-Arg SEQ ID NO:111 Ингибирует заселение легких клетками опухоли
Урокиназаподобный активатор плазминогена Cys-Val-Ser-Asn-Lys-Tyr-Phe-Ser-Asn-Ile-His-Trp-Cys SEQ ID NO:112 Антагонист для uPA/uPAR
Phe-X-X-Tyr-Lys-Trp SEQ ID NO:113 Антагонист для uPA/uPAR
Lys-Trp-X-X-Ar SEQ ID NO:114 Антагонист для uPA/uPAR
Leu-Asn-Phe-Ser-Gln-Tyr-Leu-Trp-Tyr-Thr-NH2 SEQ ID NO:115 Антагонист для uPA/uPAR
Ac-Lys-Pro-Ser-Ser-Pro-Pro-Glu-Glu-NH2 SEQ ID NO:116 Ингибирует прогрессирование опухоли и ангиогенез
р53 Ac-Met-Pro-Arg-Phe-Met-Asp-Tyr-Trp-Glu-Gly-Leu-Asn-NH2 SEQ ID NO: 117 Ингибирует Hdm2 и связывание р53
Met-Val-Arg-Arg-Phe-Leu-Val-Thr-Leu-Arg-Ile-Arg-Arg-Ala-Cys-Gly-Pro-Pro-Arg-Val SEQ ID NO:118 Предотвращает повсеместное распространение р53
Gly-Ser-Arg-Ala-His-Ser-Ser-His-Leu-Lys-Ser-Lys-Gly-Gln-Ser-Thr-Ser-Arg-His-Lys-Lys-Leu SEQ ID NO:119 Активирует р53
p34cdc2 Cys-Ala-Phe-Tyr-Ile SEQ ID NO: 120 Ингибирует взаимодействие между р34/р33 и pRb2 и р107
Leu-Cys-Ala-Phe-Tyr-Ile-Met-Ala-Lys SEQ ID NO:121
Met-Cys-Ser-Met-Tyr-Gly-lle-Cys-Lys SEQ ID NO:122
Cdk2 Tyr-Ser-Phe-Val-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala SEQ ID NO:123 Ингибирует взаимодействие между Cdk2 и гистоном Н1
p21WAF1 Lys-Arg-Arg-Gln-Thr-Ser-Met-Thr-Ala-Phe-Tyr-His-Ser-Lys-Arg-Arg-Leu-Ile-Phe-Ser SEQ ID NO:124 Индуцирует остановку роста G1/S
Lys-Arg-Arg-Leu-Ile-Phe-Ser-Lys SEQ ID NO:125
Phe-Leu-Asp-Thr-Leu-Val-Val-Leu-His-Arg SEQ ID NO:126
E2F/DP транскрипция Arg-Cys-Val-Arg-Cys-Arg-Phe-Val-Val-Trp-Ilе-Gly-Leu-Arg-Val-Arg-Cys-Leu-Val SEQ ID NO:127 Ингибировал E2F функцию in vitro
Leu-Asn-Trp-Аlа-Trp-Аlа-Аlа-Glu-Val-Leu-Lys-Val-Gln-Lys-Arg-Arg-lle-Tyr-Asp-Ile-Thr-Asn-Val SEQ ID NO:128
Leu-Glu-Gly-Ile-Gln-Leu-lle-Ala-NH2 SEQ ID NO:129
Phe-Trp-Leu-Arg-Phe-Thr SEQ ID NO:130
Trp-Val-Arg-Trp-His-Phe SEQ ID NO:131
Trp-Val-Arg-Trp-His
SEQ ID NO:132
Trp-His-Phe-Ile-Phe-Trp SEQ ID NO:133
Ile-Trp-leu-Ser-Gly-Leu-Ser-Arg-Gly-Val-Trp-Val-Ser-Phe-Pro SEQ ID NO:134
Gly-Ser-Arg-Ile-Leu-Thr-Phe-Arg-Ser-Gly-Ser-Trp-Tyr-Ala-Ser SEQ ID NO:135
Asp-Glu-Leu-Lys-Arg-Ala-Phe-Ala-Ala-Leu-Arg-Asp-Gln-Ile SEQ ID NO:136
Всl2 Lys-Lys-Leu-Ser-Glu-Cys-Leu-Lys-Lys-Arg-Ile-Gly-Asp-Glu-Leu-Asp-Ser SEQ ID NO:137 Вызывает апоптоз в свободной от клеток системе
Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg SEQ ID NO:138
Arg-Asn-Ile-Ala-Arg-His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg SEQ ID NO:139
Интегрины Tyr-Ile-Gly-Ser-Arg-NH2 SEQ ID NO:140 Ингибируют связывание клеток опухоли с ECMs
Ac-Tyr-Ile-Gly-Ser-Arg-NH2 SEQ ID NO:141
Ac-Tyr-Ile-Gly-Ser-Arg-NHCH3 SEQ ID NO:142
Ac-Tyr-Ile-Gly-Ser-Arg-N(CH3)2 SEQ ID NO:143
Phe(pNH2)-Ile-Gly-Ser-Arg-NH2 SEQ ID NO:144
Ac-Tyr-Ile-Gly-Ser-Arg-
NHCH(CH3)2 SEQ ID NO:145
CO(Asp-Tyr-Ile-Gly-Ser-Arg-NHPr)2 SEQ ID NO:146
Arg-Gly-Asp SEQ ID NO:147
Tyr-Ile-Gly-Ser-Arg SEQ ID NO:148
Ile-Pro-Cys-Asn-Asn-Lys-Gly-Ala-His-Ser-Val-Gly-Leu-Met-Trp-Trp-Met-Leu-Ala-Arg SEQ ID NO:149
Аналоги ангиостатина Ser-Pro-His-Arg-Pro-Arg-Phe-Ser-Pro-Ala SEQ ID NO:150
Ser-Pro-His-Ala-His-Gly-Tyr-Ile-Pro-Ser SEQ ID NO:151
Thr-Pro-His-Thr-His-Asn-Arg-Thr-Pro-Glu SEQ ID NO:152
Thr-Pro-His-Arg-His-Gln-Lys-Thr-Pro-Glu SEQ ID NO:153
Glu-Pro-His-Arg-His-Ser-Ile-Phe-Thr-Pro-Glu SEQ ID NO: 154
Кадгерины Ac-Cys-His-Ala-Val-Cys-NH2 SEQ ID NO:155 Ингибитор ангиогенеза
Гистон деацетилаза Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp SEQ ID NO:156 Ингибирование лейкоза
ММР2 Cys-Thr-Thr-His-Trp-Gly-Phe-Thr- Опухолевые метастазы
Leu-Cys SEQ ID NO:157

Пример 10. Анализ GLP Композиции Лекарственного средства

Эффективность инсулинотропного агента можно определить расчетом значения ЕС50, исходя из кривой зависимости «доза-эффект». Очищенные плазматические мембраны от стабильной трансфицированной клеточной линии, ВНК467-12А (tk-ts13), экспрессирующей человеческий GMP-1 рецептор, стимулируют при помощи GLP-1 и аналогов пептида, и эффективность выработки сАМР (аденозин 3',5'-циклического монофосфата) измеряют с использованием AlphaScreen™ сАМР набора реактивов от Perkin Elmer Life Sciences.

Получают стабильную трансфицированную клеточную линию и выбирают для скрининга клон с высокой экспрессирующей способностью. Затем клетки культивируют при 5% СО2 в DMEM (Среда Игла в модификации Дульбекко), 5% FCS (фетальная телячья сыворотка), 1% Pen/Strep и 0,5 мг/мл G418.

Клетки с приблизительно 80% конфлюэнтностью промывают 2Х при помощи PBS и собирают при помощи Versene (0,1 М NaCl, 1,5 мМ КН2РO4, 2,7 мМ KCl, 8,0 мМ Nа2НРO4, 1,0 мМ EDTA (этилендиаминтетрауксусная кислота), 5,6 мМ глюкозы), центрифугируют в течение 5 минут при 1000 об/мин и удаляют супернатант. Дополнительные стадии проводят при охлаждении на льду. Клеточный осадок гомогенизируют при помощи Ultrathurax в течение 20-30 сек в 10 мл Буфера 1 (20 мМ Na-HEPES (2-[4-(2-гидроксиэтил)-1-пиперазин]этансульфоновая кислота), 10 мМ EDTA, рН 7,4), центрифугируют 15 минут при 20000 об/мин и клеточный осадок ресуспендируют в 10 мл Буфера 2 (20 мМ Na-HEPES, 0,1 мМ EDTA, рН 7,4). Суспензию гомогенизируют в течение 20-30 секунд и центрифугируют 15 минут при 20000 об/мин. Суспендирование в Буфере 2, гомогенизацию и центрифугирование повторяют однократно, и мембраны ресуспендируют в Буфере 2, которые готовы для дальнейшего анализа или хранения при -80°С.

Анализ функционального рецептора осуществляют измерением индуцированной пептидом выработки сАМР при помощи AlphaScreen Technology. Основной принцип AlphaScreen Technology заключается в конкуренции между эндогенным сАМР и экзогенно добавленным биотин-сАМР. Захвата сАМР достигают путем использования специфического антитела, конъюгированного с акцепторными зернами. Образованный сАМР подсчитывают и измеряют на AlphaFusion Микролуночном Анализаторе. Значения ЕС50 рассчитывают с использованием компьютерной программы Graph-Pad Prisme.

Устойчивость пептида к разрушению дипептидил аминопептидазой IV можно установить следующим анализом деградации: Аликвоты пептида инкубируют при 37°С с аликвотой очищенной дипептидил аминопептидазы IV в течение 4-22 часов в подходящем буфере при рН 7-8 (буфер не является альбумином). Ферментативные реакции останавливают добавлением трифторуксусной кислоты (TFA), а продукты разложения пептида разделяют и количественно определяют, используя ВЭЖХ (высокоэффективная жидкостная хроматография) или ЖХ-МС (жидкостная хроматография с масспектрометрическим определением) анализ. Смеси наносят на Zorbax 300SB-C18 (30 нм поры, 5 мкм частицы) колонку размером 150×2,1 мм и элюируют со скоростью 0,5 мл/мин при помощи линейного градиента ацетонитрила в 0,1% трифторуксусной кислоты (0% - 100% ацетонитрила в течение 30 мин). Пептиды и их продукты разложения можно мониторировать по их поглощению при 214 нм (пептидные связи) или 280 нм (ароматические аминокислоты) и определять количественно по интегрированным площадям их пиков. Профиль разложения можно установить, используя ЖХ-МС, где можно определить масс-спектры разделенного пика. Процентное соотношение между интактным и разложившимся соединением в данный момент времени используют для оценки пептидной DPPIV стабильности.

Пептид обозначают, как DPPIV стабилизованный, если он в 10 раз более стабилен, чем природный пептид, на основании процентного содержания интактного соединения в данный момент времени. Таким образом, DPPIV стабилизованное GLP-1 соединение, является, по меньшей мере, в 10 раз более стабильным, чем GLP-1 (7-37).

Стимулирование аденилат-циклазы

BRIN-BD11 клетки высевают в 24-луночные планшеты (3Х105/ на лунку) и культивируют в течение 48 ч с предварительным инкубированием в среде с добавкой меченого тритием аденина (2 мС1) в течение 16 ч. Затем клетки дважды промывают холодным Hanks забуференным физиологическим раствором (HBS) и добавляют тест-раствор (400 мкл; 37°С). Затем клетки обрабатывают различными концентрациями (10-10-10-5 М) GLP-1 соединений в HBS буфере в присутствии 1 мМ IBMX (фосфодиэстеразный ингибитор 3-изобутил-1-метилксантин) и 5,6 мМ глюкозы (20 мин; 37°С). После инкубирования тест-растворы удаляют и добавляют 300 мкл лизирующего раствора (5% TFA, 3% SDS (натрия додецил сульфат), 5 мМ немеченого АТР (аденозинтрифосфат) и 300 мкМ немеченого cAMP). Dowex и алюминиевая ионообменные смолы используют для разделения меченого тритием cAMP и меченого тритием аденина и АТР в клеточном лизате, как описано (Miguel JC, et al. Biochem. Pharmacol. 2003, 65:283).

Инсулиновые секреторные отклики можно измерить в панкреатических β-клетках BRIN-BD11 клетках. Клетки высевают в 24-многолуночные планшеты при плотности 1×105/ на лунку и выдерживают для присоединения в течение ночного культивирования. Немедленному исследованию высвобождения инсулина предшествует 40-мин предварительное инкубирование при 37°С в 1,0 мл бикарбонатного буфера Кребса-Рингера (115 мМ NaCl, 4,7 мМ KCl, 1,28 мМ CaCl2·2H2O, 1,2 мМ КН2РO4, 1,2 мМ MgSO4·H2O, 10 мМ NаНСО3 и 5 г/л бычьего сывороточного альбумина, рН 7,4) с добавлением 1,1 мМ глюкозы. Тест-инкубирование осуществляют при 37°С в присутствии 5,6 мМ глюкозы с диапазоном концентраций GLP-1 соединений (10-12-10-6 М). После 20 мин инкубирования буфер удаляют из каждой лунки и аликвоты хранят при -20°С для измерения инсулина.

Понижающая глюкозу и инсулин-секреторная активность у тучных диабетических (ob/ob) мышей

Биологическую активность GLP-1 соединений in vivo можно оценить у тучных диабетических (ob/ob) мышей в возрасте 12-16 недель. Животных помещают отдельно в комнате с кондиционированием воздуха при 22±2°С с 12-часовым дневным: 12-часовым ночным циклом. Животным в избытке предоставляют питьевую воду и постоянный доступ к стандартной диете содержания грызунов. Мышей подвергают голоданию в течение 18 ч и вводят внутрибрюшинно в количестве 8 мл/кг массы тела физиологический раствор (9 г/л NaCl), глюкозу отдельно (18 мМ/кг массы тела) или в комбинации с GLP-1 соединением (25 нМ/кг массы тела). Образцы крови собирают в охлажденные фторид/гепариновые пробирки для микроцентрифугирования немедленно перед инъекцией и через 15, 30 и 60 мин после инъекции, и полученную плазму хранят при -20°С.

Другие методы анализа

Уровни глюкозы в плазме можно установить с использованием Analox анализатора глюкозы (Hammersmith, London, UK), в котором применяют метод глюкозной оксидазы (Stevens JF, Clin. Chim. Acta 1971, 32:199). Уровни инсулина можно оценить при помощи радиоиммунного анализа с нагруженной декстраном угольной пылью (Flatt PR и Bailey CJ, Diabetologia 1981, 20:573). Дифференциальные площади под кривыми концентрации глюкозы и инсулина в плазме (AUC) можно рассчитать с использованием GraphPad PRISM версии 3.0 (Graphpad Software, San Diego, CA, USA).

Активность GLP-1 соединения может являться частью композиции лекарственного средства по настоящему изобретению при условии, что GLP-1 лекарственное средство способно связывать и индуцировать передачу сигнала через GLP-1 рецептор. Связывание GLP-1 рецептора и сигнальную трансдукцию можно оценить с использованием методов анализа in vitro, таких как таковые, описанные в Примерах 2, 3 и 4 из ЕР 619322 и Примерах 1, 2 и 3 из Патента США №5120712, соответственно (включено в настоящий документ посредством ссылки).

Фармакокинетические исследования можно осуществить, как описано в Примере 7 из WO 02/46227 (включено в настоящий документ посредством ссылки).

Увеличение периода полувыведения GLP-1 производных после внутривенного или подкожного введения

Увеличение периода полувыведения GLP-1 аналогов можно установить путем мониторинга их концентрации в плазме после подкожного введения здоровым свиньям. Для сравнения можно проследить за концентрацией в плазме GLP-1 (7-37) (природная активная форма GLP-1, использованная в качестве контроля) после подкожного введения.

Испытуемые соединения растворяют в носителе, подходящем для подкожного или внутривенного введения. Концентрацию отрегулируют таким образом, что объем дозировки составляет приблизительно 1 мл. Исследование выполняют на 12 карликовых свиньях Guttingen мужского пола от Ellegaard Gottingen Minipigs ApS. Проводят акклиматизацию в течение приблизительно 10 дней перед тем, как животных подвергают исследованию. В начале акклиматизационного периода возраст карликовых свиней составляет примерно 5 месяцев, и они весят в диапазоне 8-10 кг.

Исследование проводят в подходящей комнате вивария с комнатной температурой, установленной при 21-23°С, и относительной влажностью приблизительно 50%. Комнату освещают для обеспечения цикла 12 часов свет и 12 часов темнота. Свет включают с 06.00 до 18.00 ч. Животных размещают в небольших загонах с подстилкой из соломы, по шесть в каждом загоне. В течение исследования животные имеют свободный доступ к питьевой воде местного качества, но голодают от приблизительно 16.00 ч в день накануне инъекции до приблизительно 12 часов после инъекции. Животных взвешивают на момент прибытия и в дни инъекции.

Животные получают однократную внутривенную или подкожную инъекцию. Подкожную инъекцию делают на правой стороне шеи приблизительно в 5-7 см от уха и 7-9 см от середины шеи. Инъекции делают с ограничителем на игле, чтобы ввести 0,5 см иглы. Каждое испытуемое соединение вводят трем животным. Каждое животное получало дозу, равную 2 нмоль/кг массы тела. Шесть животных инъецируют в течение недели, в то время как шесть оставшихся отдыхают.

Полный профиль зависимости концентрации от времени в плазме получают от каждого животного. Образцы крови собирают согласно следующей схеме: После внутривенной инъекции: Пре-доза (0), 0,17 (10 минут), 0,5, 1, 2, 4, 6, 8, 12, 24, 48, 72, 96 и 120 часов после инъекции. После подкожной инъекции:

Пре-доза (0), 0,5, 1, 2, 4, 6, 8, 12, 24, 48, 72, 96 и 120 часов после инъекции.

В каждый момент отбора пробы отбирают 2 мл крови у каждого животного. Образцы крови отбирают из яремной вены. Образцы крови собирают в тест-пробирки, содержащие буфер для стабилизации, чтобы предотвратить ферментативное разрушение GLP-1 аналогов. Плазму немедленно переносят в Micronic-пробирки. Приблизительно 200 мкл плазмы переносят в каждую Micronic-пробирку. Плазму хранили при -20°С до проведения анализа. Образцы плазмы анализируют на содержание GLP-1 аналогов с использованием иммуноферментного анализа.

Профили зависимости концентрации от времени в плазме анализируют с помощью немногокомпонентного фармакокинетического метода анализа. В каждом случае рассчитывают следующие фармакокинетические параметры: AUC, AUC/Доза, АUС%экстраполяции, Смакc, tмакс, λz, t1/2, CL, CL/f, Vz, Vz/f и MRT (среднее время удерживания).

Композиции по изобретению можно также испытывать на свиньях породы Danish Landrace.

Свиньи (50% Duroc, 25% Yorkshire, 25% Danish Landrace, приблизительно 40 кг) голодают с начала эксперимента. Каждой свинье вводят 0,5 нмоль испытуемой композиции на кг массы тела в 50 пМ изотонического раствора (5 мМ фосфата, рН 7,4, 0,02% Tween®-20 (Merck), 45 мг/мл маннита (апирогенный, Novo Nordisk)). Образцы крови отбирают из катетера в яремной вене. 5 мл образца крови наливают в охлажденные стеклянные флаконы, содержащие 175 мкл следующего раствора: 0,18 М EDTA, 15000 К1Е(калликреин инактивирующие единицы)/мл апротинина (Novo Nordisk) и 0,30 мМ Valine-Pyrrolidide (Novo Nordisk), pH 7,4. В течение ближайших 30 мин образцы центрифугируют в течение 10 мин при 5-6000g. Температуру поддерживают при 4°С. Супернатант дозируют пипеткой в различные стеклянные флаконы и хранят при минус 20°С до использования.

Концентрацию пептидов в плазме устанавливают при помощи «сэндвич» ELISA или RIA (радиоиммуносорбентного анализа) с использованием различных моно- или поликлональных антител. Выбор антител зависит от GLP-1 аналога. Время, при котором достигается максимальное значение концентрации в плазме, варьирует в широком диапазоне в зависимости от выбранного конкретного GLP-1 аналога.

Общий протокол анализа для «сэндвич» ELISA в 96-луночном планшете для микротитрования

Буфер для покрытия (PBS): забуференный фосфатом физиологический раствор, рН 7,2

Буфер для промывания (PBS-промывка): забуференный фосфатом физиологический раствор, 0,05% об./об. Твин-20, рН 7,2

Аналитический буфер (BSA-буфер): забуференный фосфатом физиологический раствор, 10 г/л бычьего сывороточного альбумина (Пика 05477), 0,05% об./об. Твин-20, рН 7,2

Стрептавидиновый буфер: забуференный фосфатом физиологический раствор, 0,5 М NaCl, 0,05% об./об. Твин-20, рН 7,2

Стандарт: индивидуальные соединения в плазма-матриксе

A-TNP: нонсенс антитело

AMDEX: стрептавидин-пероксидаза из хрена (Amersham RPN4401V)

ТМВ-субстрат: 3,3',5,5'-тетраметилбензидин (<0,02%), перекись водорода

Анализ выполняют в соответствии с нижеследующим (объем/на лунку):

1. Нанесите покрытие при помощи 100 мкл улавливающего антитела в концентрации 5 мкг/мл в PBS-буфере, инкубируйте в течение ночи при 4°С, промывайте 5х PBS-промывкой, блокируйте при помощи последней порции промывки в течение минимум 30 минут, затем опорожните планшет.

2. 20 мкл образца +100 мкл биотинилированного детекторного антитела в концентрации 1 мкг/мл в BSA-буфере с 10 мкг/мл A-TNP, инкубируйте в течение 2 ч при комнатной температуре при встряхивании, промывайте 5х PBS-промывкой, затем опорожните планшет.

3. 100 мкл AMDEX 1: 8000 в стрептавидиновом буфере, инкубируйте в течение 45-60 минут при комнатной температуре при встряхивании, промывайте 5х PBS-промывкой, затем опорожните планшет.

4. 100 мкл ТМВ-субстрата, инкубируйте при комнатной температуре при встряхивании, остановите реакцию при помощи 100 мкл 4М Н3РO4. Считывайте поглощение при 450 нм с 620 нм в качестве сравнения. Концентрацию в образцах можно рассчитать на основании стандартных кривых.

Общий протокол анализа для RIA

DB-буфер: 80 мМ фосфатного буфера, 0,1% человеческого сывороточного альбумина, 10 мМ EDTA, 0,6 мМ тиомерсала, рН 7,5.

FAM-буфер: 40 мМ фосфатного буфера, 0,1% человеческого сывороточного альбумина, 0,6 мМ тиомерсала, рН 7,5.

Угольная пыль: 40 мМ фосфатного буфера, 0,6 мМ тиомерсала, 16,7% бычьей плазмы, 15 г/л активированного угля, рН 7,5 (смешивайте суспензию в течение минимум 1 ч перед использованием при 4°С)

Стандарт: индивидуальные соединения в плазма-матриксе

Анализ проводят в пробирках minisorp 12×75 мм (объем/на пробирку) в соответствии с нижеследующим:

Угольная пыль Н2O
DB-буфер Образец Антитело FAM изотопная метка
Сутки 1
Всего 100 мкл
NSB 330 мкл 100 мкл
Образец 300 мкл 30 мкл 100 мкл 100 мкл
Смешайте, инкубируйте в течение ночи при 4°С Сутки 2
Всего 1,5 мл
NSB 1,5 мл
Образец 1,5 мл

Смешайте и инкубируйте в течение 30 мин при 4°С. Центрифугируйте при 3000 об/мин в течение 30 мин и немедленно после этого переместите супернатант в новые пробирки, закройте крышкой и подсчитывайте на гамма-счетчике в течение 1 минуты. Концентрацию в образцах рассчитывают на основании индивидуальных стандартных кривых.

GLP-1 радио рецепторный анализ (RRA):

GLP-1 радио рецепторный анализ представляет собой радиометрический лигандсвязывающий метод анализа с использованием LEADseeker радиоизотопных частиц. Анализ построен из фрагментов мембраны, содержащих GLP-1 рецептор, немеченых GLP-1 аналогов, человеческого GLP-1, меченого при помощи 125I, и PS LEADseeker частиц, покрытых агглютинином зародышей пшеницы (WGA). «Холодный» и 125I-меченый GLP-1 будут конкурировать за связывание рецептора. Когда добавляют LEADseeker частицы, они будут связывать углеводные остатки на фрагментах мебраны через WGA-остатки. Соседство между 125I-молекулами и LEADseeker частицами вызывает испускание света частицами. LEADseekеr будет отражать исходящий свет, и он будет обратимо коррелирован с количеством GLP-1 аналога, находящегося в образце.

Реактивы и Материалы:

Предварительная подготовка плазмы животных: Плазму животных термически обрабатывают в течение 4 час при 56°С и центрифугируют при 10000 об/мин в течение 10 минут. После этого добавляют Val-Pyr (10 мкМ) и апротинин (500 KIE/мл) и хранят при -18°С до использования.

Стандарты GLP-1 аналогов: GLP-1 аналоги вносят в термически обработанную плазму, чтобы получить серию разведения в диапазоне от приблизительно 1 мкМ до 1 пМ.

GLP-1 RRA аналитический буфер: 25 мМ Na-HEPES (pH 7,5), 2,5 мМ CaCl2, 1 мМ MgCl2, 50 мМ NaCl, 0,1% овальбумина, 0,003% Твин-20, 0,005% бацитрацина, 0,05% NaN3.

Суспензия GLP-1 рецептора: фрагменты мембраны GLP-1 рецептора очищают из клеток почки детеныша хомяка (ВНК), экспрессирующих человеческий панкреатический GLP-1 рецептор. Хранят при -80°С до использования.

WGA-связанные полистирольные LEADseeker радиоизотопные частицы (RPNQ0260, Amersham): Частицы растворяют в GLP-1 RRA аналитическом буфере до концентрации 13,3 мг/мл. Затем добавляют суспензию мембраны GLP-1 рецептора и инкубируют при охлаждении (2-8°С) в течение, по меньшей мере, 1 ч перед использованием.

Материалы

125I-GLP-I (7-36) амид (Novo Nordisk A/S). Хранили при -18°С до использования.

Этиловый спирт 99,9% об (De Dansk Sprotfabrikker A/S). Хранили при -18°С до использования.

Multiscreen® Sob/inert 0,45 мкм гидрофобный PTFE (политетрафторэтилен) планшет (MSRPN0450, Millipore Corp.).

Полипропиленовые 384-луночные планшеты (каталожный №781075, Greiner Bio-One).

Оборудование:

Горизонтальный смеситель для планшета

Роторная центрифуга со стандартным планшетом для микротитрования и качающейся корзиной

UltrVap, Drydown концентратор образцов (Provair)

LEADseeker® Мультимодальная система визуализации (Amersham)

Методика:

Подготовка образца: Установите Multiscreen® Solvinert фильтрующий планшет на схожий по химической устойчивости приемный планшет (т.е. полипропиленовые планшеты) для сбора фильтрата.

Добавьте 150 мкл ледяного этилового спирта 99,9% в пустые лунки MultiScreen® Solvinert фильтрующего планшета, а затем добавьте 50 мкл калибрующего раствора или образца плазмы. Поместите защитную крышку на фильтрующий планшет и инкубируйте 15 минут при 18-22°С на горизонтальном смесителе для планшета.

Собранную установку из фильтра и приемного планшета, вместе с крышкой, поместите в стандартную роторную установку со стандартным планшетом для микротитрования и качающейся корзиной. Фильтрат собирают в пустые лунки приемного планшета при 1500 об/мин в течение 2 минут. Фильтрат высушивают досуха с использованием UltrVap при нагревании в токе N2 (40°С) в течение 15 минут. Сухой материал растворяют добавлением 100 мкл GLP-1 RRA аналитического буфера в каждую лунку. Это инкубируют в течение 5 минут на горизонтальном смесителе.

GLP-1 радио рецепторный анализ: Применяйте следующую схему пипетирования и белые полистиреновые 384-луночные планшеты:

1. 35 мкл GLP-1 RRA аналитического буфера.

2. 5 мкл повторно растворенного фильтрата.

3. 10 мкл 125I-GLP-1 (7-36) амида. Исходный раствор разбавляли в GLP-1 RRA аналитическом буфере для получения 20000 cpm (counts per minute, число импульсов в минуту)/на лунку перед использованием.

4. 15 мкл фрагментов мембраны GLP-1 рецептора (0,5 мкг/на лунку), предварительно нанесенных на WGA-полистирольные LEADseeker радиоизотопные частицы (0,2 мг/на лунку).

Планшеты накрывают и инкубируют в течение ночи при 18-22°С. Световую эмиссию из каждой лунки детектируют с использованием мультимодальной системы визуализации LEADseeker в течение 10 минут.

Стимулирование образования сАМР в клеточной линии, экспрессирующей клонированный человеческий GLP-1 рецептор.

Очищенные плазматические мембраны от стабильной трансфицированной клеточной линии, ВНК467-12А (tk-ts13), экспрессирующей человеческий GMP-1 рецептор, стимулируют при помощи GLP-1 и аналогов пептида, и эффективность выработки сАМР измеряют с использованием AlphaScreen™ сАМР набора реактивов от Perkin Elmer Life Sciences.

Получают стабильную трансфицированную клеточную линию и выбирают для скрининга клон с высокой экспрессирующей способностью. Клетки культивируют при 5% СO2 в DMEM, 5% FCS, 1% Pen/Strep и 0,5 мг/мл G418.

Клетки с приблизительно 80% конфлюэнтностью промывают 2Х при помощи PBS и собирают при помощи Versene, центрифугируют в течение 5 минут при 1000 об/мин и удаляют супернатант. Дополнительные стадии проводят при охлаждении на льду. Клеточный осадок гомогенизируют при помощи Ultrathurax в течение 20-30 сек в 10 мл Буфера 1 (20 мМ Na-HEPES, 10 мМ EDTA, pH 7,4), центрифугируют 15 мин при 20000 об/мин и клеточный осадок ресуспендируют в 10 мл Буфера 2 (20 мМ Na-HEPES, 0,1 мМ EDTA, pH 7,4). Суспензию гомогенизируют в течение 20-30 сек и центрифугируют 15 минут при 20000 об/мин. Суспендирование в Буфере 2, гомогенизацию и центрифугирование повторяют однократно, и мембраны ресуспендируют в Буфере 2, которые готовы для дальнейшего анализа или хранения при -80°С. Анализ функционального рецептора осуществляют измерением индуцированной пептидом выработки сАМР при помощи AlphaScreen Technology. Основной принцип AlphaScreen Technology заключается в конкуренции между эндогенным сАМР и экзогенно добавленным биотин-сАМР. Захвата сАМР достигают путем использования специфического антитела, конъюгированного с акцепторными зернами. Образованный сАМР подсчитывают и измеряют на AlphaFusion Микролуночном Анализаторе. Значения ЕС50 рассчитывают с использованием компьютерной программы Graph-Pad Prisme.

Пример 11. Бактериальная экспрессия генетической слитой конструкции глюкагон-подобного пептида-1 и IDom7h-8 с использованием GAS лидерной последовательности

GLP-1 (7-37), в котором глутамат в положении 9 заменили пролином ([Pro9] GLP-1 (7-37)), клонировали в виде слитой конструкции с iDOM7h-8 (P96E мутация согласно нумерации Kabat в CDR3) в рЕТ 12а вектор с GAS лидерной последовательностью (см. WO 05/093074). Замещение GLP-1 глутамата на пролин в 9 положении выполнили для того, чтобы придать GLP-1 части слитой конструкции устойчивость к разрушению путем расщепления дипептидилпептидазой IV (DPPIV) (Brian D. Green et al. (2003) Metabolic Stability, Receptor Binding, сАМР Generation, Insulin Secretion and Antihyperglycaemic Activity of Novel N-terminal Glu9-substituted Analogues of Glucagon-like-peptide-1: Biol. Chem. (384) 1543-1555). В целом, были сделаны три конструкции, одна без линкера, одна с PSS аминокислотами между [Pro9] GLP-1 (7-37) и iDOM7h-8 и одна с PSSGAP аминокислотами между [Pro9] GLP-1 (7-37) и iDOM7h-8 (показано на Фиг.16 в виде связывающей альбумин формы Dom7h-8). Экспрессия происходила в BL21 DE3 Plys S клетках при 30°С в течение 48 часов с использованием ночной экспрессирующей системы аутоиндукции ТВ readymix (Novagen) перед выделением супернатанта центрифугированием. Слитую конструкцию [Pro9] GLP-1 (7-37) iDom7h-8 очищали из супернатанта с использованием аффинной хроматографии на протеин L-агарозе. Ионообменную смолу затем промывали при помощи 10 объемов колонки PBS и связанный белок элюировали 0,1 М глицином рН 2. Затем наносили слитую конструкцию [Pro9]GLP-1(7-37)-iDom7h-8 в глициновом буфере на катионообменную колонку (1 мл S-колонка, GE healthcare), которую предварительно уравновешивали 20 мМ цитратным буфером при рН 6,2. Элюирование осуществляли 0-50% градиентом того же самого буфера с добавлением 1 М NaCl. Собирали фракции с максимальными концентрациями и размер белков определяли при помощи SDS-PAGE. Фракции с максимальными концентрациями белка ожидаемого размера объединяли и заменяли буфер на PBS. Идентичность белка подтверждали масс-спектрометрическим анализом и N-концевым секвенированием.

Пример 12. Определение активности GLP-1 для слитой конструкции [Pro9]GLP-1(7-37)-PSSGAP-iDOM7h-8

Чтобы подтвердить, что слитая конструкция [Pro9]GLP-1(7-37)-PSSGAP-iDOM7h-8 проявляла активность GLP-1, слитую конструкцию подвергли двум различным биологическим методам анализа. В первом методе анализа, клеточную линию RINm5f крысиной инсулиномы (разработана в 1980 году Gadzar et al от индуцированной рентгеновским излучением трансплантабельной инсулиномы крысы) инкубировали с различными концентрациями (от 10 пМ до 0,1 мкМ) GLP-1 и слитой конструкции [Pro9]GLP-1(7-37)-PSSGAP-iDOM7h-8 в течение 60 мин. Дополнительно, в качестве контроля добавляли однократное аналитическое количество Эксендин-4, GLP-1 аналога, устойчивого к разрушению дипептидил пептидазой IV, и однократное аналитическое количество только буфера. Хотя RINm5f клетки плохо реагируют на глюкозу при обработке питательными субстратами или не стимуляторами секреции, они проявляют секреторные отклики, схожие с бета-клетками. Следовательно, оценивали действие соединений на клеточную пролиферацию путем измерения инкорпорированных количеств 5-бром-2'-дезоксиуридина (BrdU) во время синтеза ДНК в пролиферирующих клетках с использованием Cell proliferation ELISA system (Amersham, Little Chalfont, UK), см. Фиг.17. Применяя OD450 для измерения уровней ДНК, было установлено дозозависимое увеличение в уровне ДНК одновременно с увеличением количества слитой конструкции [Pro9]GLP-1(7-37)-PSSGAP-iDOM7h-8 до концентрации слитой конструкции, равной 100 нМ. GLP-1 также проявил ожидаемый дозозависимый отклик.

Во втором методе анализа, RINm5f клетки инкубировали с различными концентрациями (от 10 пМ до 0,1 мкМ) GLP-1 и слитой конструкции [Pro9]GLP-1(7-37)-PSSGAP-iDOM7h-8 в 5,6 мМ глюкозы в течение 60 мин. Дополнительно, в качестве контроля добавляли однократное аналитическое количество Эксендин-4, GLP-1 аналога, устойчивого к разрушению DPPIV, и однократное аналитическое количество бикарбонатного буфера Кребса-Рингера (KRB). Секрецию инсулина анализировали после инкубирования в течение 60 мин при 37°С с использованием KRB буфера с добавлением GLP-1, ЗА23 или Эксендин-4. Реакционную среду собирали, центрифугировали и анализировали концентрацию инсулина в супернатанте с применением радиоиммуноферментного анализа. Концентрацию инсулина приводили в соответствие числу клеток внутри каждой лунки. Концентрацию инсулина (выраженную в нг/мл/ч) затем наносили на график относительно концентрации соединения. Установили дозозависимое увеличение высвобождения инсулина при увеличивающихся дозах слитой конструкции [Pro9]GLP-1(7-37)-PSSGAP-iDOM7h-8 до концентрации слитой конструкции, равной 10 нМ (см. Фиг.18). Эти результаты согласуются с опубликованными данными по GLP-1 отдельно.

Пример 13. Бактериальная экспрессия генетической слитой конструкции глюкагон-подобного пептида-1 и iDom7h-8 с использованием ОМР-Т лидерной последовательности

Те же самые 3 конструкции, описанные в Примере 11 (одна без линкера, одна с PSS аминокислотами между [Pro9]GLP-l (7-37) и iDOM7h-8 и одна с PSSGAP аминокислотами между [Pro9]GLP-1(1-37) и iDOM7h-8), были сделаны снова с ОМР-Т лидерной последовательностью. Для ясности, порядок элементов в конструкции представлял собой ОМР-Т лидерную последовательность, [Pro9]GLP-1, линкер (где необходимо) и iDom7h-8. Экспрессия происходила в BL21 DE3 Plys S клетках при 25°С в течение 4 часов в ТВ питательной среде, индуцированной при помощи 0,5 мМ IPTG (изопропил-тио-бета-галактозид) при оптической плотности (OD), равной 16, перед выделением клеточного осадка центрифугированием. Секретированные белки затем выделяли обработкой периплазмы. Слитые конструкции GLP-1 iDom7h-8 очищали из периплазмических фракций с использованием аффинной хроматографии на протеин L-агарозе. Ионообменную смолу затем промывали при помощи 10 объемов колонки PBS и связанный белок элюировали 0,1 М глицином рН 2. Затем наносили слитую конструкцию [Pro9]GLP-1(7-37) в глициновом буфере на катионообменную колонку (1 мл S-колонка, GE healthcare), которую предварительно уравновешивали 20 мМ цитратным буфером при рН 6,2. Элюирование осуществляли 0-50% градиентом того же самого буфера с добавлением 1 М NaCl. В этом случае, промывание колонки 20 мМ цитратным буфером при рН 6,2 (0% NaCl) привело к вымыванию (появлению в элюате) полосы ожидаемого размера, так что ее сконцентрировали с применением 5К vivaspin колонки (Vivascience).

Пример 14. Экспрессия в Pichia pastoris генетической слитой конструкции глюкагон-подобного пептида-1 и iDom7h-8

Слитую конструкцию [Pro9]GLP-l-PSS-iDOMyh-S (как представлено на Фиг.16b, но с использованием iDom7h-8) клонируют в pPICzα вектор как отдельно, так и с N-концевым ЕАЕА удлинением, и трансформируют в Pichia pastoris KM71h. Белок экспрессируют (1) с использованием индукции метиловым спиртом в течение 4 суток при 30°С и (2) с использованием индукции метиловым спиртом в течение 2 суток при 25°С. Супернатант выделяют центрифугированием и проверяют размер белка на SDS PAGE геле.

Ожидают, что слитые конструкции имеют правильный размер, по результатам SDS PAGE анализа, и являются активными в GLP-1 анализе, как описано в Примере 10 и в Примере 12.

Пример 15. Экспрессия в Е.coli глюкагон-подобного пептида-1 и iDom7h-8 в BL21 DE3 внутриклеточных тельцах

Те же самые слитые конструкции, как описано в Примере 11, клонируют в рЕТ21 экспрессирующий вектор (Novagen), который разработан для экспрессии белков в цитоплазме. Возможно включить в конструкции протеазный сайт расщепления между подлежащим удалению N-концом и НАР… от [Pro9]GLP-1(7-37). Это позволит расщепить белок, чтобы обеспечить полностью нативный N-конец. Ферменты, которые можно применять для этой цели, включают Фактор Ха, тромбин или DPPI. Белок затем экспрессируют с высоким содержанием в BL21(DE3) клетках после IPTG индукции, и он накапливается во внутриклеточных тельцах включения. Внутриклеточные тельца выделяют из BL21 клеток и солюбилизируют в гуанидин-HCl. После восстановления внутриклеточные тельца подвергают рефолдингу в буферной системе подвижного окисления-восстановления (Buchner, J., Pastan, I. Brinkmann, U. (1992). A method for increasing the yield of properly folded recombinant fusion proteins. Anal. Biochem. 205, 263-2170). После рефолдинга, белок диализируют и концентрируют на 5К vivaspin колонке (Vivascience) и очищают на S-колонке (GE healthcare).

Ожидают, что слитые конструкции имеют правильный размер, по результатам SDS PAGE анализа, и являются активными в GLP-1 анализе, как описано в Примере 10 и в Примере 12.

Пример 16. Экспрессия в клетках млекопитающих глюкагон-подобного пептида-1 и iDom7h-8

Слитую конструкцию [Pro9]GLP-1-PSS-DOMYh-S (как представлено на Фиг.16b) клонируют в PcDNA(-) вектор с использованием мышиного секреторного сигнального пептида для содействия секреции транслированного белка в культуральную среду. 1 мг ДНК получают в Е. соli с использованием щелочного лизиса (набор реактивов mega prep, qiagen, CA) и трансфицируют в 1,5 л НЕК293 клеток, культивированных в среде Игла в модификации Дульбекко (Gibco) для транзиторной экспрессии белка. Белок экспрессируют инкубированием культуры при 37°С в течение 5 суток, и супернатант (содержащий экспрессированный белок) выделяют центрифугированием. Слитую конструкцию [Pro9]GLP-l-PSS-DOM7h-S очищают из периплазмической фракции с применением аффинной хроматографии на L-агарозе. Ионообменную смолу затем промывают при помощи 10 объемов колонки PBS и связанный белок элюируют 0,1 М глицином рН 2. Затем наносят белок в глициновом буфере на катионообменную колонку (1 мл S-колонка, GE healthcare), которую предварительно уравновешивали 20 мМ цитратным буфером при рН 6,2. Элюирование осуществляют 0-50% градиентом того же самого буфера с добавлением 1 М NaCl. Белок правильного размера, по результатам SDS-PAGE геля, затем концентрируют с применением 5К vivaspin колонки (Vivascience) и заменяют буфер на PBS для биологического анализа.

Пример 17. Экспрессия в Е. соli Пептида YY, слитого с DOM7h-8

Пептид YY (3-36) (PYY: ID №167 аминокислотной последовательности и ID №168 нуклеотидной последовательности IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY) ингибирует потребление пищи у человека и имеет короткий период полувыведения из плазмы (10-30 мин). Он высвобождается в ответ на прием пищи и действует через Y2R в дугообразном ядре для физиологического регулирования потребления пищи. PYY клонируют в рЕТ GAS вектор (WO05093074), примыкающий к DOM7h-8 (см. Фиг.20а и 20b, на которых показаны пептидный С-конец и N-конец от DOM7h-8, соответственно). Экспрессия происходит в BL21 DE3 Plys S клетках при 25°С в течение 4 часов в ТВ питательной среде, индуцированной при помощи 0,5 мМ IPTG перед выделением клеточного осадка центрифугированием. Секретированные белки затем выделяют обработкой периплазмы. Слитую конструкцию PYY Dom7h-8 очищают из периплазмических фракций с использованием аффинной хроматографии на протеин L-агарозе. Ионообменную смолу затем промывают при помощи 10 объемов колонки PBS и связанный белок элюируют 0,1 М глицином рН 2 и очищают дополнительно ионным обменом. В очищенном белке затем диализом заменяют буфер на PBS, белок концентрируют в 5К vivaspin колонке (Vivascience) и подвергают биологическому анализу для измерения стимуляции высвобождения сАМР, как описано (Goumain et al. (2001) The Peptide YY-Prefemng Receptor Mediating Inhibition of Small Intestinal Secretion Is a Peripheral У 2 Receptor: Pharmacological Evidence and Molecular Cloning: Molecular pharmacology: 60 124-134). Вкратце, изолированные клетки кишечной слизи в концентрации 200 мкг белка/мл инкубируют при непрерывном перемешивании в течение 45 мин при 15°С в 0,5 мл забуференного фосфатом физиологического раствора, рН 7,0, содержащего 1,4% (мас./об.) бычьего сывороточного альбумина, 0,1% бацитрацина и 0,2 мМ 3-изобутил-1-метилксантина (IBMX), как описано (Servin et al. (1989): Peptide-YY and neuropeptide-Y inhibit vasoactive intestinal peptide-stimulated adenosine 3',5'-monophosphate production in rat small intestine: structural requirements of peptides for interacting with PYY-preferring receptors. Endocrinology 124: 692-700). PYY отдельно или слитую конструкцию PYY-Dom7h-8 добавляют вместе с высокоактивным физиологическим стимулятором выработки сАМР в энтероцитах (например, VIP (вазоактивный пептид кишечника)). Реакцию инициируют добавлением клеток и останавливают через 45 мин добавлением 50 мкл ИМ перхлорной кислоты. После центрифугирования в течение 10 мин при 4000 g сАМР, находящийся в супернатанте, обрабатывают янтарной кислотой с получением сукцинила, и его концентрацию измеряют радиоиммуноферментным анализом, как описано (Laburthe et al., (1982) Alpha-adrenergic inhibition ofcyclic AMP accumulation in epithelial cells isolated fromrat small intestine. Biochim Biophys Acta 721: 101 -108).

Предполагают, что слитая конструкция имеет ожидаемый размер и проявляет PYY активность, эквивалентную неслитому контролю.

Пример 18. Экспрессия в E.coli Dom7h-8 Пептид YY, GLP-1, слитой конструкции

Слитую конструкцию [Pro9]GLP-1(7-37)-DOM7h-8-PYY (см. Фиг.19с) клонируют в рЕТ GAS вектор и затем экспрессируют, как описано для Dom7h-8 PYY, представленной в Примере 17. После очистки слитую конструкцию анализируют на биологическую активность PYY, а также GLP-1, соблюдая протоколы анализа, описанные в Примерах 17 и в Примере 12 соответственно.

Предполагают, что слитые конструкции имеют ожидаемый размер и проявляют PYY и GLP-1 активность, эквивалентную неслитому контролю.

В следующих ниже дополнительных примерах использованы следующие обозначения:

DAT 0115, 0116 и 0117 представляют собой слияния эксендина с доменным антителом, которое связывает сывороточный альбумин (DAT 0115 содержит линкер (g4s)3, a DAT 0117 содержит спиральный линкер, и 0116 не имеет линкера);

DAT 0120 представляет собой GLP-1 A8G (мутантный), слияние через спиральный линкер с доменным антителом, которое связывает сывороточный альбумин.

Пример 19: Экспрессия генетических слияний GLP-1 (A8G) или Эксендина-4 и DOM7h-14 AlbudAb:

Либо эксендин-4, либо GLP-1 (7-37), где аланин в положении 8 заменен глицином ([Gly8] GLP-1), клонировали в виде слияния с DOM7h-14 (доменным антителом (dAb), которое связывает сывороточный альбумин (AlbudAb), с аминокислотной последовательностью, показанной ниже) в векторе рТТ-5 (который может быть получен от фирмы CNRC, Канада). В каждом случае GLP-1 или Эксендин-4 находился на 5'-конце конструкции, а dAb на 3'-конце. Всего было получено 7 конструкций (DAT 0114, DAT 0115, DAT 0116, DAT 0117, DAT 0118, DAT 0119, DAT 0120). Линкер либо отсутствовал, либо линкер представлял собой gly-ser (G4S), либо спиральный линкер (Arai, R., H.Ueda, et al. (2001). "Design of the linkers which effectively separate domains of a bifunctional fusion protein." Protein Eng 14(8): 529-32.456), либо линкер состоял из второй группировки GLP-1 между GLP-1 или Эксендином-4 и dAb. Линкеры были включены в качестве спейсеров, чтобы пространственно отделить GLP-1 или эксендин-4 от dAb для предотвращения стерического препятствия связыванию между GLP-1 или Эксендином-4 и рецептором GLP-1.

ДНК, свободную от эндотоксинов, получали из E.coli, используя щелочной лизис (используя набор Giga для плазмид, свободных от эндотоксинов, который может быть получен от Qiagen CA), и использовали для трансфекции клеток НЕК293Е (которые могут быть получены от CNRC, Канада). Трансфекцию проводили в 250 мл/колбу клеток НЕК293Е при 1,75×106 клеток/мл, используя 333 мкл реагента 293fectin (Invitrogen) и 250 мкг ДНК на колбу, и экспрессию проводили при 30°С в течение 5 суток. Надосадочную жидкость собирали центрифугированием и очистку осуществляли путем аффинной очистки на белке L. Всю партию белка связывали со смолой, наносили на колонку и промывали PBS в количестве 10 объемов колонки. Белок элюировали 50 мл 0,1 М глицина с рН 2 и нейтрализовали, используя Трис с рН 8. Белок ожидаемого размера идентифицировали на гель-электрофорезе в SDS-PAGE; размеры представлены ниже в Таблице 9.

Таблица 9
Молекулярные массы конструкций DAT 0114, DAT 0115, DAT 0116, DAT 0117, DAT 0118, DAT 0119, DAT 0120
Слитый белок Ожидаемая MW
DAT 0114 18256
DAT 0115 16896
DAT 0116 15950
DAT 0117 19798
DAT 0118 15936
DAT 0119 15318
DAT 0120 18895

Пример 20: Демонстрация того, что слитые конструкции GLP-1 и эксендин-4 AlbudAb связывают сывороточный альбумин.

Слитые конструкции GLP-1 и эксендин-4 AlbudAb анализировали с помощью поверхностного плазменного резонанса (Biacore AB, который может быть получен от GE Healthcare) для получения информации по сродству. Анализ проводили, используя чип СМ5 Biacore (карбоксиметилированный дексгран в качестве матрицы), который был покрыт сывороточным альбумином. Примерно 1000 резонансных единиц (RUs) каждого тестируемого сывороточного альбумина (сывороточный альбумин человека, крысы и мыши) иммобилизовали в ацетатном буфере с рН 5,5. Проточную кювету 1 Biacore AB не покрывали, блокировали отрицательным контролем, проточную кювету 2 покрывали человеческим сывороточным альбумином (HSA) (815 RUs), проточную кювету 3 покрывали крысиным сывороточным альбумином (RSA) (826 RUs), и проточную кювету 4 покрывали мышиным сывороточным альбумином (MSA) (938 RUs). Каждую тестируемую слитую молекулу экспрессировали в тканевой культуре млекопитающих, как описано в приведенном выше примере.

Готовили диапазон концентраций слитой молекулы (в диапазоне от 16 нМ до 2 мкМ) путем разведения в буфере BIACORE HBS-EP (0,01 М HEPES, рН 7,4, 0,15 М NaCl, 3 мМ ЭДТА, 0,005% поверхностного вещества Р20) и пропускали через чип BIACORE.

Сродство (KD) вычисляли на основании следов BIACORE путем аппроксимации кривых скорости ассоциации и скорости диссоциации к следам, образуемым концентрациями dAb в области KD. Значения сродства (KD) суммированы в приведенной ниже Таблице 10.

Таблица 10
Связывание GLP-1 и эксендин-4 AlbudAb с человеческим, крысиным и мышиным сывороточными альбуминами
Слитая конструкция GLP-1 (7-37) A8G, спиральный линкер, DOM7h-14 Слитая конструкция 2xGLP-1 (7-37) A8G DOM7h-14
HSA 110 нМ 150 нМ
RSA 800 нМ 700 нМ
MSA 110 нМ 130 нМ

Приведенные выше результаты демонстрируют, что слитые молекулы сохраняют способность к связыванию со всеми типами сывороточного альбумина, и это указывает на то, что, вероятно, они обладают увеличенным периодом полувыведения in vivo.

Пример 21: Слитые конструкции GLP-1 и эксендин-4 AlbudAb активны в анализе связывания рецептора GLP-1 (GLP-1 R ВА):

Слитые конструкции подвергали обмену буфера в 100 мМ NaVI, 20 мМ цитрат, рН 6,2. В это время клетки СНО 6CRE GLP1R (клетки СНО К1 (которые могут быть получены из Американской коллекции типовых клеточных культур. АТСС), стабильно трансфицированные элементом ответа 6 цАМФ, направляющим репортерный ген люциферазы, а также человеческим рецептором GLP-1), высевали при 2×105 клеток/мл в суспензионной среде. Суспензионную культуру поддерживали в течение 24 часов. Затем клетки разбавляли в 15 мМ буфере HEPES (полученном от Sigma), содержащем 2 мМ L-глутамин (2,5×105 клеток/мл), и распределяли в 384-луночные планшеты, содержащие 10 мкл/лунку анализируемого соединения. После добавления контроля для анализа планшеты возвращали в инкубатор на 3 ч при 37°С и 5% СO2. После инкубации субстрат для люциферазы steady-glo (который может быть получен от фирмы Promega) добавляли в лунки, как описано в наборе, и планшеты герметично закрывали самоклеящимися крышками для планшетов (Weber Marking Systems Inc. Cat. No. 607780). Планшеты помещали в считывающее устройство (Viewlux, Perkin Elmer) и предварительно инкубировали в течение 5 минут, после чего считывали флуоресценцию и наносили результаты на график. Соединение анализировали в диапазоне концентраций в присутствии и в отсутствие 10 мкМ альбумина, что дало возможность аппроксимации кривой доза-ответ с альбумином и без альбумина. Вычисляли значения ECso и суммировали в приведенной ниже Таблице 11.

Таблица 11
Активность слитых конструкции GLP-1 и Эксендин-4 AlbudAb в анализе связывания рецептора GLP-1 (GLP-1 R ВА)
GLP-1R BA ЕС50(пМ) n=3 GLP-1 РВА(10 мкМ альбумин) EC50 (рМ) n=2
Слитая конструкция Эксендин 4-(G4S)3-DOM7h-14 8,9 35
Слитая конструкция Эксендин 4-DOM7h-14 12 72
Слитая конструкция Эксендин 4 - спиральный линкер - DOM7h-14 4,3 15
Слитая конструкция GLP-1 A8G - спиральный линкер - DOM7h-14 17 130
GLP-1 7-36 21 19
Эксендин-4 1,0 0,82

Приведенные выше результаты демонстрируют, что все протестированные слитые молекулы сохраняют эффективность связывания рецептора GLP-1. Эти результаты также демонстрируют, что данная эффективность сохраняется в присутствии сывороточного альбумина. Следовательно, эти слитые молекулы, вероятно, сохраняют способность связывать рецептор GLP-1 in vivo.

Пример 22: Демонстрация продолжительности действия DAT 0115 в мышиной модели db/db диабета типа II:

Цель данного исследования состояла в определении продолжительности действия DAT 0115 на пероральную толерантность к глюкозе у мышей db/db. Животных сортировали по снижению уровней глюкозы за трое суток до начала эксперимента, а затем делили на партии. Затем по одному животному в каждой партии назначали в каждую из 26 групп исследования. Это гарантировало сходный средний начальный уровень глюкозы в каждой из групп исследования.

DAT 0115 (продуцированный в клетках НЕК293 и очищенный, как описано выше) вводили подкожно при 1 мг/кг, 0,3 мг/кг или 0,1 мг/кг за 5 ч, 24 ч, 48 ч, 72 ч, 96 ч или 120 ч до пероральной нагрузки глюкозой. (Не все дозы вводили в каждый момент времени, подробности см. ниже в таблице). DAT 0115 значительно снижал AUC глюкозы в течение 2-часового периода времени перорального теста на толерантность к глюкозе (OGTT) по сравнению с мышами db/db, обработанными носителем, в моменты времени вне и включая 24 ч для доз 0,1 мг/кг и 0,3 мг/кг и вне и включая момент времени 72 ч для дозы 1 мг/кг. Эксендин-4, введенный в качестве положительного контроля при 42 мкг/кг, также значительно снижал AUC глюкозы после OGTT при введении за 5 ч до перорального болюса глюкозы. В приведенной ниже таблице 12 показан процент снижения AUC для каждой из групп исследования DAT 0115 по сравнению с носителем. Звездочкой указан Р<0,05 для DAT 0115 в сравнении с носителем с использованием поправки на частоту ложных обнаружений.

Таблица 12
Демонстрация процента снижения AUC для каждой из групп исследования DAT 0115 по сравнению с носителем. (Звездочкой указан Р<0,05 для DAT 0115 в сравнении с носителем с использованием поправки на частоту ложных обнаружений)
Время OGTT (часы относительно дозирования) 0,1 мг/кг DAT 0115 0,3 мг/кг DAT 0115 1 мг/кг DAT 0115
+5 60%* Не делали 76%*
+24 36%* 59%* 50%*
+48 28% 26% 37%*
+72 16% 26% 41%*
+96 -12% Не делали 12%

Пример 23: Демонстрация эффективности DAT 0115 в мышиной модели ожирения, вызванного питанием (DIO):

Цель данного исследования состояла в использовании установленной модели питания мышей (мышей с ожирением, вызванным питанием), чтобы определить, влияет ли введение DAT 0115 на потребление пищи и, как результат, на массу тела. Это может иметь предсказательное значение в отношении людей. Самцов мышей C57BI/6 (приобретенных у Taconic) откармливали на 60% ккал диете с высоким содержанием жиров в течение 12 недель, а затем переносили в собственный виварий. После прибытия мышей помещали в индивидуальные клетки на подстилки Alpha Dry в помещение с регулируемой температурой и влажностью (70-72°F (21,11-22,22°С) влажность = 48-50%, световой цикл 5 АМ/5 РМ). Диету меняли на диету с высоким содержанием жиров 45%, и животных акклиматизировали в течение 18 суток. Перед введением тестируемого соединения мышам инъецировали подкожно физиологический раствор в течение трех суток и проводили мониторинг потребления пищи. Мышей делили на партии и группы, так чтобы масса тела и потребление пищи не отличались между группами и внутри группы. На сутки исследования группам из 8 мышей вводили подкожно дозы, как описано ниже, используя объем инъекции 5 мл/кг: Трем группам вводили дозы DAT 0115 (низкая, средняя и высокая доза), одной группе - дозы молекулы отрицательного контроля (DOM7h-14 AlbudAb, но без конъюгата Эксендин-4) и одной группе - дозы положительного контроля Эксендина-4.

Таблица 13
Протокол для установления эффективности DAT 0115 в мышиной модели ожирения, вызванного питанием (DIO)
Группа Вводимое соединение Уровень дозы
1 Отрицательный контроль: DOM7h-14 в 100 мМ NaCl, 20 мМ цитрат/цитрат натрия рН 6,2 1 мг/кг
2 Эксендин-4 0,01 мг/кг
3 DAT 0115 в 100 мМ NaCl, 20 мМ цитрат/цитрат натрия рН 6,2 0,01 мг/кг
4 DAT 0115 в 100 мМ NaCl, 20 мМ цитрат/цитрат натрия рН 6,2 0,1 мг/кг
5 DAT 0115 в 100 мМ NaCl, 20 мМ цитрат/цитрат натрия рН 6,2 1 мг/кг

Суточное потребление пищи и массу тела измеряли ежесуточно в течение 10 суток. Результаты с DAT 0115 показали дозозависимое снижение массы тела и потребления пищи по сравнению с контролем DOM7h-14. Поэтому сделали вывод, что данные этого исследования на мышах подтверждают гипотезу, что DAT 0115 должен быть хорошим клиническим кандидатом.

В то время как данное изобретение было частично раскрыто и описано вместе со ссылками на его предпочтительные варианты воплощения, специалистам в данной области понятно, что в данном изобретении можно сделать различные изменения в форме и деталях, не выходя за пределы объема изобретения, охватываемого прилагаемой формулой изобретения.

1. Конъюгат лекарственного средства или слитая конструкция, имеющие связывающую специфичность в отношении сывороточного альбумина и содержащие пептидное лекарственное средство и фрагмент антитела, который связывает антиген, где антиген действует, чтобы увеличить период полувыведения конъюгата лекарственного средства или слитой конструкции in vivo, и антиген представляет собой сывороточный альбумин, и где пептидное лекарственное средство выбрано из: глюкагон-подобного пептида-1 (GLP-1) или его аналога или производного; пептида Эксендина-3 или его аналога или производного; пептида Эксендина-4 или его аналога или производного; и пептида YY (PYY) или его аналога или производного.

2. Конъюгат лекарственного средства или слитая конструкция по п.1, где пептидное лекарственное средство представляет собой лекарственный слитый белок, содержащий указанное лекарственное средство, связанное с фрагментом антитела.

3. Конъюгат лекарственного средства или слитая конструкция по п.2, где пептидное лекарственное средство слито с фрагментом антитела через пептидную линкерную группировку.

4. Конъюгат лекарственного средства или слитая конструкция по любому из пп.1-3, где фрагмент антитела представляет собой единичный вариабельный домен иммуноглобулина (dAb).

5. Конъюгат лекарственного средства или слитая конструкция по п.4, где указанный единичный вариабельный домен иммуноглобулина выбран из VH, VL или VHH домена.

6. Конъюгат лекарственного средства или слитая конструкция по п.5, где пептид GLP-1 содержит аминокислотную последовательность, которая гомологична последовательности, выбранной из группы, состоящей из SEQ ID NO: 157 или 159.

7. Конъюгат лекарственного средства или слитая конструкция по любому из пп.5 или 6, где пептид GLP-1 содержит Gly10, Thr12, Asp14, Phe27 и Ilе2.

8. Конъюгат лекарственного средства или слитая конструкция по п.5, где аналог GLP-1 отличается от SEQ ID NO: 157 или SEQ ID NO: 159 не более чем на 6 аминокислот.

9. Конъюгат лекарственного средства или слитая конструкция по п.1, содержащие единичный вариабельный домен, специфический в отношении сывороточного альбумина (SA), который имеет константу диссоциации (Kd), равную 1 нМ-500 мкМ для SA, как установлено поверхностным плазменным резонансом.

10. Конъюгат лекарственного средства или слитая конструкция по п.9, где SA-специфический домен связывает SA в стандартном лиганд-связывающем анализе с IC50, равной 1 нМ - 500 мкМ.

11. Конъюгат лекарственного средства или слитая конструкция по п.1, имеющие t1/2 альфа между 1 и 6 часами.

12. Конъюгат лекарственного средства или слитая конструкция по п.1, имеющие t1/2 бета между 12 и 60 ч.

13. Конъюгат лекарственного средства или слитая конструкция по п.1, где GLP представляет собой GLP-1 (7-37), GLP-1 (7-36)амид, [Ser8]GLP-1(7-36)амид, [Рrо9]GLP-1(7-36), [Pro9]GLP-1(7-37).

14. Конъюгат лекарственного средства или слитая конструкция по п.13, где GLP имеет С-концевой пептид, выбранный из перечня, состоящего из PSS, PSSGAP или PSSGAPPPS.

15. Конъюгат лекарственного средства или слитая конструкция по п.1, содержащие единичную белковую группировку.

16. Рекомбинантная нуклеиновая кислота, кодирующая конъюгат лекарственного средства или слитую конструкцию по любому из пп.1-15.

17. Экспрессирующий вектор, кодирующий конъюгат лекарственного средства или слитую конструкцию, имеющие связывающую специфичность в отношении сывороточного альбумина, и содержащий рекомбинантную нуклеиновую кислоту по п.16.

18. Клетка-хозяин, содержащая рекомбинантную нуклеиновую кислоту по п.16, продуцирующая конъюгат лекарственного средства или слитую конструкцию, имеющие связывающую специфичность в отношении сывороточного альбумина.

19. Способ получения слитой конструкции лекарственного средства, включающий поддержание клетки-хозяина по п.18 в условиях, пригодных для экспрессии указанной рекомбинантной нуклеиновой кислоты, посредством чего получают слитую конструкцию лекарственного средства.

20. Фармацевтическая композиция, содержащая конъюгат лекарственного средства или слитую конструкцию, имеющие связывающую специфичность в отношении сывороточного альбумина, по любому из пп.1-15, присутствующие в терапевтически эффективном количестве, и физиологически приемлемый носитель.

21. Применение конъюгата лекарственного средства или слитой конструкции, имеющих связывающую специфичность в отношении сывороточного альбумина, по любому из пп.1-15 для лечения и/или предупреждения состояния у пациента, где состояние выбрано из группы, состоящей из гипергликемии, диабета 2 типа, нарушенной толерантности к глюкозе, диабета 1 типа, ожирения, гипертензии, синдрома X, дислипидемии, когнитивных расстройств, атеросклероза, инфаркта миокарда, ишемической болезни сердца и других сердечно-сосудистых расстройств, удара, воспалительного синдрома кишечника, диспепсии и язв желудка.

22. Применение конъюгата лекарственного средства или слитой конструкции, имеющих связывающую специфичность в отношении сывороточного альбумина, по любому из пп.1-15 для замедления или предотвращения развития заболевания диабета 2 типа у пациента.

23. Применение конъюгата лекарственного средства или слитой конструкции, имеющих связывающую специфичность в отношении сывороточного альбумина, по любому из пп.1-15 для уменьшения потребления пищи пациентом, уменьшения β-клеточного апоптоза, повышения β-клеточной функции и β-клеточной массы и/или восстановления чувствительности к глюкозе β-клеток у пациента.

24. Применение конъюгата лекарственного средства или слитой конструкции, имеющих связывающую специфичность в отношении сывороточного альбумина, по любому из пп.1-15 для лечения и/или предотвращения гипергликемии, диабета 1 типа, диабета 2 типа или дефицита β-клеток у пациента.

25. Конъюгат лекарственного средства или слитая конструкция, имеющие связывающую специфичность в отношении сывороточного альбумина, по п.1 для лечения и/или предотвращения диабета.

26. Конъюгат лекарственного средства или слитая конструкция, имеющие связывающую специфичность в отношении сывороточного альбумина, по п.1 для лечения и/или предотвращения ожирения.

27. Конъюгат лекарственного средства или слитая конструкция, имеющие связывающую специфичность в отношении сывороточного альбумина, по п.1 для уменьшения потребления пищи пациентом.



 

Похожие патенты:

Изобретение относится к биотехнологии и представляет собой антитела к OX40L, которые содержат Fc-фрагмент, полученный из организма человека, и не связываются с фактором комплемента C1q.

Изобретение относится к иммунологии и биотехнологии. .

Изобретение относится к биотехнологии и иммунологии. .

Изобретение относится к биотехнологии и представляет собой антитело, которое связывается с OX40L, и варианты этого антитела, которые содержат определенные Fc-фрагменты, полученные из организма человека, и не связываются с фактором комплемента C1q.

Изобретение относится к ауристатиновым пептидам, включая MeVal-Val-Dil-Dap-норэфедрин (ММАЕ) и MeVal-Val-Dil-Dap-Phe (MMAF), и эти пептиды были присоединены к лигандам посредством различных линкеров, включая малеимидокапроил-val-cit-PAB

Изобретение относится к композициям и способам для лечения или профилактики заболеваний, нарушений или физической травмы, в которых гуманизированные антитела против сфинголипида вводят пациенту, чтобы связать нежелательные токсические сфинголипиды или их метаболиты
Наверх