Высушенные восстановленные везикулы для фармацевтического применения

Изобретение относится к фармакологии и представляет собой высушенную фармацевтическую композицию, включающую лиофилизированное активное средство, включающее везикулы, включающие: а) по меньшей мере, один липид, b) по меньшей мере, одно активное средство, которое является белком или его активным фрагментом, с) средство, способствующее слиянию, где средство, способствующее слиянию, является щелочной аминокислотой, выбранной из аргинина, гистидина, лизина или цитруллина, и d) не включающая средство, стабилизирующее мембрану, где регидратация высушенной фармацевтической композиции водным раствором приводит к образованию многослойных липосом, имеющих средний диаметр липосомы, равный более чем 1 мкм, эти липосомы инкапсулируют активное средство. Изобретение обеспечивает высокую эффективность и стабильность активного средства в липосомах, обладающих диаметром более 1 мкм. 6 н. и 22 з.п. ф-лы, 2 табл., 3 ил.

 

Настоящее изобретение имеет отношение к композициям высушенных восстановленных везикул (DRV) и к их лекарственным формам на водной основе, которые содержат один или несколько терапевтических средств (например, гидрофильный белок). В особенности, оно имеет отношение к везикулам DRV, включающим, по меньшей, один липид и средство, стимулирующее слияние, которые после восстановления образуют большие многослойные липосомы, инкапсулирующие в водной фазе активное средство.

Известно, что липосомы, применяемые в качестве переносчиков биологических и терапевтических активных соединений, способствуют доставке этих соединений в организм. Липосомы обычно включают замкнутую липидную каплю, которая имеет внутреннее пространство, в котором соединение обычно содержится в водной среде. В некоторых воплощениях соединение химически связано с липидным компонентом или просто содержится внутри водного внутреннего компартмента липосомы. Существуют различные типы липосом: мультивезикулярные липосомы (MVL) с множеством неконцентрических внутренних камер с водой внутри каждой липосомной частицы; многослойные везикулы (MLV), имеющие серии практически сферических оболочек, сформированных из липидных бислоев, перемежающихся с водными слоями, и имеющие диаметр, варьирующий вплоть до 5 мкм или крупнее; крупные однослойные везикулы (LUV), диметр которых варьирует от 600 нм до 1 мкм или крупнее, имеющие липидный бислой, окружающий большую, неструктурированную водную фазу; и маленькие однослойные везикулы (SUV), структура которых похожа на структуру везикул LUV, за исключением того, что их диаметр меньше примерно 0,2 мкм.

В этой области техники хорошо известны разнообразные способы получения липосом, некоторые из них описаны в издании «Liposome Technology», 2-ое издание, в G.Gregoriadis, CRC Press Inc., Boca Raton (1993). Основные трудности в технологии получения липосом заключаются в том, каким способом обеспечить высокий уровень нагрузки липосом активным средством и как сделать эту нагрузку стабильной при использовании и хранении. Другая трудность заключается в том, как подобрать скорость освобождения активного средства для специфических целей липосомной композиции. Хотя инкапсулирование биологического материала в липосомы потенциально важно для доставки лекарственных средств у людей, в промышленных масштабах получение материала, заключенного внутри везикул, часто бывает затруднительным.

Для того чтобы избежать нежелательных побочных эффектов, таких как эмболия, описанная для крупных липосом, большинство фармацевтических способов парентерального применения сфокусированы на маленьких липосомах. К тому же, вероятно, не так затруднительно производить стабильный продукт, применяя маленькие липосомы.

Существует несколько известных способов получения материала, заключенного в MLV, как в небольших масштабах, так и в промышленных масштабах (Rao, "Preparation of Liposomes on the Industrial Scale. Problems And Perspectives," in Liposome Technology 2nd Edition in G.Gregoriadis, CRC Press Inc., Boca Raton, pp 49-65 (1993)). В большинстве случаев, к тонкой липидной пленке, образовавшейся на стенках контейнера после удаления органического растворителя, добавляют водный раствор вещества, которое предполагают заключить внутрь липосом, и контейнер взбалтывают. В результате происходит инкапсулирование активного средства внутрь MLV. Основной недостаток такого способа заключается в неравномерности процесса инкапсулирования, и часто возникающего низкого или невоспроизводимого инкапсулирования биологического средства внутрь липосом в дополнение к деградации биологического средства и нестабильности суспензии липосом при хранении.

С помощью способа, описанного в патенте ЕР 0678017, многослойные везикулы (FATMLV) получают с помощью замораживания-оттаивания. Способ получения везикул FATMLV требует, чтобы замораживание и оттаивание проводили в присутствии того вещества, которое предполагается инкапсулировать. Однако если подвергать чувствительные вещества, такие как белки, столь грубой физической процедуре, то это приведет к инактивации или деградации материала. К тому же, многократные циклы замораживания и оттаивания не подходят для крупномасштабного производства и требуют высоких затрат для технического воплощения.

Известно, что липосомы и их содержимое могут быть относительно нестабильны в водной дисперсии. Следовательно, в нескольких способах получения усилия были сосредоточены на продлении короткого срока хранения липосомальной композиции с помощью дегидратации.

Усовершенствование пассивного инкапсулирования активного средства липосомами и хранения липосом, включающих активное средство, было достигнуто при применении способа дегидратации-регидратации (патенты ЕР 0485143, WO 90/03795, ЕР 0678017 и ссылки в этих патентах), в котором заранее полученные липосомы добавляют к водному раствору, содержащему активное средство, или их смешивают с лиофилизированным белком, затем следует дегидратация смеси и последующая регидратация смеси в водной среде. Когда раствор высушивают до состояния высоковязкой липидной смеси, отдельные липосомы сливаются с образованием везикул MLV, которые инкапсулируют активное средство между ламеллами. В процессе регидратации, образуются липидные везикулы, в которые заключено вещество. Этот способ приводит к довольно низкой эффективности включения в зависимости от лекарственного средства, которое намереваются инкапсулировать, из-за нестабильности липосом, из-за утечки активного средства или физической инактивации или деградации инкапсулированного вещества.

Известно, что добавление сахара, в качестве консерванта (например, в качестве наполнителя), перед дегидратацией и образованием сухого липидного порошка может предохранить липосомы, полученные с помощью лиофилизации. Наполнители описаны в патентах ЕР 0678017, WO 90/03795, WO 97/42936, WO 92/02208, ЕР 190315 и в издании Liposomes 2nd edition, A Practical Approach, edited by Vladimir P.Torchilin and Volkmar Weissig, Oxford University Press (2002). Их применяют для защиты везикулы от повреждения и утечки активного средства в процессе лиофилизации и для того, чтобы избежать слияния маленьких однослойных везикул до крупных многослойных структур.

В патенте WO 97/42936 описан способ получения лиофилизированных везикул MLV, в которые заключена композиция амфифильного лекарственного средства в дополнение к сорбитолу, примененному в качестве средства, стабилизирующего мембрану.

В патенте WO 90/03795 описано применение криопротекторов, таких как сахара (например, сахароза, маннитол, лактоза, трегалоза, мальтоза), и, по меньшей мере, одного белка (например, альбумина, желатина или казеина) при проведении высушивания липосомальных препаратов для защиты дегидратируемого продукта от повреждения в процессе лиофилизации и последующего восстановления, для сохранения целостности бислоя липосом (например, наблюдали незначительное слияние или агрегацию или не наблюдали их совсем) и для того, чтобы избежать утечки липосом. Если не добавлять каких-либо лиопротекторов, то липосомы после высушивания и регидратации полностью сжимаются и образуют везикулы MLV, содержимое которых в значительной степени потеряно и крупный размер которых не допускает правильного распределения при системных применениях.

Ozer et al. описал применение криопротекторов, таких как полиспирты и сахариды и белки или аминокислоты, для сохранения структуры и целостности мембранных бислоев и для предотвращения слияния везикул и агрегирования при дегидратации и замораживании (Ozer, Y. et al. (1988) Influence of Freezing and Freeze-drying on the Stability of Liposomes Dispersed in Aqeous Media. Acta Pharm. Technol. 34: 129-139).

Патент ЕР 0560138 раскрывает высушенные реконструированные липосомы для включения липофильных веществ, таких как нифедипин, и способы получения этих липосом, включающих фосфолипид, антиоксиданты, криопротектор и стабилизатор рН. Однако раскрытые способы наносят вред активным соединениям, таким как белки. Криопротекторы, такие как редуцирующие сахара (например, глюкоза), модифицируют белки с помощью химической реакции и приводят к образованию небольших везикул, например, со средним диаметром, равным от 40 до 200 нм.

В патенте США US 5,290,563 раскрыт способ инкапсулирования гетерогенных соединений, таких как белковые аллергены и/или экстракты аллергенов, внутрь липосом, включающих, по меньшей мере, один ионный липид, без добавления криопротекторов. Присутствие таких гетерогенных веществ стабилизирует липосомы.

Согласно Kim et al. липосомы следует получать с помощью выпаривания органических растворителей из хлороформ-эфирных сферул, суспендированных в воде (Kim, S. et al. (1983) Preparation of multivesicular liposomes. Biochim. Biophys. Acta 728: 339-348).

Согласно Cruz et al. и ссылкам, приведенным в этой работе, липосомы следует получать как системы-переносчики для белков. Раскрытые способы имеют такие же недостатки, как описаны выше, например, применение органических растворителей, приводит к низкой эффективности инкапсулирования или не может быть применено для крупномасштабного производства (Cruz, М. Е. et al. (1989) Liposomes as carrier systems for proteins: factors affecting protein encapsulation. Liposomes in the Therapy of Infectious Diseases and Cancer 417-426).

Патент WO 2007/067784, в целом, имеет отношение к липосомальным фармацевтическим композициям, которые содержат один или несколько гидрофобных терапевтических средств (например, лекарственных средств). Однако патент WO 2007/067784 не обращен к проблеме липосом, которые инкапсулируют белки. Фактически его идея заключается в применении криопротекторов, которые стабилизируют липидные мембраны и/или предотвращают образование везикул MLV после регидратации.

Следовательно, цель настоящего изобретения заключается в обеспечении способа получения инкапсулирующих белки липосом в сухой форме, которые могут быть регидратированы и которые можно применять для крупномасштабного производства.

Еще одна цель настоящего изобретения заключается в обеспечении препаратов липосом, которые могут быть регидратированы, которые, будучи дегидратированы, могут храниться в течение продолжительного периода времени, и которые после восстановления превратятся в дисперсию многослойных везикул с активным веществом, инкапсулированным в водную фазу липосом.

Еще одна цель настоящего изобретения заключается в том, чтобы избежать необходимости в нескольких стадиях замораживания и оттаивания при производстве везикул MLV, инкапсулирующих активное средство, для того, чтобы предотвратить разрушение или инактивацию активного средства.

Еще одна цель настоящего изобретения заключается в обеспечении способа дегидратации липосом и способа их хранения в виде высушенной в присутствии активного средства липидной лекарственной формы, эта высушенная липидная лекарственная форма затем может быть регидратирована с помощью добавления водного раствора для формирования многослойных липосом с высокой скоростью инкапсулирования активного средства, в результате чего восстановление высушенного продукта осуществляют удобным способом.

Еще одна цель настоящего изобретения заключается в обеспечении способа крупномасштабного производства высушенных восстановленных везикул MLV, который представляет собой простой, реально осуществимый и экономичный способ.

Еще одна цель настоящего изобретения заключается в обеспечении высушенных восстановленных везикул размером более чем 1 мкм для лечения заболеваний, например, заболеваний костей и/или суставов, таких как костно-хрящевые нарушения и остеоартрит.

Еще одна цель настоящего изобретения заключается в обеспечении способа производства липосом, которые способны с высокой эффективностью включать гидрофильный белок, который исключает органические растворители или детергенты, который легко выполнить в крупном масштабе, который дает стабильный продукт при хранении без разрушения белка, который позволяет осуществить замедленное высвобождение белка и который обеспечивает липосомы, достаточно крупные для того, чтобы избежать быстрого выведения из места наложения.

В одном из аспектов, изобретение имеет отношение к высушенной фармацевтической композиции, которая включает лиофилизированные включающие активное средство везикулы, включающие

а) по меньшей мере, один липид, b) по меньшей мере, одно активное средство, с) средство, способствующее слиянию, и d) не включающие средство, стабилизирующее мембрану, в которой регидратация высушенной фармацевтической композиции приводит к образованию многослойных липосом, имеющих средний диаметр липосомы, равный более чем 1 мкм, эти липосомы инкапсулируют активное средство.

Высушенную фармацевтическую композицию в соответствии с изобретением можно стабильно хранить в течение длительного времени. Предпочтительно, высушенная фармацевтическая композиция изобретения представляет собой лиофилизированную композицию. Поскольку композиция в высушенной или в лиофилизированной форме стабильна, ее можно легко восстановить путем добавления водного раствора. Добавление водного раствора приводит к образованию многослойных липосом, имеющих средний диаметр липосомы, равный более чем 1 мкм, предпочтительно, равный примерно 1,5 мкм или крупнее. Эти многослойные липосомы инкапсулируют активное средство с высокой эффективностью инкапсулирования, равной, предпочтительно, по меньшей мере, 40%, в особенности, равной, по меньшей мере, 50%, более предпочтительно равной, по меньшей мере, 55%, даже более предпочтительно равной, по меньшей мере, 60% и наиболее предпочтительно равной, по меньшей мере, 80%.

Композиция высушенной фармацевтической композиции изобретения включает, по меньшей мере, один липид, по меньшей мере, одно активное средство, по меньшей мере, средство, способствующее слиянию, и не включает средство, стабилизирующее мембрану. Предпочтительно, по меньшей мере, одно активное средство представляет собой белок, в особенности, гидрофильный белок или его активный фрагмент. Особенно предпочтительны те белки, которые представляют собой регенерирующее средство для кости и/или хряща, предпочтительно CD-RAP. Предпочтительные средства, способствующие слиянию, представляют собой щелочные аминокислоты, в особенности, аминокислоты, которые выбирают из аргинина, гистидина, лизина или цитрулина. Дополнительно, было обнаружено, что выгодно обеспечивать высушенную фармацевтическую композицию, не содержащую средство, стабилизирующее мембрану, т.е. в особенности, в отсутствие защитного сахара, спиртовой формы сахаров или гликозида. Дополнительно, в некоторых предпочтительных воплощениях изобретения, композиция также включает неорганический или органический анион, такой как сукцинат, фумарат, цитрат, малат, фосфат, ацетат или хлорид.

Высушенная фармацевтическая композиция предпочтительно представляет собой стерильную композицию.

Без заключения в липосомы, происходит быстрое выведение даже крупных белков из места введения, например, происходит выведение из синовиальной жидкости через синовиальную мембрану и, следовательно, они не доступны в достаточной мере для индукции регенерации поврежденных тканей, таких как хрящ или кость. Для того чтобы продлить локальное время удержания активного средства, такого как фактор роста, в месте нанесения, например, в диске или в его окружении и/или внутри суставного сочленения, авторы изобретения способны обеспечить липосомную композицию белка, например, крупные многослойные везикулы (MLV), включающие гидрофильный белок, такой как CD-RAP или BMP, с высокой степенью инкапсулирования и контролируемым выходом белка.

Авторы изобретения обеспечивают парентеральную фармацевтическую композицию, включающую композицию лиофилизированных липосом с белком, которые устойчивы к разрушению при долговременном хранении и которые могут быть восстановлены с образованием крупных многослойных липосом, включающих гидрофильный белок. Высушенные восстановленные везикулы, примененные в этом документе, представляют собой, например, сухие гранулированные изделия, которые при добавлении водной среды диспергируют с образованием композиции многослойных липосом, включающих биологический активный компонент. Преимущественно, при применении высушенных липосом в соответствии с изобретением избегают проблем со стабильностью, таких как агрегирование или окисление активного средства. К тому же, достигают высокой эффективности инкапсулирования гидрофильных ингредиентов, таких как белки, подобные регенерирующим средствам для костей и/или хряща, включая BMP и/или CD/RAP. В отличие от известного уровня техники, авторы изобретения теперь способны обеспечить стабильную фармацевтическую композицию с минимальным изменением активного средства, формирующую стабильную лиофилизированную лепешку, которая может быть легко и быстро восстановлена с помощью водной среды с воспроизводимым включением инкапсулирования активного средства, с усовершенствованной стабильностью при хранении и значительным увеличением в распределении по размерам многослойных липосом при регидратации.

Регидратированные липосомы изобретения обладают пролонгированной устойчивостью in situ после инъекции, например, в синовиальную жидкость, внутрисуставное пространство, в межпозвоночный диск или окружение межпозвонкового диска и, таким образом, преодолевают ограничения современного уровня техники в области лечения заболевания суставов. Белок обладает непосредственным действием из-за присутствия активного средства вне липосомы и замедляющим или повышающим устойчивость влиянием на деградацию липосом. Присутствие активного средства в течение длительного времени обеспечивает возможность длительного полезного влияния на клетки, такие как хрящеобразующие и синовиальные клетки, на образование протеогликанов, обеспечивая, таким образом, регенерирующее действие, или замедляет прогрессирование болезни с помощью активного средства. При введении конечной композиции настоящего изобретения в пораженный сустав (например, в костно-суставное сочленение) конечная композиция может обеспечивать защитное действие на структуры сустава, и противовоспалительное и/или регенерирующее действие, опосредуемое активным соединением, смазывающий эффект липосомы, эффект дополнительной вязкости и/или эффект замещения синовиальной жидкости.

Также в объем охраны настоящего изобретения входит способ получения высушенной липосомной композиции, которая после регидратации водным раствором образует многослойные липосомы со средним диаметром липосомы, равным более чем 1 мкм, инкапсулирующие активные соединения, включающий стадии а) гидратации липида, липидной смеси или липидной пленки в отсутствие органического растворителя, b) образования небольших однослойных везикул, предпочтительно, со средним диаметром от 50 до 200 нм, с) добавления водного раствора активного средства, d) добавления средства, способствующего слиянию, и, необязательно, неорганического или органического аниона после, перед или вместе со стадией с), и е) дегидратации указанной липидной дисперсии без добавления средства, стабилизирующего мембрану.

Небольшие однослойные везикулы, полученные на стадии b), предпочтительно имеют средний диаметр, равный, по меньшей мере, 50 нм, в особенности, равный, по меньшей мере, 60 нм и более предпочтительно равный, по меньшей мере, 70 нм, и имеют максимальный диаметр, равный предпочтительно 200 нм, в особенности, 150 нм, и более предпочтительно 120 нм.

Особое преимущество способа настоящего изобретения заключается в том, что после стадий b) и с) может быть проведено стерилизующее фильтрование. Таким образом, может быть обеспечена стерильная высушенная фармацевтическая композиция.

После получения на стадии а) и d) лекарственные формы можно хранить, например, при пониженном давлении при 4°С, предпочтительно при комнатной температуре.

В зависимости от размера липосом MLV и в зависимости от термочувствительности многих активных соединений, таких как белки, стерилизующее фильтрование или терминальная стерилизация такого известного фармацевтического препарата не осуществима. Эти трудности преодолевают с помощью способа асептического производства в соответствии с изобретением.

Следовательно, изобретение дополнительно обеспечивает способ получения пригодной для введения липосомной композиции, включающей многослойные липосомы со средним диаметром липосомы, равным более чем 1 мкм, инкапсулирующие активные соединения, включающий стадии а) гидратации липида, липидной смеси или липидной пленки в отсутствие органического растворителя, b) образования небольших однослойных везикул предпочтительно со средним диаметром от 50 и 200 нм, с) добавления водного раствора активного средства, d) после, перед или вместе со стадией с) добавления средства, способствующего слиянию, и необязательно неорганического или органического аниона, е) дегидратации указанной липидной дисперсии без добавления средства, стабилизирующего мембрану, f) регидратации водным раствором и образования многослойных везикул, имеющих средний диаметр липосомы, равный более чем 1 мкм, инкапсулирующих активное средство, в котором стадию стерилизующего фильтрования проводят после стадии b) и/или с).

В особенности, можно получить стерильную композицию, включающую липосомы MLV, применяя стерильный водный раствор на стадии f).

Также охвачено обеспечение набора, включающего высушенную фармацевтическую композицию, такую как описана в этом документе, и, в особенности, в п.1, и водный раствор для регидратации высушенной фармацевтической композиции.

Если желательна лиофилизация, то в известном уровне техники описаны лиопротекторы. Дисахариды, такие как сахароза, лактоза и трегалоза представляют собой наиболее предпочтительные лиопротекторы. Следует избегать моносахаридов, таких как глюкоза или сорбитол, или экспиентов с низкой молекулярной массой, таких как аминокислоты и неорганические соли, из-за низкой температуры их фазового перехода и температуры разрушения в замороженном состоянии (Liposomes 2nd edition, A Practical Approach, edited by Vladimir P. Torchilin and Volkmar Weissig, Oxford University Press, page 157 (2002)). Однако авторы изобретения обнаружили, что применение щелочных аминокислот, например, аргинина в качестве наполнителей не защищает везикулы в процессе лиофилизации, но, удивительно, стимулирует процесс слияния, который важен для получения многослойных везикул с диаметром, равным 1 мкм и крупнее. В дополнение к этому эффекту, применение этих аминокислот удивительным образом способствует стабилизации белка, входящего в состав композиции, в процессе лиофилизации. Сочетание этих двух эффектов - с одной стороны, дестабилизация липидных мембран и, с другой стороны, стабилизация лекарственных средств - до настоящего времени было совершенно не известно.

В отличие от известного уровня техники липосомы, такие как MVL, описанные например, в работе Кима и соавт. (Kim, S. et al. (1983) Preparation of multivesicular liposomes. Biochim. Biophys. Acta 728: 339-348), преимущество липосом настоящего изобретения заключается в том, что исключены органические растворители, такие как хлороформ. Препараты липосом изобретения предпочтительно свободны от органических растворителей и, в особенности, содержат органический растворитель в количестве менее чем 2% (по масс.), предпочтительно менее чем 1% (по масс.), более предпочтительно менее чем 0,1% (по масс.) и наиболее предпочтительно 0%. Дополнительно, изобретение обеспечивает способ для создания крупномасштабного производства для получения высушенных восстановленных везикул, в котором при регидратации происходит формирование везикул MLV для фармацевтических приложений.

Преимущество способа изобретения заключается в том, что можно избежать дополнительных стадий очистки липосом, которые представляют собой описанные в известном уровне техники способы удаления материала, не захваченного в водную внутреннюю полость липосомы или между липосомными оболочками. То, что часть невключенного белка предпочтительно присоединена к поверхности липосом нековалентно, представляет собой серьезное преимущество, поскольку создается возможность для первоначального быстрого освобождения активного средства, например, свободного белка, при введении фармацевтической композиции субъекту, который в ней нуждается.

Высокая степень включения белка (например, CD-RAP) в везикулы MLV, при применении способа настоящего изобретения, по сравнению с низкой эффективностью инкапсулирования везикул MLV, произведенных с помощью способов известного уровня техники, представляет собой дополнительное преимущество способа настоящего изобретения. Кроме того, при применении способа настоящего изобретения происходит формирование многослойных липосом вместо крупных однослойных липосом, которые получают при применении способов известного уровня техники, таких как восстановление лиофилизированного липидного порошка с помощью раствора белка.

Термин «многослойные везикулы (везикулы MLV)» означает липосомы, содержащие множество липидных бислоев, формирующих две или несколько оболочек, в особенности двухфазные многослойные липидные везикулы. Двухфазные липидные везикулы включают множество расположенных на определенном расстоянии липидных бислоев, включающих компонент, формирующий липосому, и, необязательно, биологическое активное средство. Липидные везикулы включают периферические компартменты с водным раствором между липидными бислоями и компартмент центральной внутренней полости, включающие водный раствор, необязательно включающий активные соединения.

Термины «инкапсулирование, захват или окружение» применены в этом документе для описания расположения веществ, в особенности, гидрофильных веществ, в водной внутренней полости или между двумя соседними оболочками липосомы. Количество материала, включенного во внутреннее пространство липосомы, может быть определено с помощью способов, известных в известном уровне техники, таких как очистка с помощью центрифугирования, описанного в издании «Liposomes» 2nd edition, A Practical Approach, edited by P. Torchilin and Volkmar Weissig, Oxford University Press (2002), диализа, описаного в издании «Liposomes», A Practical Approach edited by R. R. C. New, IRL Press (1990), или тех способов, которые будут описаны в разделе «Примеры» изобретения.

Под термином «без добавления средства, стабилизирующего мембрану» следует понимать, что не было добавлено никаких веществ или что никакие вещества не присутствовали в количестве, достаточном для ингибирования слияние липосомных фрагментов или везикул, например, достаточном для ингибирования образования многослойных везикул. Примеры средств, стабилизирующих мембраны, представляют собой защищающие сахара, сахарные спирты или гликозиды в концентрации, достаточной для осуществления защиты на внешней и/или внутренней поверхностях. При концентрации сахара, такого как трегалоза, равной 50 мМ, везикулы обычно имеют такой же размер как перед дегидратацией. При концентрации сахара, например, при концентрации трегалозы, равной 125 мМ или выше, практически отсутствует заметная структурная разница между везикулами до или после дегидратации. Однако небольшие количества такого средства, стабилизирующего мембрану, могут быть охвачены, если они не ингибируют слияние липосом при высушивании, например, при образовании везикул MLV. Средство, стабилизирующее мембраны, предпочтительно присутствует в композиции изобретения в количестве, равном <5% (масс./объем), предпочтительно <2.5% (масс./объем), более предпочтительно <1% (масс./объем), даже более предпочтительно <0,1% (масс./объем) и наиболее предпочтительно 0% (масс./объем).

Термины «активное средство, биологическое активное средство или биологическое активное соединение» означают любое средство, которое имеет терапевтический, биологический, фармакологический, фармацевтический (например, лечит, контролирует, улучшает, предупреждает, задерживает начало болезни, снижает риск развития одного или несколько заболеваний, нарушений или состояний или их симптомов) и/или косметический эффект. Терапевтический эффект может быть местным или системным и может быть объективным или субъективным. Предпочтительно активное средство представляет собой белок, в особенности, гидрофильный белок, более предпочтительно белок регенерации кости и/или хряща.

Термин «средство, стабилизирующее мембрану» означает средство, которое при добавлении в определенной концентрации или в определенном диапазоне концентраций, защищает липосомы от разрушения или утечки активного средства, инкапсулированного при высушивании. Оно может быть защищающим сахаром, сахарным спиртом или гликозидом, в особенности, моно- или дисахаридом или аминогликозидом. Защитные сахара и гликозиды включают экспиенты, такие как трегалоза, мальтоза, сахароза, глюкоза, лактоза, дектран, стрептомицин и дигидрострептомицин.

Термин «средство, способствующее слиянию» означает средство, которое стимулирует или делает возможным слияние липидных агрегатов в везикулы MLV. К тому же, средство, способствующее слиянию, предпочтительно означает эксипиент или компонент, который стабилизирует нативную структуру активного средства, например, белка. Дополнительно, средство, способствующее слиянию, предпочтительно, не защищает везикулы SUV при высушивании или от разрушения липидных бислоев везикул SUV, например, путем формирования кристаллов льда. Средство, способствующее слиянию, может быть аморфным или частично кристаллическим веществом или буферным веществом, которое приводит к фрагментации, разрыву или раскрытию липидных мембран, при применении такого способа дегидратации, как сублимационная сушка, делая возможным инкапсулирование активного средства в процессе формирования везикул MLV с помощью последующей регидратация. Такие вещества включают аминокислоты, в особенности, щелочные аминокислоты и, предпочтительно, аргинин, гистидин, цитрулин, лизин и соответствующие соли, такие как фосфат, сульфат или хлорид или их смеси. Предпочтительно, средство, способствующее слиянию, добавляют в количестве, достаточном для создания изотонических условий после регидратации высушенной липосомной композиции (высушенные восстановленные везикулы, DRV). К тому же, средство, способствующее слиянию, предпочтительно не имеет вредного воздействия (например, окисления) на активное средство, например, на белок, который намереваются инкапсулировать.

Термин «дегенеративное заболевание межпозвонкового диска (DDD)» представляет собой хронический процесс, который частично характеризуется прогрессирующей потерей протеогликана и снижением количества воды в студенистом ядре, что может начать проявляться во множестве заболеваний, таких как идиопатическая боль в нижнем отделе спины, выпячивание межпозвонкового диска, разрушение внутренних межпозвонковых дисков или растрескивание межпозвонковых дисков, радикулопатия, спинальный стеноз, воспаление седалищного нерва, индуцированное грыжей студенистого ядра, воспаление седалищного нерва, идиопатический сколиоз и/или миелопатия. Степень деформации межпозвонкового диска может быть оценена с помощью анализа результатов предоперационной MRI.

Для целей настоящего изобретения, термин «трансдискально» включает, но не ограничивается, инъекцией в межпозвонковый диск, в особенности, в студенистое ядро (NP) межпозвонкового диска, который включает интактный диск, дегенеративный диск на разных стадиях, грыжу межпозвонкового диска, разорвавшийся межпозвонковый диск, расслоившийся межпозвонковый диск или растрескавшийся межпозвонковый диск. Если объем, который намереваются ввести, может оказать давление на NP, то, по меньшей мере, часть NP может быть удалена перед инъекцией или нанесением имплантата для позвоночного столба. В некоторых случаях объем удаленного материала равен примерно объему, который намереваются внести, ±20%. Термин «трансдискально» также включает инъекцию в фиброзное кольцо (AF) дегенерирующего межпозвонкового диска, как описано выше для NP. В случаях, когда наносят материал-носитель более крупного размера, может понадобиться частичное или полное удаление диска перед нанесением фармацевтической композиции в соответствии с изобретением. Это дополнительно включает обеспечение имплантата в место, расположенное снаружи, но близко расположенное к стенке AF или к концевой пластинке примыкающего тела позвонка, так можно избежать прокола AF и, следовательно, потенциальной нагрузки на диск.

Термин «липид», так как он применен в этом документе, предназначен для обозначения любого вещества, которое может быть применено для получения липидных бислоев. Типичные липиды включают гликолипиды, лецитин, фосфолипиды, церамиды и их смеси.

Подходящие липиды, гидрогенизированные или нет, присутствующие индивидуально или в смесях, в соответствии с настоящим изобретением включают нейтральные или положительно заряженные липиды, такие как нейтральные лецитины или фосфолипиды. Примеры липидов представляют собой фосфатидилхолин (PC), яичный фосфатидилхолин (ЕРС), фосфатидилсерин (PS), холестерин (Chol), дистеароилфосфатидилхолин (DSPC), сфингомиелин (SM), диолеилфосфатидилхолин (DOPC), диолеилфосфатидилглицерин (DOPG), дилауроилфосфатидилхолин (DLPC), фосфатидилглицерин (PG), димиристоилфосфатидилхолин (DMPC), дипальмитоилфосфатидилхолин (DPPC), ганглиозиды, церамиды, фосфатидилинозитол (PI), фосфатные кислоты (РА), дицетилфосфат (DcP), димиристоилфосфатидилхолин (DMPC), ганглиозид и другие гликолипиды, стеариламин, дипальмитоилфосфатидилглицерин (DPPG), и другие синтетические или полусинтетические липиды. Фосфолипиды могут быть нейтральными липидами, полученными из яичных желтков, сои или от других животных или растений, таких как лецитин желтка, лецитин сои и им подобные. Липосомная композиция обычно представляет собой смесь, состоящую, по меньшей мере, из одного, более предпочтительно, по меньшей мере, из двух липидов, таких как холестерин и фосфатидилхолин, и более предпочтительно из трех или большего числа липидов.

В дополнительном предпочтительном воплощении липиды включают менее чем 20, 15, 10, 8, 5, 3, 1 весовых процентов (% по масс.) ненасыщенных липидов по отношению к общему содержанию липидов. Предпочтительно липиды представляют собой насыщенные нейтральные липиды.

Ненасыщенные и/или нейтральные липиды представляют собой предпочтительные липиды в соответствии с настоящим изобретением для увеличения стабильности образовавшихся липосом и для усовершенствования замедленного высвобождения для фармацевтического применения для целей изобретения, описанных в рамках описания изобретения. Ненасыщенные липиды имеют очень низкую температуру фазового перехода. Поскольку липиды будут в жидкокристаллической фазе в ходе всех фаз получения, то, например, обработка дисперсии или регидратация липосом проходит намного легче и быстрее. Если температура окружающей среды будет близка к температуре фазового перехода или совпадает с температурой фазового перехода липидов, то в результате произойдет значительная потеря включаемого соединения.

Предпочтительно, парентеральные фармацевтические композиции; описанные выше, включают два липида, предпочтительно два нейтральных липида, более предпочтительно фосфатидилхолин (PC) и холестерин (Chol). Предпочтительно, отношение массовых процентов двух липидов (например, PC:Chol), рассчитанное по отношению к общему содержанию липидов, может быть от примерно 2 до примерно 7, от примерно 2 до примерно 6, от примерно 2 до примерно 5, от примерно 3 до примерно 7, от примерно 3 до примерно 6, от примерно 3 до примерно 5, от примерно 2,7 до примерно 5,4, от примерно 2,8 до примерно 5,2, от примерно 2,8 до примерно 4,2, от примерно 2,8 до примерно 3,2 (например, 3,4 или 5).

Хотя описано, что нейтральные липиды часто приводят к образованию агрегатов везикул MLV, для везикул MLV настоящего изобретения никакого агрегирования не наблюдали.

Предпочтительно смесь липидов представляет собой смесь заряженных липидов. Примеры катионных липидов включают диоктадецилдиметиламмония хлорид (DOPAC), N-(2,3-диолеилокси)пропил-N,N,N-триметиламмония (DOTMA), дидодециламмония бромид (DDAB), 1,2-диолеоилокси-3-триметиламмония пропан (DOTAP), 3-N-(N',N',-диметиламиноэтан)-карбамол холестерин (DC-Chol), 1,2-димиристоилоксипропил-3-диметилгидроксиэтил аммония (DMRIE), 2,3-диолеилокси-N-[2(сперминкарбоксамидо)этил]-N,N-диметил-1-пропанамин трифторацетат (DOSPA) и им подобные.

Примеры анионных липидов хорошо известны специалистам в этой области техники и включают, но не ограничиваются, кардиолипином, аскорбилпальмитат, дистеароилфосфатидилглицерин (DSPG), фосфатидная кислота и фосфатидилсерин (PS). Другие анионные липиды включают амиды фосфатидилэтаноламина, такие как анандамиды и метанандамиды, фосфатидилсерин, фосфатидилинозитол и их сложные эфиры жирных кислот, фосфатидилэтиленгликоль, кислые лизолипиды, пальмитиновую кислоту, стеариновую кислоту, арахидоновую кислоту, олеиновую кислоту, линоленовую кислоту, линолевую кислоту, миристиновую кислоту, сульфолипиды и сульфатиды, свободные жирные кислоты, как насыщенные, так и ненасыщенные, и их отрицательно заряженные производные. Более предпочтительно, анионные липиды представляет собой фосфатидную кислоту, фосфатидилглицерин, сложные эфиры фосфатидилглицерина и жирных кислот, фосфатидилэтаноламин анандамид, фосфатидилэтаноламин метанандамид, фосфатидилсерин, фосфатидилинозитол, сложный эфир фосфатидилинозитола и жирных кислот, кардиолипин, фосфатидилэтиленгликоль, кислый лизолипид, сульфолипид, сульфатид, насыщенная свободная жирная кислота, ненасыщенная свободная жирная кислота, пальмитиновая кислота, стеариновая кислота, арахидоновая кислота, олеиновая кислота, линоленовая кислота, линолевая кислота или миристиновая кислота. Любой их анионных липидов, описанных в этом документе, может быть фторирован путем замены, по меньшей мере, одного атома водорода на атом фтора.

Для усовершенствования инкапсулирования водорастворимого вещества, такого как белок CD-RAP, липидные компоненты предпочтительно выбирают так, чтобы, по меньшей мере, один липид был заряженным для увеличения инкапсулирования активного средства. Таким образом, в еще одном воплощении, парентеральная фармацевтическая композиция включает вплоть до 20%, 15%, 10%, 5%, 2%, 1%, между примерно 10% и 1%, между примерно 5% и 1%, между 0,1% и 0,5% (масс./масс.) заряженных липидов по отношению к общему содержанию липидов.

Предпочтительно, заряженный липид представляет собой кардиолипин или аскорбилпальмитат, предпочтительно, между 0,1% и 5% (масс./масс.) от общего липида, между 0,1% и 3% (масс./масс.), между 0,1% и 1,5% (масс./масс.), между 0,1% и 1% (масс./масс.) кардиолипина или аскорбилпальмитата от общего липида.

Предпочтительный пример подходящей липидной смеси представляет собой смесь фосфатидилхолина (PC), холестерина (Chol) и аскорбилпальмитата, предпочтительно, РС:Chol:аскорбилпальмитат в отношении, равном 60%-1%:0%-40%:0%-5%, более предпочтительно в отношении, равном 70%-90%:7%-30%:0,1%-3% и наиболее предпочтительно в отношении, равном 70%-80%:20%-28%:0,1%-1,5% (масс./масс.) от общего содержания липидов.

В противоположность тому, что ожидали, исходя из существующего уровня техники, согласно которому заряженные фосфолипидные соединения могут быть важны для уменьшения размера липосом (Liposomes 2nd edition, A Practical Approach, под редакцией Vladimir P. Torchilin и Volkmar Weissig, Oxford University Press (2002), стр.7, первый параграф) и могут влиять отрицательно на удержание веществ после лиофилизации/регидратации, авторы изобретения, с удивлением обнаружили, что добавление заряженного липида увеличивает размер везикул MLV после восстановления (сравни с фиг.3).

Липосомы могут дополнительно включать липид, замещенный гидрофильным полимером, для образования липополимеров. Такие липополимеры предпочтительно включают липиды, модифицированные полимерами по своим концевым группам посредством ковалентной или нековалентной связи. Липополимер может быть введен в липосому или путем добавления липополимера к липидной смеси, формирующей липосому, или путем первоначального получения липосомы и последующего включения липополимера во внешний слой предварительно сформированной липосомы. Липополимеры, описанные, например, в патенте WO 2006/027786, включены в этот документ путем ссылок.

Белок в соответствии с изобретением включает, например, гидрофильный белок.

Предпочтительно гидрофильные белки представляют собой средства для регенерации хряща или кости, например, средства, стимулирующие образование хряща или костные морфогенетические белки. В особенности, такие средства, включают членов семейства TGF-β (трансформирующий фактор роста, Roberts и Spom, Handbook of Experimental Pharmacology 95 (1990), страницы 419-472), DVR-группу (Hotten et al., Biochem. Biophys. Res. Comm. 206 (1995), страницы 608-613 и дополнительно работы, процитированные в этом документе), включая белки BMP (костные морфогенетические белки, Roses and Thies, Growth Factors in Perinatal Development (1993), страница 39-58) и факторы GDF (ростовые факторы дифференцировки), ингибин/активин (Vale et al., The Physiology of Reproduction, второе издание (1994), страница 1861-1878), белки семейства GDNF, SOX, IGF и EGF.

Представляющие интерес белки, представляющие собой членов суперсемейства TGF-β3 или их активных вариантов, включают белки TGF-β такие как TGF-β1, TGF-β2, TGF-β3, TGF-β4, TGF-β5 (патенты U.S. 5,284,763; EP 0376785; US 4,886,747; DNA 7 (1988), страница 1-8, EMBO J. 7 (1988), страница 3737-3743; Mol. Endo. 2 (1988), страница 1186-1195; J. Biol. Chem. 265 (1990), страница 1089-1093), белки ОР1, ОР2 и ОР3 (патенты US 5,011,691, US 5,652,337, WO 91/05802), а также BMP-2, BMP-3, BMP-4 (патенты WO 88/00205, US 5,013,649 и WO 89/10409; Science 242 (1988), страница 1528-1534), BMP-5, BMP-6 и BMP-7 (OP1) (Proc. Natl. Acad. Sci. 87 (1990), страница 9841-9847; WO 90/11366), BMP-8 (OP2) (WO 91/18098), BMP-9 (WO 93/00432), BMP-10 (WO 94/26893). BMP-11 (WO 94/26892), BMP-12 (WO 95/16035), BMP-13 (WO 95/16035), BMP-15 (WO 96/36710), BMP-16 (WO 98/12322), BMP-3b (Biochem. Biophys. Res. Comm. 219 (1996), страница 656-662), GDF-1 (WO 92/00382 и Proc. Natl. Acad. Sci. 88 (1991), страница 4250-4254), GDF-8 (WO 94/21681), GDF-10 (WO 95/10539), GDF-11 (WO 96/01845), GDF-5 (CDMP1, МР52) (WO 95/04819; WO 96/01316; WO 94/15949, WO 96/14335 и WO 93/16099 и Nature 368 (1994), страница 639-643), GDF-6 (CDMP2, BMP-13) (WO 95/01801, WO 96/14335 и WO 95/16035), GDF-7 (CDMP3, BMP-12) (WO 95/01802 и WO 95/10635), GDF-14 (WO 97/36926), GFD-15 (WO 99/06445), GDF-16 (WO 99/06556), 60A (Proc. Natl. Acad. Sci. 88 (1991), страница 9214-9218), DPP (Nature 325 (1987), страница 81-84), VgM (Proc. Natl. Acad. Sci. 86 (1989), страница 4554-4558) Vg-1, (Cell 51 (1987), страница 861-867), дорзалин (Cell 73 (1993), страница 687-702), MIS (Cell 45 (1986), страница 685-698), (WO 97/00958), BIP (WO 94/01557), ингибин а, активин βА и активин βВ (ЕР 0222491), активин βС (МР121) (WO 96/01316), активин βE и GDF-12 (WO 96/02559 и WO 98/22492), активин βD (Biochem. Biophys. Res. Comm. 210 (1995), страница 581-588), GDNF (Science 260 (1993), страница 1130-1132, WO 93/06116), неуртурин (Nature 384 (1996), страница 467-470), парсефин (Neuron 20 (1998), страница 245-253, WO 97/33911), артемин (Neuron 21 (1998), страница 1291-1302), Mic-1 (Proc. Natl. Acad. Sci USA 94 (1997), страница 11514-11519), унивин (Dev. Biol. 166 (1994), страница 149-158). ADMP (Development 121 (1995), страница 4293-4301), белок гена Nodal (Nature 361 (1993), страница 543-547), белок гена Screw (Genes Dev. 8 (1994), страница 2588-2601) или их сочетания. Другие полезные белки включают биологически активные биосинтетические конструкции, включая биосинтетические белки, сконструированные с применением последовательностей от двух или нескольких известных морфогенетических белков. Примеры биосинтетических конструкций раскрыты в патенте США U.S. 5,011,691 (например, СОР-1, СОР-3, СОР-4, СОР-5, СОР-7 и СОР-16). Пример полезного белка члена семейства SOX (например, SOX-9) раскрыт в патенте WO 96/17057. Раскрытие процитированных публикаций, включая патенты или патентные заявки, включены в этот документ путем отсылок.

В одном из воплощений, регенерирующее средство для хряща или кости выбирают из группы белков с SH3-доменом или с доменом, адаптированных как SH3-подобная доменная складка, такой как CD-RAP. SH3-домены или SH3-подобные домены описаны, например, в Stoll et al. (Stoll, R. et al. (2003) Backbone dynamics of the human MIA protein studied by (15)N NMR relaxation: implications for extended interactions of SH3 domains. Protein Sci. 12: 510-519; Stoll, R. et al. (2001) The extracellular human melanoma inhibitory activity (MIA) protein adopts an SH3 domain-like fold. Embo J 20: 340-349) и может быть определен путем предсказания SH3-складки с помощью 3D-PSSM Интернет-сервера, опубликованного в работе Kelley et al. (Kelley, L. A. et al. (2000) Enhanced genome annotation using structural profiles in the program 3D-PSSM. J Mol. Biol 299: 499-520). SH3-домены, также называемые домены Src-гомологии, представляют собой белковые молекулы, которые обнаружены во многих внутриклеточных белках. До настоящего времени не сообщалось о SH3-доменных белках, которые были бы полезны для лечения нарушений спинного мозга.

В еще одном воплощении регенерирующее средство для хряща или кости представляет собой белок, который может специфически связываться с фибронектином, фрагментами фибронектина и/или с последовательностями, богатыми пролином, как, например, те, что описаны в литературе (Stoll, R. et al. (2001) The extracellular human melanoma inhibitory activity (MIA) protein adopts an SH3 domain-like fold. Embo J 20: 340-349; Homandberg, G. A. and Hui, F. (1996) Association of proteoglycan degradation with catabolic cytokine and stromelysin release from cartilage cultured with fibronectin fragments. Arch. Biochem. Biophys. 334: 325-331; Homandberg, G. A. et al. (1997) Fibronectin-fragment-induced cartilage chondrolysis is associated with release of catabolic cytokines. Biochem. J 321 (Pt3): 751-757).

В одном из воплощений регенерирующее средство для хряща или кости включает фибронектин или домен, связывающий интегрин. Связывание фактора дифференциации и сохранения хряща с внеклеточными белками, такими как фибронектин или фрагменты фибронектина, а также с интегринами, может быть определено, например, методом ELISA. Фибронектин, их фрагменты или интегрины могут быть нанесены в виде покрытия на пластиковые поверхности и подвергнуты воздействию фактора дифференциации и сохранения хряща. Количество связывания может быть определено с помощью связанных с пероксидазой моноклинальных антител к фактору дифференциации и сохранения хряща. Связывание интегрина можно также определить с помощью способа, описанного в работе Bauer et al. и включенной посредством этого с помощью отсылки (Bauer, R. et al. (2006) Regulation of integrin activity by MIA. J Biol Chem 281: 11669-11677).

Предпочтительно, средства для регенерации хряща или кости определяют как а) белки хондроцитов, включающие или имеющие зрелую последовательность белка CD-RAP (SEQ ID No 1) и функциональные фрагменты или их варианты, b) белки, имеющие, по меньшей мере, 63%, предпочтительно 80%, более предпочтительно 90%, гомологии в аминокислотной последовательности с С-концевым скелетом из четырех цистенов белка CD-RAP, аминокислоты от 12 до 107 последовательности SEQ ID No. 1, или с) белки, имеющие любые родственные последовательности от 1 до 3, определенные в этом документе (SEQ ID No 2, 3 и 4).

Функциональные фрагменты, имеющие такие же биологические функции как CD-RAP, предпочтительно имеют длину, равную, по меньшей мере, 20, в особенности, по меньшей мере, 40, и более предпочтительно, по меньшей мере, 50, наиболее предпочтительно последовательность из 80 соседних аминокислот, показанная на SEQ ID N0:1. Предпочтительно, функциональные фрагменты включают аминокислоты в положении от 1 до 50, от 1 до 70, от 1 до 80, от 20 до 80, от 20 до 107 последовательности SEQ ID No 1.

Зрелая последовательность CD-RAP (SEQ ID No 1)

GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFS

KLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Родственная последовательность 1 (SEQ ID No 02)

С X4 С X17 С X12 V X11-13 W X7-18 F X4 V X21 С X

Родственная последовательность 2 (SEQ ID No 03)

K X C X D X E C X11 D X3 P D C X12 V X2 K L X7-9 W X G S X5-13 G Y F P Х3

V X18 D F X C X

Родственная последовательность 3 (SEQ ID No 04)

K X C X D X2 C X8 A X2 D X3 P D C R P X5 G X V X5 K L X7 W X G S V X12

G Y F P X22 D F X C Q

в которой «X», при каждом появлении, независимо представляет собой любую аминокислоту, и число в нижнем регистре представляет собой номер любой аминокислоты. Предпочтительно, «X» независимо представляет собой нейтральные аминокислоты и, в особенности. A, R, N, D, В, С, Q, Е, Z, G, H, I, L, К, М. F, P, S, Т, W, Y или V.

Особенно предпочтительно, чтобы регенерирующее средство для хряща или кости представляло собой CD-RAP (хрящевой белок, чувствительный к ретиноевой кислоте), также называемый MIA (активность, ингибирующая меланому), OTOR (белок фиброцитов, FDP, MIA-подобный, MIAL) и TANGO 130, который принадлежит к классу секретируемых белков (Bosserhoff, А. К. et al. (2004) Characterization and expression pattern of the novel MIA homolog TANGO. Gene Expr. Patterns. 4: 473-479; Bosserhoff, A. K. and Buettner, R. (2003) Establishing the protein MIA (melanoma inhibitory activity) as a marker for chondrocyte differentiation. Biomaterials 24: 3229-3234; Bosserhoff, A. K. et al. (1997) Mouse CD-RAP/MIA gene: structure, chromosomal localization, and expression in cartilage and chondrosarcoma. Dev. Dyn. 208: 516-525; WO 00/12762). CD-RAP или MIA представляет собой белок в 130 аминокислот (патенты ЕР 0710248, ЕР 1146897 полностью включены в этот документ путем отсылок), который представляет собой высоко специфический маркер хондриоидной дифференциации.

Предпочтительно, белок в соответствии с изобретением включает CD/RAP (MIA), BMP-2, BMP-7, BMP-12, BMP-13, GDF-5 (MP-52), TGF-бета1, TGF-бета2, TGF-бета3. TGF-альфа или их активные фрагменты или комбинации, наиболее предпочтителен CD/RAP (MIA).

Белок, рассматриваемый в этом документе, может быть экспрессирован из интактной или укороченной геномной ДНК или кДНК или из синтетических молекул ДНК, в прокариотических или эукариотических клетках-хозяевах. Белки могут быть изолированы из культуральной среды или из телец включения и/или подвергнуты рефолдингу для образования биологически активных композиций. Смотри, например, патент ЕР 0710248 и работу Lougheed et al. (Lougheed, J. С. et al. (2001) Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins. Proc. Natl. Acad. Sci, U.S.A 98: 5515-5520) для типичных протоколов очистки рекомбинантного белка CD-RAP. Подробное описание анализа активности (например, хондрогенеза) таких изолированных белков приведено в работах в Tscheudschilsuren et al. и Stoll et al. (Tscheudschilsuren, G. et al. (2005) Regulation of mesenchymal stem cell and chondrocyte differentiation by MIA. Experimental Cell Research 1-10; Stoll, R. et al. (2003) Backbone dynamics of the human MIA protein studied by (15)N NMR relaxation: implications for extended interactions of SH3 domains. Protein Sci. 12: 510-519), раскрытие которых включено путем отсылок в этот документ. Биоанализ хрящевой индукции описан в примерах от 2 до 5 в патенте ЕР 1146897, который включен в этот документ путем отсылок.

Предпочтительно, средство, способствующее слиянию, применяют в количестве, достаточном для того, чтобы избежать осмотического стресса в физиологическом окружении, и/или для поддержания изотонических условий при парентеральных применениях. Предпочтительно, средство, способствующее слиянию, применяют в количестве, равном менее чем 8% (масс./объем) по отношению к материалу частиц перед высушиванием, предпочтительно менее чем 5%, предпочтительно между 2% и 5%.

В предпочтительном воплощении, парентеральная фармацевтическая композиция, включающая содержащие лиофилизированный белок везикулы, включает средство, способствующее слиянию, в количестве, достаточном для образования изотонической липосомной дисперсии после регидратация с помощью водного раствора. Предпочтительно, рН регидратированной липосомной дисперсии находится между рН 4 и рН 9, между рН 5 и рН 8, предпочтительно между рН 6 и рН 7,5.

Подходящие неорганические или органические анионы представляют собой, например, сукцинат, фумарат, цитрат, малат, фосфат, ацетат, хлорид, предпочтительно фосфат.

Предпочтительно, средство, способствующее слиянию, представляет собой фосфат аргинина, предпочтительно между 100-800 мМ, более предпочтительно 100-600 мМ или наиболее предпочтительно 280 и 400 мМ аргинина фосфат после восстановления лиофилизированных липосом.

Другие добавки или дополнительные вещества, подобные антиоксидантам, такие как метионин, аскорбиновая кислота, токоферол, бутилгидрокситолуол (ВТН), бутилгидроксианизол, пропилгаллат, заряженное вещество, такое как стеариламин, олеиламин, дицетил фосфат или им подобные могут быть подобраны соответствующим образом. Предпочтительно, добавка представляет собой бутилгидрокситолуол (ВТН), бутилгидроксианизол и/или метионин, предпочтительно, между 0,1 и 5% (масс./масс.) от общего липида, между 0,1 и 3% (масс./масс.), между 0,1 и 1,5% (масс./масс.), между 0,1 и 1% (масс./масс.) антиоксиданта, например, бутилгидрокситолуол от общего количества липида, и/или между 5 и 100 мМ метионина, конечная концентрация в регидратированных липосомах, более предпочтительно между 5 и 50 мМ, наиболее предпочтительно между 10 и 25 мМ метионина, конечная концентрация в регидратированных липосомах. Дополнительные вещества могут быть такими, которые служат для улучшения замедленного высвобождения, увеличивают период полураспада липосом или улучшают прицельную доставку липосом и, таким путем, лекарственного средства к определенным типам тканей или клеток.

В дополнение к активному средству, фармацевтическая липосомная композиция настоящего изобретения может включать дополнительные терапевтические или биологические активные средства. Например, терапевтические факторы, применяемые при лечении, например, отдельных симптомов остеоартрита, такие как один или несколько ингибиторов, которые вовлечены в разрушение суставного хряща или синовиальных компонентов, не ограничены антиметаллопротеиназами, циклиновыми соединениями, антагонистами цитокинов, кортикостероидами, ингибиторами TNF; могут присутствовать IL-ингибиторы, противоангиогенные соединения, ингибиторы аггреканазы, ингибиторы р38 киназы, ингибиторы апоптоза, ингибиторы гиалуронидазы и ингибиторы протеолитических ферментов. Факторы, контролирующие воспаление, включая инфликсимаб, этанерцепт, адалимумаб, нерелимонмаб, ленерцепт и им подобные, или их комбинации также могут быть частью композиции. Также предусмотрено, что фармацевтическая липосомная композиция может включать компоненты внеклеточного матрикса, такие как гуалуроновая кислота или ее производное, включая соли, сложные эфиры, внутренние эфиры и сульфированные производные, предпочтительно неполные эфиры гуалуроновой кислоты.

В изобретении также предусмотрено, что будет охвачена парентеральная фармацевтическая композиция или способ ее получения, в соответствии с любым из воплощений настоящего изобретения, в которой более чем 70%, 80%, 90%, 95%, 98% липосом, которые образуются после регидратации водным раствором и инкапсулирования активного средства, представляют собой многослойные липосомы. Более подробно, приведенные выше проценты означают, что после регидратации образуются липосомы, у которых указанный выше процент означает долю от всех сформировавшихся липосом.

В одном из воплощений, водный раствор представляет собой буферный или небуферный раствор, предпочтительно небуферный раствор, наиболее предпочтительно воду для инъекций.

В предпочтительном воплощении, многослойные липосомы, которые предпочтительно представляет собой липосомную дисперсию, имеют осмолярность, равную от 200 до 400 мосмоль, предпочтительно от 250 до 350 мосмоль.

В одном из воплощений, парентеральная фармацевтическая композиция в соответствии с изобретением содержит, по меньшей мере, 0,125 пмоль белка, предпочтительно 1,25 пмоль CD-RAP намкмоль липосомного липида.

В одном из воплощений многослойные липосомы в соответствии с изобретением, получаемые с помощью способа дегидратации и регидратации, такого как описан выше, содержат внутри- и внелипосомное активное средство в растворе, предпочтительно, в изотоническом растворе.

Другое предпочтительное воплощение охватывает фармацевтическую композицию, включающую везикулы, включающие лиофилизированный белок и включающие а) фосфатидилхолин, холестерин и аскорбилпальмитат в отношении, равном примерно от 78-80% до 19,5%-28% до 0,5-2% от общего липида, b) средство, индуцирующее восстановление кости или хряща, предпочтительно CD-RAP, и с) средство, способствующее слиянию, предпочтительно фосфат аргинина с рН между рН 4 и рН 9, предпочтительно рН 5 и рН 8, наиболее предпочтительно рН 6 и рН 7,5, в которой многослойные липосомы, имеющее внутреннее водное пространство, включающее средство, индуцирующее восстановление кости и/или хряща, со средним диаметром липосомы, равным более чем 1 мкм, предпочтительно между 1 мкм и 2,5 мкм, формируются после регидратации высушенной композиции водным раствором, сопровождающейся инкапсуляцией активного средства.

Способы настоящего изобретения обеспечивают высушенную липосомную композицию, а также восстановленные липосомные композиции. Высушенная липосомная композиция предпочтительно представляет собой лиофилизированную и/или стерильную композицию. Восстановленная липосомная композиция предпочтительно представляет собой вводимую парентерально и также стерильную композицию. В особенности, способы обеспечивают высокую эффективность инкапсулирования и высокую концентрацию внутрилипосомного белка после регидратации в водной среде и образования многослойных липосом.

Эти способы включают стадии гидратизации липида, липидной смеси или липидной пленки в отсутствие органического растворителя, в ходе которой происходит формирование крупных везикул MLV, и последующее образование небольших однослойных везикул или липосом, предпочтительно, со средним диаметром, равным от 50 до 200 нм, от 50 до 150 нм, от 50 до 120 нм, от 70 до 120 нм.

В соответствии с настоящим изобретением, липид или липидная смесь, такая как липидный порошок, могут быть гидратированы добавлением водного раствора. Водный раствор может содержать буфер или не содержать буфер (например, буферная или небуферная основная масса белкового раствора). Предпочтительно, водный раствор содержит, по меньшей мере, 50% (масс./масс.), более предпочтительно, по меньшей мере, 90% (масс./масс.) и наиболее предпочтительно, по меньшей мере, 99% (масс./масс.) воды. Липидная пленка может быть получена путем растворения липидов в органическом растворе, таком, например, как трет-бутанол, и последующего высушивания под током азота или лиофилизации.

Для получения небольших однослойных липосом и сортировки липосом по размерам доступно несколько методик. Эти способы включают разнообразные методики, в которых применяют приложение силы, достаточной для уменьшения размера липосом и получения однослойных везикул меньшего размера. Такие способы включают гомогенизацию, с помощью которой крупные липосомы фрагментируют с образование липосом меньшего размера в результате приложенного сдвигающего усилия. В типичной методике гомогенизации липосомы рециркулируют через эмульсионный гомогенизатор до тех пор, пока не будет достигнут желаемый размер, например, средний диаметр между 50 и 200 нм, между 50 и 150 нм, между 50 и 120 нм или между 70 и 120 нм. Гомогенизаторы высокого давления, применяемые для производства липосом, описаны, например, в издании Liposomes 2nd edition, A Practical Approach, edited by Vladimir P. Torchilin and Volkmar Weissig, Oxford University Press, страница 17 (2002). Другие способы включают экструзию липосом через пористые поликарбонатные мембраны под давлением. Обычно, липосомная дисперсия циклически проходит через мембраны несколько раз. Следующие одна за другой мембраны с уменьшающимися порами могут быть применены для постепенного уменьшения размера. Предпочтительные фильтры или мембраны имеют размер меньше или равный 250 нм, 200 нм, 150 нм, 100 нм, 80 нм, 50 нм или 15 нм. Предпочтительное число циклов равно 1, более предпочтительно 2, наиболее предпочтительно 3 или более. Дополнительные способы представляют собой обработку ультразвуком, микрофлюидизацию или механическое перетирание, а также комбинации различных способов. Размер липосом можно контролировать, применяя общепринятые способы, такие как светорассеяние.

После образования небольших однослойных липосом добавляют водный раствор белка (раствор белка в воде) для образования небольших однослойных липосом. После, перед или на этой стадии добавляют средство, способствующее слиянию.

Стадия стерилизации может быть включена после образования везикул SUV и/или после добавления водного раствора белка. Стадия стерилизации, например стерилизация фильтрацией, может быть выполнена с помощью фильтрации через стерильный фильтр с размером пор, равным 0,22 мкм. Ultipor N66 (PALL), Acrodisc 4455T (PALL) или Millex GV SLGV025LS (Millipore) представляют собой примеры таких стерильных фильтров.

В предпочтительном воплощении, концентрация белка находится между 25 мкг/мл и 10 мг/мл, но обычно между 250 мкг/мл и 2,5 мг/мл препарата восстановленных многослойных липосом.

Предпочтительно, средство, способствующее слиянию, включают в изделие и в способы изобретения в количестве, достаточном для образования изотонической липосомной дисперсии после регидратации с помощью водного раствора, предпочтительно в концентрации от 50 мМ до 800 мМ, от 200 мМ до 600 мМ, и наиболее предпочтительно от 250 мМ до 400 мМ. Предпочтительно, рН регидратированных многослойных липосом и/или липосомных дисперсий находится между рН 4 и рН 9, более предпочтительно между рН 5 и рН 8, наиболее предпочтительно между рН 6 и рН 7,5.

Дегидратация указанной липидной дисперсии включает лиофилизацию или сублимационную сушку. Следует понимать, что в изобретении могут быть применены способы высушивания, отличные от лиофилизации, например, вакуумная сушка, сушка под током азота, сушка распылением, сушка на сушильных лотках и сушка в барабанной сушилке. В еще одном воплощении, дегидратация указанной липидной дисперсии представляет собой фрагментацию, разрыв или раскрывание небольших однослойных везикул с помощью дегидратации, например, с помощью лиофилизации или сублимационной сушки.

Необязательно, может быть включена дополнительная стадия, например, стадия фильтрации через мембраны, такие как поликарбонатные мембраны, после любой из стадий получения, описанных выше, например, для удаления кристаллов липофильных веществ.

Добавки, включая те, что были описаны выше (например, антиоксиданты, стабилизирующие средства), могут быть включены на любой стадии способа настоящего изобретения.

В дегидратированной, т.е. высушенной, в особенности, лиофилизированной форме, композицию можно стабильно хранить на протяжении длительных периодов времени.

Дегидратированное изделие (например, лиофилизированная «лепешка») затем может быть восстановлена добавлением дистиллированной воды, водного или другого подходящего раствора, буферного или небуферного. Липосомы могут быть ресуспендированы или регидратированы в водном растворе с помощью плавного перемешивания раствора. Регидратация может быть выполнена при комнатной температуре или при другой температуре, подходящей для композиции липосом и их внутреннего содержимого. Регидратация лиофилизированных композиций приводит к образованию суспензии или дисперсии многослойных липосом, которые имеют увеличенное распределение по размеру и морфологии по сравнению с исходной суспензией липосом перед высушиванием.

В другом предпочтительном воплощении многослойные везикулы, инкапсулирующие белок, в основном образуются в процессе регидратации лиофилизированной липосомной композиции (стадия е), более предпочтительно, когда многослойные липосомы образуются в процессе дегидратации указанной липидной дисперсии (стадия d).

Предпочтительно, чтобы эффективность инкапсулирования или высокая степень включения, по меньшей мере, одного биологического активного соединения, были равны более чем 40%, 55%, более чем 60%, более чем 70%, более чем 80% активного средства.

Настоящее изобретение охватывает фармацевтические композиции, включающие высушенные способные к восстановлению везикулы, включающие везикулы, включающие лиофилизированный белок, и способы их получения с пренебрежимо малым или не поддающимся определению агрегированием или деградацией активного средства.

В предпочтительном воплощении, более чем 60%, 80%, 90%, 95% или примерно 100% регидратированных липосом MLV сохраняют или имеют следующее распределение по размеру: крупнее, чем 1 мкм, более предпочтительно между 1,0 мкм и 5 мкм, между 1,5 мкм и 5 мкм, между 1,0 мкм и 3 мкм, наиболее предпочтительно между 1,2 мкм и 2,5 мкм. Средние диаметры везикул могут быть определены с помощью электронно-микроскопического исследования, фотонно-корреляционной микроскопии, спектроскопии лазерного рассеяния, лазерной дифракции (например, MASTERSIZER™) или с помощью методик анализа частиц в режиме светотени (например, Accusizer™) или дополнительных способов, таких как описаны в издании Liposomes 2nd edition, A Practical Approach, edited by Vladimir P. Torchilin and Volkmar Weissig, Oxford University Press (2002), включенного в настоящий документ путем отсылок.

Предпочтительный способ представляет собой фотонно-корреляционную микроскопию.

Дополнительный аспект настоящего изобретения включает фармацевтическую лиофилизированную композицию, которая может быть получена с помощью способа изобретения, а также восстановленную фармацевтическую композицию, которая может быть получена с помощью способов, описанных в этом документе.

Многослойные липосомы, инкапсулирующие активные соединения, например, регенерирующие средства для кости и/или хряща, такое как CD/RAP, могут быть полезны в некоторых областях лечения, таких как регенерация хряща в случае костно-хрящевых нарушений, глубоких нарушений, частичных нарушений, артрита, такого как остеоартрит, ревматоидный артрит, псориатический артрит, юношеский хронический артрит, ризомелический псевдоартрит, ревматоидной полиартрит, синовит или виллонодулярный синовит, заболевания позвоночника, дегенеративное заболевание межпозвонковых дисков, растяжение сухожилия и/или связки, тендинит, разрывы мениска и/или повреждение передней крестообразной связки (ACL). Преимущество такой липосомной доставки активных соединений заключается в более эффективной, локализованной доставке к желаемым окружающим тканям. Липосомы могут быть сконструированы так, чтобы обеспечить депо с замедленным высвобождением в предназначенном месте и медленное освобождение инкапсулированного лекарственного средства.

Другое преимущество везикул MLV настоящего изобретения в отличие, например, от везикул SUV заключается в том, что в случае лечения остеоартрита путем инъекций в синовию, лекарственное средство, содержащееся в везикулах MLV, задерживается в месте нанесения благодаря крупным размерам частиц и медленному выходу инкапсулированного активного средства.

Таким образом, другой аспект изобретения представляет собой применение стерильной фармацевтической лиофилизированной композиции изобретения для производства фармацевтической композиции для лечения нарушений кости и/или хряща, иммунологического заболевания, предпочтительно, остеоартрита, ревматоидного артрита и заболевания позвоночника, такого как дегенеративное заболевание межпозвонковых дисков у субъекта, предпочтительно, с помощью однократной или многократных инъекций после регидратации лиофилизированной композиции водным раствором.

В предпочтительном воплощении заболевание позвоночника представляет собой идиопатическую боль в нижнем отделе спины, выпячивание межпозвонкового диска, разрушение межпозвонкового диска или трещины в дисках, радикулопатию, спинальный стеноз, воспаление седалищного нерва, индуцированное грыжей студенистого ядра, воспаление седалищного нерва, идиопатический сколиоз или миелопатию.

В предпочтительном воплощении, инъекция представляет собой местную или несистемную инъекцию, предпочтительно в синовию, в область синовии, в студенистое ядро, в область студенистого ядра, внутрь межпозвоночного диска или через межпозвоночный диск.

Схема дозировок может изменяться от нескольких раз в неделю до нескольких раз в месяц, с предпочтительным интервалом, равным не более чем раз в три дня. Общий период лечения, предпочтительно, равен, по меньшей мере, раз в неделю, более предпочтительно, по меньшей мере, раз в месяц.

Фармацевтическая композиция также может подходить для долговременного введения, по меньшей мере, на протяжении 3-х месяцев, по меньшей мере, на протяжении 6-ти месяцев, по меньшей мере, на протяжении 12-ти месяцев, вплоть до 18-ти месяцев, вплоть до 24-х месяцев или даже дольше.

Фармацевтическая композиция изобретения предпочтительно может быть введена с помощью однократного введения дозы, равной примерно от 0,25 мг вплоть до примерно 25 мг, в особенности, примерно от 0,5 мг до примерно 15 мг, и более предпочтительно примерно от 5 мг вплоть до 15 мг белка липосом.

Дополнительно, предпочтительные протокол лечения включает введение указанной фармацевтической композиции настоящего изобретения а) по меньшей мере, 1 раз, в особенности, от 1-го до 3-х раз на первой недели, затем следует интервал, продолжительностью от 1-й до 5-ти недель без введения, и, необязательно, 1 или несколько повторений протокола введения, b) один раз в неделю или один раз на протяжении нескольких последующих недель, или с) один раз в месяц или один раз на протяжении нескольких последующих месяцев, при этом месячная доза предпочтительно равна от примерно 1 мг вплоть до примерно 100 мг, в особенности, от примерно 2 мг до примерно 60 мг, и более предпочтительно от примерно 20 мг до вплоть до 50 мг белка липосом.

Стабильность липосом при хранении, по меньшей мере, равна три месяца, предпочтительно, по меньшей мере, 6 месяца, более предпочтительно, по меньшей мере, один год.

Все ссылки, раскрытые в этом документе, специфически включены путем отсылок в этот документ во всей полноте.

Поскольку предпочтительные воплощения проиллюстрированы и описаны, следует понимать, что специалистом со средним уровнем компетентности в этой области техники могут быть внесены изменения без отступления от изобретения в его широком аспекте, определенном формулой изобретения.

Изобретение дополнительно описано с помощью прилагаемых фигур и следующих примеров.

ФИГУРА 1 показывает морфологию липосом, полученных способом замораживания и оттаивания (А) в соответствии с примером 3, по сравнению со способом в соответствии с примером 1 изобретения (В).

ФИГУРА 2 иллюстрирует морфологию регидратированной липосомы, проанализированную с помощью световой микроскопии в двойном поляризованном свете.

ФИГУРА 3 показывает среднее распределение по размеру везикул MLV ± стандартное отклонение, полученных в соответствии с примером 6В, после восстановления в зависимости от количества примененного аскорбилпальмитата.

Примеры

Пример 1: Получение лиофилизированных восстановленных липосом (DRV) с помощью средства, способствующего слиянию

А: 750 мг фосфатидилхолина (Lipoid S100), 250 мг холестерина с 10 мг аскорбилпальмитата или без него растворяют в 20 мл этанола в круглодонной колбе. Растворитель количественно удаляют в роторном испарителе. Полученную тонкую липидную пленку регидратируют в 10 мл воды и с помощью мягкого перемешивания при комнатной температуре получают липосомы (10% (масс./объем) липида). Однослойные везикулы (SUV) с диаметром, равным приблизительно 100 нм, получают с помощью последующей обработки ультразвуком. 300 мкл SUV смешивают с 250 мкл раствора CD-RAP (3 мг/мл в 420 мМ аргинине/Н3РО4 рН 7,5) и лиофилизируют. Инкапсулирование происходит в процессе регидратации лиофилизированной лепешки 300 мкл дистиллированной воды и мягкого перемешивания на вортексе. Это дает более чем 40% эффективность инкапсулирования в везикулы MLV со средним диаметром, равным 1,5 мкм, без химических изменений включенного лекарственного средства, как определяют с помощью метода HPLC и иммуноферментного анализа (ELISA).

В: 111,4 г фосфатидилхолина (Lipoid S100), 37,1 г холестерина и 1,5 г аскорбилпальмитата растворяют в 800 мл трет-бутанола и получают молекулярно-дисперсную смесь. Растворитель удаляют количественно с помощью лиофилизации. С помощью гидратирования сухих липидов с помощью 1,5 л воды и энергичного взбалтывания образуются многослойные липосомы с диаметром, равным нескольким микрометрам. Липидную дисперсию гомогензируют, применяя гомогенизатор высокого давления и последующую экструзию через 100 нм мембрану, и получают монодисперсии небольших однослойных везикул (SUV). 3 мл SUV добавляют к 2,5 мл раствора CD-RAP (3 мг/мл в 420 мМ аргинина/H3PO4 рН 7,5) и лиофилизируют. Восстановление стабильной гомогенной лиофилизированной лепешки в 3-х мл дистиллированной воды и последующее встряхивание приводит к гомогенной дисперсии многослойных липосом (DRV) с диаметром, равным примерно 1,5 мкм, и эффективностью инкапсулирования, равной более чем 40%.

Пример 2: Получение везикул DRV с разными экспиентами, например, со средством, способствующим слиянию.

Проанализировали влияние разных экспиентов или добавок, например, средства, способствующего слиянию, на формирование высушенных восстановленных везикул (DRV), включающих гидрофильный белок, например, CD-RAP, применяемый для лечения различных заболеваний, таких как заболевания хряща и кости, например, остеоартрита, костно-хрящевых нарушений или дегенеративного заболевания межпозвонкового диска. Вместо аргинина/H3PO4 рН 7,5, примененного в качестве добавки и/или средства, способствующего слиянию, в соответствии с примером 1, тестируют несколько других добавок и/или буферных систем, результаты суммируют в таблице 1. Анализируют следующие параметры: распределение по размеру с помощью фотонно-корреляционной микроскопии (PCS), омолярность с помощью осмометра, стабильность белка методом HPLC, визуальное появление восстановленных везикул и эффективность инкапсулирования.

Таблица 1
Характеристика везикул DRV с разными средствами, способствующими слиянию
Добавки Стабильность белка Средний размер Дисперсия ЕЕ [%] Физиол. осмолярность
Трегалоза 5% (масс./объем) 4- - + nd +
Трегалоза 3% (масс./объем) / Маннитол 2% (масс./объем) + - + nd +
Трегалоза 2% (масс./объем) / Маннитол 3% (масс./объем) + - + nd +
Маннитол 5% (масс./объем) + - + nd +
PEG4000 5% (масс./объем) + + - nd +
Глицин 1,1% (масс./объем) - + + - +
Глицин 1,1% (масс./объем) 20 мМ KCl/150 мМ KH2PO4 + + - nd +
350 мМ Аргинин/H3PO4/ рН 7,5 - + + - +
350 мМ Гистидин/H3PO4/ рН 7,5 + + + + +
350 мМ b-лизин/H3PO4/ рН 7,5 + + + + +
Солевой раствор фосфатного буфера рН 7,4 - + + nd +

Стабильность белка, средний размер липосом, гомогенность дисперсии и эффективность инкапсулирования (ЕЕ) определяют после регидратация высушенных липосом, nd: не определяемый, параметры не были определены, при условии, что другие требования не были выполнены.

Трегалоза, маннитол и их смеси, примененные в качестве криопротекторных средств, стабилизируют как белок, так и мембрану липосом, и это приводит к образованию не подвергшихся влиянию небольших однослойных везикул вместо крупных везикул MLV. Другая композиция в качестве криопротекторного средства включает полиэтиленгликоль 4000, который оказался не в состоянии удовлетворить требованию гомогенности дисперсии после регидратации лиофилизированной лепешки до липосом. Применение солевого раствора фосфатного буфера, в качестве буферной системы с хорошо известным составом, добавление только уксусной кислоты рН 6,0 и рН 4,2 не может стабилизировать белок при высушивании, что приводит к сильному разрушению белка. Однако авторы изобретения обнаружили, что композиции, включающие аминокислоты, приводят к иным удивительным результатам. Глицин в качестве добавки требует добавления соли для поддержания стабильности белка, но приводит к восстановленной липосомной композиции в нефизиологической среде. Однако удивительно, что добавление основных аминокислот, таких как, но, не ограничиваясь, аргинин, гистидин и лизин удовлетворяет всем требованиям получения гомогенного липосомного раствора или дисперсии белка CD-RAP, инкапсулированного в крупные многослойные липосомы (>1,5 мкм) с высокой эффективностью инкапсулирования (>40%) без химических изменений белка в процессе.

Пример 3: Получение липосом методом «замораживания и оттаивания»

742 мг фосфатидилхолина (Lipoid S100), 248 мг холестерина и 10 мг аскорбилпальмитата растворяют в 20 мл этанола в круглодонной колбе. Растворитель количественно удаляют в роторном испарителе. Полученную тонкую липидную пленку регидратируют в 7,8 мл воды и с помощью мягкого перемешивания при комнатной температуре получают липосомы (12,8% (масс./объем) липида). С помощью последующей обработки ультразвуком получают однослойные везикулы (SUV) с диаметром, равным приблизительно 100 нм. 234,8 мкл раствора SUV смешивают с 65,2 мкл раствора CD-RAP (1,15 мг/мл в 420 мМ аргинин/H3PO4 рН 7,5). Липосомная дисперсии становится мелочно-белой после 3-х циклов замораживания и оттаивания (охлаждение в жидком N2 и последующее оттаивание при комнатной температуре) в результате слияния липидных мембран и образования липосом. Морфология липосом сохраняется при увеличении числа циклов замораживания и оттаивания, например, до 5. Продукт представляет собой вязкую молочно-белую суспензию с эффективностью инкапсулирования (измеренную в соответствии с примером 5 способа А), равной более чем 40%. Однако в отличие от везикул MLV, полученных в соответствии со способом настоящего изобретения, большинство липосом, образовавшиеся в результате применения способа замораживания и оттаивания, были только однослойными. Определение степени многослойности с помощью световой микроскопии в двойном поляризованном свете показало менее чем 5% мальтийских крестов (параметр, с помощью которого устанавливают многослойность липосом), тогда как получение липосом с помощью лиофилизации в соответствии с изобретением (например, пример 1) приводит к образованию >95% многослойных липосом (фигура 1). Образование однослойных липосом вместо везикул MLV при применении способа замораживания и оттаивания дополнительно подтверждено в литературе (Liposomes, A Practical Approach edited by R. R. C. New, IRL Press (1990), страница 58, последний параграф).

Пример 4: Липосомы, полученные путем восстановления липидного порошка

750 мг фосфатидилхолина (Lipoid S100), 250 мг холестерина и 10 мг аскорбилпальмитата растворяют в 20 мл этанола в круглодонной колбе. Растворитель количественно удаляют в роторном испарителе. Полученную тонкую липидную пленку регидратируют в 10 мл 200 мМ аргинина/H3PO4; рН 7,5, и с помощью мягкого перемешивания при комнатной температуре получают липосомы (10% (масс./объем) липида). Однослойные везикулы (SUV) с диаметром, равным приблизительно 100 нм, получают с помощью последующей обработки ультразвуком. 3000 мкл везикул SUV смешивают с 2500 мкл дистиллированной воды и лиофилизируют. Инкапсулирование происходит в процессе регидратации липидной лиофилизированной лепешки в 3000 мкл раствора CD-RAP (0,3 мг/мл в 150 мМ Arg/PO4 pH 7,5) и мягкого перемешивания на вортексе.

Созданные таким образом липосомы сравнивают с липосомами, полученными в соответствии с примером 1А. Эффективность инкапсулирования определяют в соответствии с примером 5А.

Удивительно, что гидратация лиофилизированных липидных лепешек раствором CD-RAP приводит к очень слабой эффективности инкапсулирования, равной 20%±4% CD-RAP (n=4), тогда как гидратация совместно лиофилизированного CD-RAP и липидов в соответствии с примером 1А приводит к 3-кратному увеличению эффективности инкапсулирования, равной 60%±10% (n=10).

Гомогенный плотный контакт как липидов, так и белка, который намереваются включить, наиболее существенен для высокой эффективности инкапсулирования, которую достигают с помощью совместной лиофилизации компонентов.

Пример 5: Определение эффективности инкапсулирования белка CD-RAP

Применяют три разных способа определения эффективности инкапсулирования белка CD-RAP в липосомы, полученные в соответствии с приведенными выше примерами. Способ А применяют для отделения с помощью центрифугирования CD-RAP, инкапсулированного внутри липосом, от неинкапсулированного CD-RAP. В способе В инкапсулирование определяют, применяя стадию диализа. Способ С представляет собой модифицированное определение с помощью центрифугирования/ультрафильтрации.

Способ А: Определение с помощью центрифугирования

100 мкл раствора регидратированных липосом разводят очень осторожно и медленно в 300 мкл воды для инъекций для получения разницы в плотности между липосомами. Более быстрое разбавление приводит к разрушению липосом и в дополнение к потере включенного белка. Стадия разведения необходима для создания разницы между липосомами и окружающим растворителем, что в свою очередь необходимо для успешного медленного перемешивания липосом. Разбавленный раствор липосом центрифугируют при комнатной температуре при 16000 rcf в течение 15 минут и получают значительное количество осадка и прозрачный супернатант. Супернатант осторожно удаляют, количество белка (= неинкапсулированный белок) определяют с помощью HPLC с обращенной фазой после разведения солевым фосфатным буферным раствором и 0,01% (объем/объем) Tween 80.

Осадок солюбилизируют в 300 мкл 20%-ного (масс./объем) раствора Triton X-100, а затем энергично встряхивают. Удивительно, но авторы изобретения обнаружили, что добавление поли-L-лизина, например, 50 мкл 2%-ного (масс./объем) раствора поли-L-лизина необходимо для диссоциации белка, связанного с липидами ионными взаимодействиями. После разведения в 550 мкл 50%-ного (объем/объем) ацетонитрила/0,1%-ной (объем/объем) трифторацетоуксусной кислоты концентрацию белка определяют с помощью HPLC с обращенной фазой.

Способ В: Определение с помощью диализа

1 мл восстановленных липосом переносят в рукав из нитроцеллюлозной мембраны. Затем раствор диализуют против 30 мл 350 мМ аргинина/H3PO4 рН 7,5/0,1% (масс./объем) бычьего сывороточного альбумина. Очистку раствора липосом завершают после 4 часов инкубации при 4°С и мягкого встряхивания. Количество неинкапсулированного белка, вышедшего при диализе в среду диализа, определяют прямо с помощью HPLC с обращенной фазой.

Способ С: Определение с помощью центрифугирования/ультрафильтрации

125 мкл раствора регидратированных липосом центрифугируют в пробирках для ультрафильтрации (Amicon Microcon Ultracel YM-100 units, Millipore, CAT. No.: 42413, мембраны пропускают соединения с молекулярной массой, равной 100000 Da) при 13200 rcf в течение 60 минут. Эта стадия приводит к отделению липосом от окружающего раствора. Количество неинкапсулированного ВМР-2 в фильтрате определяют путем измерения концентрация BMP-2 с помощью RP-HPLC, с помощью калибровочной кривой и учитывая объем профильтрованной жидкости.

Пример 6: Получение везикул DRV с применением различных липидов

Вместо фосфатидилхолина и холестерина, применяемых в качестве компонентов для получения липосом, протестировали несколько других липидов для полного замещения или частичного дополнения к липидной композиции.

А. Полностью насыщенные липиды

1 г полностью насыщенного соевого лецитина (LIPOID SPC-3) растворяют в 20 мл этанола, и после приготовления в соответствии с примером 1А получают раствор 10%-ных SUV. 300 мкл раствора SUV смешивают с 250 мкл раствора CD-RAP (0,3 мг/мл в 420 мМ Arg/PO4 рН 7,5) и лиофилизируют в стеклянном сосуде, получая очень стабильную лиофилизированную лепешку. После добавления 300 мкл дистиллированной воды происходит очень медленная регидратация лиофилизированной лепешки, не менее 20 минут, которая не отвечает требованию для изделия, которое может быть быстро введено с помощью инъекции.

В. Добавление отрицательно заряженных липидов

Липосомную композицию белка CD-RAP в везикулах DRV получают в соответствии с примером 1А, за исключением того, что в липидную композицию, состоящую из лецитина сои и холестерина, вводят отрицательно заряженные липиды.

1. Добавление кардиолипина

Кардиолипин в количестве, равном 0 мг, 5 мг, 10 мг, 15 мг, 25 мг и 100 мг, добавляют к 375 мг фосфатидилхолина (Lipoid S100) и 125 мг холестерина и затем растворяют в 10 мл этанола. Дальнейшие процедуры, например, получение SUV, приготовление композиции, сублимационная сушка, выполняют в соответствии с примером 1А. После регидратация липид/белковой лепешки в 0,3 мл дистиллированной воды и встряхивания, получают образцы многослойных везикул, содержащие 0-25 мг кардиолипина и демонстрирующие быстрое увеличение вязкости. Образец, содержавший 100 мг кардиолипина, получают в виде гелеподобного раствора с высокой вязкостью, содержащего только очень маленькие везикулы (400 нм, измерено с помощью фотонно-корреляционной микроскопии).

Диаметр липосом, определенный методом фотонно-корреляционной микроскопии, увеличивался, начиная со среднего диаметра, равного 1500 нм, до конечного, равного 2500 нм, при добавлении 25 мг кардиолипина.

2. Добавление аскорбилпальмитата

Аскорбилпальмитат, добавленный в количестве, равном 0 мг, 2,5 мг, 5 мг, 10 мг, 25 мг, 50 мг и от 100 мг до 750 мг фосфатидилхолина (Lipoid S100), и 250 мг холестерина, растворяют в 20 мл этанола. Дальнейшие процедуры, например, получение SUV, приготовление композиции, сублимационную сушку, проводят в соответствии с примером 1А. После регидратация липид/белковой лепешки в 0,3 мл дистиллированной воды и встряхивания многослойные везикулы получают только в образцах, содержащих 0-50 мг аскорбилпальмитата, что указывает на быстрое увеличение вязкости в результате добавления кардиолипина. Образец, содержащий 100 мг аскорбилпальмитата, превращался в гелеподобный раствор с очень высокой вязкостью.

Однако удивительно, что многослойные липосомы демонстрируют сильную тенденцию к агломерации при высоких количествах, например, 1% или более, аскорбилпальмитата (фиг.2), и имеют более крупные диаметры (фиг.3) при увеличении количества аскорбилпальмитата после регидратация в отличие от того, что описано в литературе (Liposomes 2nd edition, A Practical Approach, edited by Vladimir P. Torchilin and Volkmar Weissig, Oxford University Press (2002), страница 7), включенной в настоящий документ путем отсылок.

Пример 7: Инкапсулирование rhBMP-2в восстановленные везикулы DRV

Лиофилизированные липосомы получают в соответствии с примером 1А, применяя 750 мг фосфатидилхолина (Lipoid S100) и 250 мг холестерина. 300 мкл везикул SUV смешивают с 250 мкл раствора rh-BMP-2 (0,50 мг/мл в 420 мМ аргинина/H3PO4 рН 7,5 и 5,0) и затем лиофилизируют. Применяют два различных препарата rh-BMP-2, rhBMP-2, полученный из E.coli (Ruppert, R. et al. (1996) Human bone morphogenetic protein 2 contains a heparin-binding site which modifies its biological activity. Eur.J Biochem. 237: 295-302) и rhBMP-2, полученный из СНО (InductOs, Wyeth Pharma GmbH). Регидратация в 300 мкл приводит к эффективности инкапсулирования, равной более чем 80%, в везикулы MLV с диаметром, равным примерно 1,5 мкм. Эффективность инкапсулирования определяют в соответствии со способом С - центрифугирования/ультрафильтрации. Все измерения проводят в двойном повторе. Результаты показаны в таблице 2.

Таблица 2
Материальный баланс инкапсулирования белка rhBMP-2 в липосомы в аргинине/H3PO4 при различных значениях рН
Вариант не инкапсулирован инкапсулирован
rhBMP-2, негликозилированный, рН 7,4 18% 82%
rhBMP-2, негликозилированный, рН 5,0 17% 83%

Пример 8: Модель с рассечением передней крестообразной связки кролика

Для того чтобы оценить снимает ли или предупреждает ли MIA/CD-RAP деградацию хряща в моделе остеоартрита у животных, применяют модель с рассечением передней крестообразной связки кролика. Под общим наркозом и в стерильных условиях получают доступ к коленному суставу кроликов через медиальный парапателлярный разрез (между медиальной коллатеральной связкой и связкой надколенника). Надколенник смешают латерально, поднадколенное жировое тело мобилизуют и оттягивают, открывая неповрежденную переднюю крестообразную связку. Разрез зашивают послойно и после наложения слов накладывают пластырную повязку. Внутрисуставную инъекцию проводят под контролем с помощью рентгеноскопии и под воздействием седативного средства. Хирургическое вмешательство и режим введения инъекций были следующими: в каждой группе было по 6 животных (группа 1: симуляция (ACL не рассекали), группа 2: липосомы, группа 3: липосомы плюс низкая доза MIA/CD-RAP, группа 4: липосомы плюс средняя доза MIA/CD-RAP, группа 5: липосомы плюс высокая доза MIA/CD-RAP, n=30). Животным, за исключение животных из группы симуляции, вводят по 5 инъекций. Инъекции проводят каждые 10 дней. Животных забивают через 10 дней после последней инъекции и получают рентгеновские снимки.

Затем, образцы фиксируют в 10%-ном нейтральном формалине в буферном растворе, декальцифицируют в EDTA и заливают в парафин. Срезы окрашивают сафранином О быстрым зеленым и гематоксилином и эозином и анализируют гистологическими способами.

В этой модели многослойные липосомы, доставляющие CD-RAP, снижают разрушение хряща и прогрессирование заболевания. Гистологический анализ показал эффективность инъекции белка CD-RAP, инкапсулированного в липосомы во внутрисуставное пространство в средней дозе и в высокой дозе CD-RAP, которая снизила развитие ОА (р<0,05). Доставка CD-RAP в средней дозе, похоже, представляет наиболее мощное воздействие для предотвращения развития ОА, как показано с помощью измерения интенсивности окрашивания сафранина О, которая сохранялась в группе средней дозы по сравнению с группой симуляции (р<0,05). Рентгенологический анализ показал предотвращение прогрессирования ОА во всех группах, обработанных CD-RAP в низкой, средней и высокой дозе (р<0,05).

Пример 9: Модель прокола фиброзного кольца

В этом примере инъекция белка CD-RAP была эффективна для частичного восстановления высоты диска в модели кольцевой пунктуры кролика.

Деформация диска может быть индуцирована у молодых новозеландских белых кроликов с помощью прокола фиброзного кольца в диск, с помощью игл определенных калибров (Singh, К. et al. (2005) Animal models for human disc degeneration. Spine J 5: 267S-279S). После обеспечения местного обезболивания с помощью инъекции лидокаина в дорзальную область диска получают латеральные обзорные рентгенограммы для определения значений базовых линий высоты IVD до инъекции. Затем кроликов укладывают в лежачее положение на боку и применяют заднебоковой ретроперитонеальный доступ для открытия поясничных IVD. У каждого кролика прокалывают AF с помощью иглы колибра 18G. Через четыре недели животное получает инъекцию солевого буферного раствора (в PBS) или липосом-носителей в качестве контроля или раствор белка, 2,5 мг/мл CD-RAP (в PBS) или CD/RAP, инкапсулированного в липосомы (2,5 мг/мл), в студенистое ядро и так продолжают в течение 12-ти недель. Доклинический результат анализируют с помощью обследований поясничного отдела позвоночника, проводимых методом магнитно-резонансной томографии (MRI), определения высоты IVD, которое проводят с помощью рентгенологического наблюдения, результаты которого обрабатывают с помощью компьютерной программы с применением программного обеспечения обработки изображений и рассчитывают % DHI (DHI после операции/DHI до операции × 100). Для гистологического анализа IVD срезы прокрашивают гематоксилином-эозином и сафранином О. Разницу между группами оценивают на статистическую значимость, применяя однофакторный дисперсионный анализ (ANOVA).

Каждый кролик имеет один диск, обработанный белком CD-RAP в солевом растворе, другой - обработанный солевым раствором или липосомами или белком CD-RAP, инкапсулированным в липосомы.

1. Высушенная фармацевтическая композиция, включающая лиофилизированное активное средство, включающая везикулы, включающая
a) по меньшей мере, один липид,
b) по меньшей мере, одно активное средство, которое является белком или его активным фрагментом,
c) средство, способствующее слиянию, где средство, способствующее слиянию, является щелочной аминокислотой, выбранной из аргинина, гистидина, лизина или цитруллина, и
d) не включающая средство, стабилизирующее мембрану,
где регидратация высушенной фармацевтической композиции водным раствором приводит к образованию многослойных липосом, имеющих средний диаметр липосомы, равный более чем 1 мкм, эти липосомы инкапсулируют активное средство.

2. Высушенная фармацевтическая композиция по п.1, в которой, по меньшей мере, одно активное средство представляет собой гидрофильный белок или его активный фрагмент.

3. Высушенная фармацевтическая композиция по п.1, в которой белок включает CD-RAP (MIA), BMP-2, BMP-7, BMP-12, BMP-13, GDF-6 (MP-52), TGF-beta1, TGF-beta2, TGF-beta3, TGF-alpha или их активные фрагменты или их комбинации.

4. Высушенная фармацевтическая композиция по п.1, в которой не присутствует ни защитный сахар, ни сахарный спирт или ни гликозид.

5. Высушенная фармацевтическая композиция по п.1, дополнительно включающая неорганический или органический анион, в особенности выбранный из сукцината, фумарата, цитрата, малата, фосфата, ацетата и хлорида.

6. Высушенная фармацевтическая композиция по п.2, в которой гидрофильный белок представляет собой регенерирующее средство для кости и/или хряща.

7. Способ получения высушенной липосомной композиции по п.1, в котором после регидратации водным раствором образуются многослойные липосомы со средним диаметром липосомы более чем 1 мкм, инкапсулирующие активное средство, включающий стадии
a) гидратации липида, липидной смеси или липидной пленки в отсутствии органического растворителя,
b) образования небольших однослойных везикул, предпочтительно со средним диаметром от 50 до 200 нм,
c) добавления водного раствора активного средства,
d) после, до или вместе со стадией с), добавление средства, способствующего слиянию, где средство, способствующее слиянию представляет собой щелочную аминокислоту, выбранную из аргинина, гистидина, лизина или цитруллина, и необязательно неорганического или органического аниона, и
e) дегидратации указанной липидной дисперсии без добавления средства, стабилизирующего мембрану.

8. Способ по п.7, в котором стадию стерильной фильтрации дополнительно проводят после стадии b) и/или стадии с).

9. Способ по п.7, в котором липид включает, по меньшей мере, один нейтральный липид, предпочтительно, по меньшей мере, два нейтральных липида, более предпочтительно фосфатидилхолин (PC) и холестерин (Chol).

10. Способ по п.7, в котором белок включает CD-RAP (MIA), BMP-2, BMP-7, BMP-12, BMP-13, GDF-6 (MP-52), TGF-beta1, TGF-beta2, TGF-beta3, TGF-alpha или их активные фрагменты или их комбинации.

11. Способ по п.7, в котором неорганический или органический анион выбирают из группы сукцината, фумарата, цитрата, малата, фосфата, ацетата и хлорида.

12. Способ по п.7, в котором формирование получаемых многослойных липосом происходит в процессе регидратации лиофилизированной липосомной композиции.

13. Способ по п.7, в котором активное средство представляет собой гидрофильный белок или его фрагмент.

14. Способ по п.13, в котором активное средство представляет собой регенерирующее средство для кости и/или хряща, предпочтительно CD-RAP или его активный фрагмент.

15. Способ по п.7, в котором эффективность инкапсулирования активного средства равна более чем 40%.

16. Способ получения пригодной для введения липосомной композиции, включающей многослойные липосомы со средним диаметром липосомы, равным более чем 1 мкм, инкапсулирующие активное средство, включающий стадии
а) гидратации липида, липидной смеси или липидной пленки в отсутствии органического растворителя,
f) образования небольших однослойных везикул, предпочтительно со средним диаметром от 50 до 200 нм,
g) добавления водного раствора активного средства, которое представляет собой белок или его активный фрагмент,
h) после, до или вместе со стадией с, добавления средства, способствующего слиянию, где средство, способствующее слиянию, представляет собой щелочную аминокислоту, выбранную из аргинина, гистидина, лизина или цитруллина, и необязательно неорганический или органический анион, и
i) дегидратации указанной липидной дисперсии без добавления средства, стабилизирующего мембрану, с образованием посредством этого фармацевтической композиции по п.1,
j) регидратации водным раствором и образования многослойных везикул, имеющих средний диаметр липосомы, равный более чем 1 мкм, инкапсулирующих активное средство,
где стадию стерильной фильтрации проводят после стадии b) и/или с).

17. Способ по п.16, в котором липид включает, по меньшей мере, один нейтральный липид, предпочтительно, по меньшей мере, два нейтральных липида, более предпочтительно фосфатидилхолин (PC) и холестерин (Chol).

18. Способ по п.16, в котором белок включает CD-RAP (MIA), ВМР-2, BMP-7, BMP-12, BMP-13, GDF-6 (MP-52), TGF-beta1, TGF-beta2, TGF-beta3, TGF-alpha или их активные фрагменты или их комбинации.

19. Способ по п.16, в котором неорганический или органический анион выбирают из группы сукцината, фумарата, цитрата, малата, фосфата, ацетата и хлорида.

20. Способ по п.16, в котором формирование получаемых многослойных липосом происходит в процессе регидратации лиофилизированной липосомной композиции.

21. Способ по п.16, в котором активное средство представляет собой гидрофильный белок или его фрагмент.

22. Способ по п.21, в котором активное средство представляет собой регенерирующее средство для кости и/или хряща, предпочтительно CD-RAP или его активный фрагмент.

23. Способ по п.16, в котором эффективность инкапсулирования активного средства равна более чем 40%.

24. Фармацевтическая лиофилизированная композиция, получаемая способом по п.7.

25. Фармацевтическая лиофилизированная композиция, получаемая способом по п.16.

26. Применение фармацевтической лиофилизированной композиции по п.1, для производства фармацевтической композиции для лечения нарушений кости и/или хряща, иммунологического заболевания, предпочтительно остеоартрита, ревматоидного артрита и заболеваний позвоночника у объекта инъекцией после регидратации водным раствором лиофилизированной композиции.

27. Применение фармацевтической лиофилизированной композиции по п.26, в котором инъекция представляет собой локальную или несистемную инъекцию, предпочтительно в синовию, околосиновиальное пространство, студенистое ядро, пространство вокруг студенистого ядра, междискально или трансдискально.

28. Применение фармацевтической лиофилизированной композиции по п.26 или 27, в котором инъекцию проводят, по меньшей мере, один раз в неделю.



 

Похожие патенты:

Изобретение относится к соединению формулы I и его пролекарству, представляющему собой 2-(5-(2-((3-(3-трет-бутил-1-п-толил-1Н-пиразол-5-ил)уреидо)метил)-4-фторфенокси)-1 Н-индазол-1-ил)этилдигидрофосфат, а также к их фармацевтически приемлемым солям и фармацевтическим композициям на их основе.

Изобретение относится к области медицины и фармации, а именно к созданию фармацевтической композиции в виде суспензии для профилактики и лечения нарушений физиологической и репаративной регенерации тканей опорно-двигательной системы - костной ткани и суставного хряща, в частности для лечения остеопороза.

Изобретение относится к соединениям общей формулы (I), где R1 представляет собой СН3; R 2 представляет собой галогено или CN; R3 представляет собой H или CH3; R4 представляет собой H или CH3; n представляет собой 0, 1 или 2; и к их фармацевтически приемлемым солям.

Изобретение относится к соединениям, отвечающим формуле в которой X представляет собой одну из следующих групп: - фенильную группу, необязательно замещенную одной или несколькими группами, независимо выбранными из следующих атомов или групп: галогена, (С1-С6)алкокси, (С1-С6)алкила, (С3-С7 )циклоалкил(С1-С6)алкила, (С3 -С7)циклоалкил(С1-С6)алкокси, NRaRb, R1 представляет собой атом водорода, галоген, (С1-С6)алкокси, (С1-С6 )алкил, (С3-С7)циклоалкил(С1- С6)алкил, (С3-С7)циклоалкил(С 1-С6)алкокси, амино, группу NRcRd; причем алкильные и алкоксигруппы могут быть необязательно замещены одним или несколькими галогенами, гидрокси, амино или (С1-С6)алкокси, R2 представляет собой одну из следующих групп: атом водорода, (С1-С6)алкильиую группу, необязательно замещенную одной или несколькими группами, независимо выбранными из гидрокси, галогена, амино, группы NRaRb, фенильной группы, - (С1-С6)алкоксигруппу, необязательно замещенную одной или несколькими группами, независимо выбранными из гидрокси, галогена, амино, группы NRaRb, - (С2-С7 )циклоалкил(С1-С6)алкил, - (С3 -С7)циклоалкил(С1-С6)алкокси, - (С2-С6)алкенил, - (С1-С 6)алкинил, - группу -CO-R5, - группу -CO-NR 6R7, - группу -СО-О-R8, - группу -NR9-CO-R10, - группу -NR11R 12, - атом галогена, - цианогруппу, - фенильную группу, необязательно замещенную одной или несколькими группами, независимо выбранными из следующих атомов или групп: галогена, (С1- С6)алкокси, NRaRb, -CO-R5, -CO-NR6 R7, -CO-O-R8, (С3-С7 )циклоалкил(С1-С6)алкила, (С3 -С7)циклоалкил(С1-С6)алкокси, (С1-С6)алкильной группы, необязательно замещенной одной или несколькими гидроксигруппами или NRaRb, R3 представляет собой атом водорода, (С1 -С6)алкил, (C1-С6)алкокси или атом галогена, R4 представляет собой атом водорода, (С1-С4)алкил, (С1-С4 )алкокси или атом фтора, R5 представляет собой атом водорода, фенильную группу или (С1-С6)алкил, R6 и R7, одинаковые или различные, представляют собой атом водорода или (С1-С6)алкил, или вместе с атомом азота образуют 4-7-членный цикл, необязательно включающий другой гетероатом, выбранный из N, О или S, R 8 представляет собой (С1-С6)алкил, R9 и R10, одинаковые или различные, представляют собой атом водорода или (С1-С6)алкил, R 11 и R12, одинаковые или различные, представляют собой (С1-С6)алкил, или вместе с атомом азота образуют 4-7-членный цикл, необязательно включающий другой гетероатом, выбранный из N, О или S, Ra и Rb независимо друг от друга представляют собой атом водорода, (С1-С 6)алкил или вместе с атомом азота образуют 4-7-членный цикл, Rc представляет собой атом водорода, и Rd представляет собой (С1-С6)алкил и, по меньшей мере, один из заместителей R1, R2, R3 и R4 отличен от водорода; и когда R3 означает метил, X является незамещенным; когда R1 означает метил, X является незамещенным; когда R2 означает хлор, X не является парафторфенилом; в форме основания или соли присоединения кислоты.

Изобретение относится к соединению формулы (I): его фармацевтически приемлемой соли или сольвату, которые обладают свойствами ингибитора Syk киназы. .
Изобретение относится к медицине, а именно к стоматологии, и касается лечения артроза височно-нижнечелюстного сустава. .
Изобретение относится к медицине, в частности к иммунологии, а именно к средствам иммунокоррекции, и может быть использовано в качестве индуктора гранулоцитарно-макрофагального колониестимулирующего фактора в клетках системы мононуклеарных фагоцитов in vitro и для эфферентной терапии при патологических состояниях, сопровождающихся снижением клеточного иммунитета.

Изобретение относится к области медицины, а именно фармацевтике. .

Изобретение относится к химико-фармацевтической промышленности и касается способов получения высокодисперсных липосомальных препаратов для профилактики и лечения заболеваний человека и животных.

Изобретение относится к транспортирующему наполнителю для введения биологически активных соединений, содержащему один или более C1-C4спиртов, воду и комбинацию одного или более дифосфатных производных агентов электронного переноса и одного или более монофосфатных производных агентов электронного переноса.

Изобретение относится к области фармацевтики, а именно к способу получения липосомальной формы изониазида (ИН) для лечения туберкулеза. .
Изобретение относится к медицине, а именно к дерматовенерологии, и может быть использовано для лечения хронических гонорейных уретритов и гонорейно-бактериальных уретритов.
Изобретение относится к фармацевтической промышленности, в частности для лечения псориаза. .
Изобретение относится к биологии и медицине и касается средства, усиливающего мобилизацию стволовых клеток. .

Изобретение относится к фармакологии и представляет собой высушенную фармацевтическую композицию, включающую лиофилизированное активное средство, включающее везикулы, включающие: а) по меньшей мере, один липид, b) по меньшей мере, одно активное средство, которое является белком или его активным фрагментом, с) средство, способствующее слиянию, где средство, способствующее слиянию, является щелочной аминокислотой, выбранной из аргинина, гистидина, лизина или цитруллина, и d) не включающая средство, стабилизирующее мембрану, где регидратация высушенной фармацевтической композиции водным раствором приводит к образованию многослойных липосом, имеющих средний диаметр липосомы, равный более чем 1 мкм, эти липосомы инкапсулируют активное средство

Наверх