Гуманизированные антитела к фактору d и их применения

Предложенное изобретение относится к области иммунологии. Описаны варианты гуманизированных моноклональных антител к фактору D или их функциональные фрагменты. Предложены: кодирующая нуклеиновая кислота, вектор экспрессии, а также клетка для получения антитела, содержащая вектор. Описан способ получения антитела к фактору D путем культивирования клетки и очистки экспрессируемого антитела. Кроме того, предлагаются: композиция на основе антител и применение антител для лечения нарушений, опосредованных системой комплемента. Использование изобретения может найти применение в медицине для лечения заболеваний, связанных с избыточной или неконтролируемой активацией системы комплемента. 18 н. и 14 з.п. ф-лы, 9 ил., 4 табл., 6 пр.

 

Уровень техники

Система комплемента играет центральную роль в процессах клиренса иммунных комплексов и иммунного ответа на инфекционные агенты, чужеродные агенты, инфицированные вирусом клетки и опухолевые клетки. Однако комплемент также вовлечен в патологическое воспаление и в аутоиммунные заболевания. Таким образом, ингибирование избыточной или неконтролируемой активации каскада комплемента могло бы принести клиническую пользу пациентам с такими заболеваниями и состояниями.

Система комплемента охватывает два отдельных пути активации, называемых классическим и альтернативным путями (V.M. Holers, In Clinical Immunology: Principles and Practice, ed. R.R. Rich, Mosby Press; 1996, 363-391). Классический путь представляет собой кальций/магнийзависимый каскад, который обычно активируется за счет образования комплексов антиген - антитело. Альтернативный путь представляет собой магнийзависимый каскад, который активируется путем депонирования и активации C3 на определенных чувствительных поверхностях (например, на полисахаридах клеточной стенки дрожжей и бактерий и на определенных биополимерных материалах). Активация пути комплемента генерирует биологически активные фрагменты белков комплемента, например, анафилатоксинов C3a, C4a и C5a и мембраноатакующих комплексов C5b-9 (MAC), которые опосредуют активности воспаления, включающие хемотаксис лейкоцитов, активацию макрофагов, нейтрофилов, тромбоцитов, тучных клеток и эндотелиальных клеток, проницаемость сосудов, цитолиз и повреждение тканей.

Фактор D представляет собой высокоспецифичную сериновую протеазу, необходимую для активации альтернативного пути комплемента. Она расщепляет фактор B, связанный с C3b, генерируя фермент C3b/Bb, который является активным компонентом конвертаз C3/C5 альтернативного пути. Фактор D может представлять собой подходящую мишень для ингибирования, поскольку его концентрация в плазме людей является очень низкой (1,8 мкг/мл), и было показано, что он является ограничивающим ферментом для активации альтернативного пути комплемента (P.H. Lesavre and H.J. Müller-Eberhard. J. Exp. Med., 1978; 148: 1498-1510; J.E. Volanakis et al., New Eng. J. Med., 1985; 312: 395-401).

Было продемонстрировано на животных-моделях и в исследованиях ex vivo, что подавление (даун-регуляция) активации системы комплемента является эффективным при лечении некоторых симптомов заболеваний, например, при системной красной волчанке и гломерулонефрите (Y. Wang et al., Proc. Natl. Acad. Sci.; 1996, 93: 8563-8568), ревматоидном артрите (Y. Wang et al., Proc. Natl. Acad. Sci., 1995; 92: 8955-8959), искусственном кровообращении и гемодиализе (C.S. Rinder, J. Clin. Invest, 1995; 96: 1564-1572), сверхостром отторжении при трансплантации органов (T.J. Kroshus et al., Transplantation, 1995; 60: 1194-1202), инфаркте миокарда (J.W. Homeister et al., J. Immunol., 1993; 150: 1055-1064; H.F. Weisman et al., Science, 1990; 249: 146-151 ), реперфузионном повреждении (E.A. Amsterdam et al., Am. J. Physiol., 1995; 268: H448-H457) и при синдроме нарушения дыхания у взрослых (R. Rabinovici et al., J. Immunol., 1992; 149: 1744-1750). Кроме того, другие воспалительные состояния и заболевания аутоиммунного/иммунного комплекса также тесно ассоциированы с активацией системы комплемента (V.M. Holers, ibid., B.P. Morgan. Eur. J. Clin. Invest, 1994: 24: 219-228), включая термическое повреждение, тяжелое астматическое состояние, анафилактический шок, воспаление кишечника, крапивницу, агниоэдему, васкулит, рассеянный склероз, миастению гравис, мембранопролиферативный гломерулонефрит и синдром Шегрена.

Существует потребность в терапии с помощью антител в области нарушений, опосредованных системой комплемента, и гуманизированные антитела по настоящему изобретению представляют собой высокоаффинные антитела, используемые для удовлетворения этой потребности.

Сущность изобретения

Настоящее изобретение относится, в основном, к антителам, включающим последовательности вариабельных доменов тяжелой цепи и легкой цепи мышиного антитела 166-32, которое представляет собой антитело, способное к ингибированию биологических активностей, ассоциированных с фактором D. Например, можно наблюдать существенное ингибирование активности альтернативного пути комплемента при концентрации, составляющей 18 мкг/мл (эквивалентно примерно превышению в 1,5 раза молярной концентрации фактора D в крови; молярное соотношение антитела к фактору D и фактора D составляет примерно 1,5:1)(см., например, патент США №6956107).

Настоящее изобретение также относится к гуманизированным антителам мышиного антитела MAb 166-32. Изобретение включает аминокислотные последовательности вариабельных участков тяжелой и легкой цепи антител и их соответствующие нуклеотидные последовательности. Другой вариант осуществления изобретения включает последовательности CDR этих антител.

Другой вариант осуществления настоящего изобретения включает композиции, включающие антитело по изобретению. В другом варианте осуществления изобретение представляет клеточные линии и векторы, несущие последовательности антител по настоящему изобретению. В одном аспекте изобретение включает способ получения антител и композиций по изобретению.

Другим вариантом осуществления настоящего изобретения является применение этих гуманизированных антител для получения лекарственного средства или композиции для лечения нарушений, ассоциированных с избыточной или неконтролируемой активацией системы комплемента. Они включают активацию системы комплемента во время операций искусственного кровообращения; активацию системы комплемента по причине ишемии-реперфузии после острого инфаркта миокарда, аневризмы, инсульта, геморрагического шока, повреждения с размозжением тканей, полиорганной недостаточности, гиповолемического шока, кишечной ишемии или других событий, вызывающих ишемию. Также было показано, что активация системы комплемента ассоциирована с воспалительными состояниями, такими как тяжелые ожоги, эндотоксемия, септический шок, синдром нарушения дыхания у взрослых, гемодиализ; анафилактический шок, тяжелое астматическое состояние, ангиоэдема, болезнь Крона, серповидно-клеточная анемия, постстрептококковый гломерулонефрит и панкреатит. Нарушение может быть результатом побочного действия лекарственного средства, аллергии на лекарственное средство, индуцированного с помощью IL-2 синдрома просачивания из сосудов или аллергии на рентгеноконтрастные средства. Нарушение также включает аутоиммунное заболевание, такое как системная красная волчанка, миастения гравис, ревматоидный артрит, болезнь Альцгеймера и рассеянный склероз. Активация системы комплемента также ассоциирована с отторжением трансплантата. Активация системы комплемента также ассоциирована с глазными заболеваниями, такими как возрастная дегенерация желтого пятна, диабетическая ретинопатия.

Краткое описание фигур

На фиг.1А и 1В изображена аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела MAb 166-32 (фиг.1А) и вариабельного участка легкой цепи (фиг.1В).

На фиг.2А и 2В изображена нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела MAb 166-32 (фиг.2А) и вариабельного участка легкой цепи (фиг.2В).

На фиг.3 изображено сравнение тяжелой цепи мышиного антитела MAb 166-32.

На фиг.4 изображено сравнение легкой цепи мышиного антитела MAb 166-32.

На фиг.5 изображены аминокислотные последовательности вариабельного участка тяжелой цепи и вариабельного участка легкой цепи для каждого клона #56, #111, #250 и #416 гуманизированного антитела.

На фиг.6 изображены результаты гемолитического анализа для клонов #56, #111, #250 и #416 гуманизированного антитела Fab.

На фиг.7 изображено ингибирование активности альтернативного пути комплемента с помощью клонов #56, #111, #250 и #416 гуманизированного антитела Fab.

На фиг.8A-B (консенсусные каркасные участки вариабельных участков тяжелой цепи (VH)) и фиг.9A-B (консенсусные каркасные участки вариабельных участков легкой цепи (VL)) изображены характерные акцепторные человеческие консенсусные каркасные последовательности, которые могут быть использованы в практическом применении настоящего изобретения со следующими признаками последовательностей: (фиг.8A-B) подгруппа I человеческих консенсусных каркасных последовательностей VH в отсутствие CDR-участков по Kabat (SEQ ID NO: 28), подгруппа I человеческих консенсусных каркасных последовательностей VH в отсутствие протяженных гипервариабельных участков (SEQ ID NO: 29-31), подгруппа II человеческих консенсусных каркасных последовательностей VH в отсутствие CDR-участков по Kabat (SEQ ID NO: 32), подгруппа II человеческих консенсусных каркасных последовательностей VH в отсутствие протяженных гипервариабельных участков (SEQ ID NO: 33-35), подгруппа III человеческих консенсусных каркасных последовательностей VH в отсутствие CDR-участков по Kabat (SEQ ID NO: 36), подгруппа III человеческих консенсусных каркасных последовательностей VH в отсутствие протяженных гипервариабельных участков (SEQ ID NO: 37-39), подгруппа VII человеческих консенсусных каркасных последовательностей VH в отсутствие CDR-участков по Kabat (SEQ ID NO: 55), подгруппа VII человеческих консенсусных каркасных последовательностей VH в отсутствие протяженных гипервариабельных участков (SEQ ID NO: 56-58), подгруппа человеческого акцепторного каркасного участка VH в отсутствие CDR-участков по Kabat (SEQ ID NO: 40), подгруппа человеческого акцепторного каркасного участка VH в отсутствие протяженных гипервариабельных участков (SEQ ID NO: 41-42), подгруппа 2 человеческого акцепторного каркасного участка VH в отсутствие CDR-участков по Kabat (SEQ ID NO: 43) и подгруппа 2 человеческого акцепторного каркасного участка VH в отсутствие протяженных гипервариабельных участков (SEQ ID NO: 44-46) и (Фиг.9А-В) подгруппа I человеческого консенсусного каркасного участка цепи VL каппа (SEQ ID NO: 47), подгруппа II человеческого консенсусного каркасного участка цепи VL каппа (SEQ ID NO: 48), подгруппа III человеческого консенсусного каркасного участка цепи каппа (SEQ ID NO: 49) и подгруппа IV человеческого консенсусного каркасного участка цепи каппа (SEQ ID NO: 50).

Подробное описание изобретения

Определения

Термины, используемые по всему тексту заявки, следует истолковывать с помощью обычного и типичного значения для специалистов в данной области. Однако авторам настоящего изобретения желательно, чтобы следующим терминам были даны конкретные определения, как определено ниже.

Фраза "по существу идентичный" по отношению к полипептидной последовательности цепи антитела может быть истолкована как цепь антитела, идентичная эталонной полипептидной последовательности, по меньшей мере, на 70% или на 80% или на 90% или на 95%. Термин «по отношению к нуклеотидной последовательности» может быть истолкован как последовательность нуклеотидов, идентичная эталонной нуклеотидной последовательности, по меньшей мере, примерно на 85% или на 90%, или на 95%, или на 97%.

Термин "идентичность" или "гомология" следует истолковывать как обозначение процента аминокислотных остатков в кандидатной последовательности, которые идентичны остатку соответствующей последовательности, с которой ее сравнивают, после выравнивания последовательностей и введения пробелов, если необходимо, для достижения максимального процента идентичности с цельной последовательностью, и не рассматривая никаких консервативных замен в виде части идентичности последовательности. Ни N-концевые, ни C-концевые удлинения, ни вставки не следует истолковывать как уменьшающие идентичность или гомологию. Методы и компьютерные программы для выравнивания хорошо известны в данной области. Идентичность последовательности может быть измерена с использованием пакета программного обеспечения для анализа последовательностей.

Термин "антитело" используется в широком смысле и, конкретно, охватывает моноклональные антитела (включая полноразмерные моноклональные антитела), поликлональные антитела и мультиспецифичные антитела (например, биспецифичные антитела). Антитела (Ab) и иммуноглобулины (Ig) представляют собой гликопротеины, обладающие одинаковыми структурными характеристиками. В то время как антитела демонстрируют специфичность связывания со специфичной мишенью, иммуноглобулины включают как антитела, так и другие антитело-подобные молекулы, которые лишены специфичности к мишени. Нативные антитела и иммуноглобулины обычно представляют собой гетеротетрамерные гликопротеины молекулярной массы, составляющей примерно 150000 дальтон, состоящие из двух идентичных легких (L) цепей и двух идентичных тяжелых (H) цепей. Каждая тяжелая цепь содержит на одном конце вариабельный домен (VH), за которым следуют константные домены. Каждая легкая цепь содержит на одном конце вариабельный домен (VL) и константные домены на ее другом конце.

Как используется в данном описании, термин "антитело к фактору D человека" обозначает антитело, которое специфично связывается с фактором D человека таким образом, чтобы ингибировать или по существу уменьшать активацию системы комплемента.

Термин "вариабельный" в контексте вариабельного домена антител означает тот факт, что определенные участки вариабельных доменов существенно отличаются среди антител по последовательности и используются при связывании и определении специфичности каждого конкретного антитела для его конкретной мишени. Однако вариабельность не распределена равномерно по вариабельным доменам антител. Она концентрируется в трех сегментах, называемых участками, определяющими комплементарность (CDR), также известными как гипервариабельные участки (HVR) в вариабельных доменах как легкой цепи, так и тяжелой цепи. Более высококонсервативные участки называют каркасными участками (FR). Каждый из вариабельных доменов нативных тяжелых и легких цепей включает четыре FR-участка, по большей части принимающих конфигурацию β-листа, связанных тремя участками CDR, которые образуют петли, связывающие и, в некоторых случаях, образующие часть структуры β-листа. Участки CDR в каждой цепи содержатся вместе в тесной близости с участками CDR из другой цепи с помощью FR-участков, способствуя образованию сайта связывания антител с мишенью (см. публикацию Kabat et al.). Как используется в данном описании, нумерацию аминокислотных остатков иммуноглобулинов проводят согласно системе нумерации аминокислотных остатков иммуноглобулинов по Kabat et al. (Sequences of Proteins of Immunological Interest, National Institute of Health, Bethesda, Md. 1987), если не указано иначе.

Термин "гипервариабельный участок", "HVR" или "HV", при использовании в данном описании, относится к участкам вариабельного домена антитела, которые являются гипервариабельными по последовательности и/или образуют определенные структурой петли. Как правило, антитела включают шесть гипервариабельных участков: три в области VH (H1, H2, H3) и три в области VL (L1, L2, L3). Используется ряд описаний гипервариабельных участков, которые включены в данный документ. Участки, определяющие комплементарность по Kabat (CDR), определяются на основе вариабельности последовательности и имеют широкое применение (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia вместо этого использует обозначение локализации структурных петель (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). Гипервариабельные участки антитела AbM представляют собой компромисс между определением CDR по Kabat и определением структурных шпилек по Chothia и используются в Оксфордском пакете программного обеспечения для молекулярного моделирования антител AbM. "Контактные" гипервариабельные участки определяются на основе анализа доступных кристаллических структур комплексов. Остатки каждого из этих гипервариабельных участков указаны ниже.

Петля Kabat AbM Chothia Контакт
L1 L24-L34 L24-L34 L26-L32 L30-L36
L2 L50-L56 L50-L56 L50-L52 L46-L55
L3 L89-L97 L89-L97 L91-L96 L89-L96
H1 H31-H35B H26-H35B H26-H32 H30-H35B
(Нумерация по Kabat)
H1 H31-H35 H26-H35 H26-H32 H30-H35
(Нумерация по Chothia)
H2 H50-H65 H50-H58 H53-H55 H47-H58
H3 H95-H102 H95-H102 H96-H101 H93-H101

Гипервариабельные участки могут включать следующие "протяженные гипервариабельные участки": 24-36 или 24-34 (L1), 46-56 или 50-56 (L2) и 89-97 (L3) в VL и 26-35 (H1), 50-65 или 49-65 (H2) и 93-102, 94-102 или 95-102 (H3) в VH. Остатки вариабельных доменов пронумерованы согласно Kabat et al., как описано выше, для каждого из этих классов.

Остатки "каркасного участка" или "FR-участка" представляют собой остатки вариабельного домена, отличные от остатков гипервариабельного участка или от остатков участка CDR, определенных в данном описании.

Термин "нумерация по Kabat остатков вариабельного домена" или "нумерация по Kabat положения аминокислоты" и их вариации означает систему нумерации, используемую для вариабельных доменов тяжелой цепи или вариабельных доменов легкой цепи в компиляции антител по Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991). При использовании этой системы нумерации действительная линейная аминокислотная последовательность может содержать меньшее количество аминокислот или дополнительные аминокислоты, соответствующие укороченным FR- или CDR-участкам вариабельного домена или вставкам в FR- или CDR-участки вариабельного домена. Например, вариабельный домен тяжелой цепи может включать одну аминокислотную вставку (остаток 52a согласно Kabat) после остатка 52 из H2 и вставленные остатки (например, остатки 82a, 82b, и 82c и т.д. согласно Kabat) после остатка 82 FR-участка тяжелой цепи. Нумерация остатков по Kabat может быть определена для данного антитела путем сравнения гомологичных участков последовательности антитела со "стандартной" последовательностью с нумерацией по Kabat.

Систему нумерации по Kabat, как правило, используют при обозначении остатка в вариабельном домене (приблизительно остатки 1-107 легкой цепи и остатки 1-113 тяжелой цепи) (например, Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991 )). "EU-система нумерации" или "EU-индекс", как правило, используется для обозначения остатка в константном участке тяжелой цепи иммуноглобулина (например, EU-индекс, описанный выше у Kabat et al.; шарнирный участок в константном домене тяжелой цепи приблизительно представляет собой остатки 216-230 (EU-нумерация) тяжелой цепи). "EU-индекс по Kabat" обозначает нумерацию остатков человеческого антитела IgG1 EU. Если в данном описании не указано иначе, обозначения номеров остатков в вариабельном домене антител означают нумерацию остатков по системе нумерации Kabat. Если в данном описании не указано иначе, обозначения номеров остатков в константном домене антител означают нумерацию остатков по EU-нумерации (например, см. предварительную заявку США No. 60/640323, фигуры для EU-нумерации).

Термин "фрагмент антитела" обозначает часть полноразмерного антитела, как правило, участок связывания с мишенью или вариабельный участок. Примеры фрагментов антител включают Fab, Fab', F(ab')2 и Fv-фрагменты. Фраза "функциональный фрагмент или аналог" антитела относится к соединению, обладающему качественной биологической активностью подобно полноразмерному антителу. Например, функциональный фрагмент или аналог антитела к фактору D человека представляет собой фрагмент, который может связываться с фактором D таким образом, чтобы предотвратить или по существу уменьшить активацию системы комплемента. Как используется в данном описании, "функциональный фрагмент" по отношению к антителам относится к фрагментам Fv, F(ab) и F(ab')2. Фрагмент "Fv" представляет собой минимальный фрагмент антитела, который содержит полный сайт распознавания и связывания с мишенью. Этот участок состоит из димера одного вариабельного домена тяжелой цепи и одного вариабельного домена легкой цепи, которые находятся в тесной нековалентной ассоциации (димер VH-VL). Он находится в такой конфигурации, что три CDR-участка каждого вариабельного домена взаимодействуют с установлением сайта связывания с мишенью на поверхности димера VH-VL. Суммарно, шесть участков CDR придают антителу специфичность связывания с мишенью. Однако даже один вариабельный домен (или половина фрагмента Fv, включающего только три участка CDR, специфичных для мишени) обладает способностью распознавать мишень и связываться с ней. "Одноцепочечный фрагмент Fv" или фрагмент "sFv" антитела включает домены VH и VL антитела, где эти домены присутствуют в одной полипептидной цепи. Как правило, Fv-полипептид дополнительно включает полипептидный линкер между доменами VH и VL, который дает возможность фрагменту sFv образовывать целевую структуру для связывания с мишенью.

Fab-фрагмент содержит константный домен легкой цепи и первый константный домен (CH1) тяжелой цепи. Fab'-фрагменты отличаются от Fab-фрагментов несколькими добавленными остатками на карбоксильном конце домена CH1 тяжелой цепи, включающего один или более цистеинов из шарнирного участка антитела. F(ab')-фрагменты получают путем расщепления дисульфидной связи шарнирных цистеинов продукта гидролиза пепсином F(ab')2. Дополнительные химические связывания фрагментов антитела известны специалистам в данной области.

Используемый в данном описании термин "моноклональное антитело" относится к антителу, полученному из популяции по существу гомогенных антител, т.е. индивидуальные антитела, включенные в популяцию, являются идентичными, за исключением возможных естественных мутаций, которые могут присутствовать в минорных количествах. Моноклональные антитела являются высокоспецифичными, причем направлены против одного целевого сайта. Кроме того, в отличие от традиционных препаратов антител (поликлональных), которые обычно включают различные антитела, направленные против различных детерминант (эпитопов), каждое моноклональное антитело направлено против одной детерминанты на мишени. В дополнение к их специфичности преимущество моноклональных антител заключается в том, что они могут быть синтезированы с помощью гибридомной культуры, не содержащей примесей других иммуноглобулинов. Обозначение "моноклональное" указывает на характер антитела, которое было получено из по существу гомогенной популяции антител и не должно быть истолковано как необходимость получения антитела каким-либо конкретным методом. Например, моноклональные антитела, предназначенные для применения по настоящему изобретению, могут быть выделены из фаговых библиотек антител с использованием хорошо известных методов. Родительские моноклональные антитела, предназначенные для применения согласно настоящему изобретению, могут быть получены гибридомным методом, впервые описанным в публикации Kohler and Milstein, Nature 256, 495 (1975), или могут быть получены рекомбинантными методами.

"Гуманизированные" формы отличных от человеческих (например, мышиных) антител представляют собой иммуноглобулины, цепи иммуноглобулинов или их фрагменты (такие как Fv, Fab, Fab', F(ab')2 или другие фрагменты последовательностей антител, связывающиеся с мишенью), которые содержат минимальную последовательность, выделенную из отличного от человеческого иммуноглобулина. Как правило, гуманизированное антитело включает по существу все из, по меньшей мере, одного, а обычно из двух вариабельных доменов, в которых все или по существу все из участков CDR соответствуют участкам CDR отличного от человеческого иммуноглобулина, и все или по существу все из участков FR представляют собой консенсусную последовательность человеческого иммуноглобулина. Гуманизированное антитело также может включать, по меньшей мере, часть константного участка (Fc) иммуноглобулина, обычно из выбранного в качестве матрицы человеческого иммуноглобулина.

Методы гуманизации отличных от человеческих антител хорошо известны в данной области. Как правило, гуманизированное антитело содержит один или более аминокислотных остатков, введенных в него из источника, отличного от человека. Эти отличные от человеческих аминокислотные остатки часто обозначаются как "импортированные" остатки, которые обычно берутся из "импортированного" вариабельного домена. Гуманизацию можно по существу осуществлять согласно методу Винтера и сотрудников [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)] путем замены участков CDR грызунов или последовательностей CDR на соответствующие последовательности человеческого антитела. Соответственно, такие "гуманизированные" антитела являются химерными антителами (патент США №4816567), где участок, по существу меньший, чем человеческий интактый вариабельный домен, заменяли на соответствующую последовательность из отличного от человека вида. На практике гуманизированные антитела обычно представляют собой человеческие антитела, в которых некоторые остатки участка CDR и, возможно, некоторые остатки участка FR заменяют на остатки из аналогичных сайтов антител грызунов.

Выбор человеческих вариабельных доменов обеих цепей, легкой и тяжелой, которые будут использовать при получении гуманизированных антител, в некоторых случаях может быть важным с точки зрения уменьшения антигенности и/или реакции на HAMA (человеческое антимышиное антитело), когда антитело предназначено для использования в терапии человека. Уменьшение или исключение реакции на HAMA, как правило, представляет собой существенный аспект клинической разработки подходящих терапевтических агентов. См., например, Khaxzaeli et al., J. Natl. Cancer Inst. (1988), 80:937; Jaffers et al., Transplantation (1986), 41:572; Shawler et al., J. Immunol. (1985), 135:1530; Sears et al., J. Biol. Response Mod. (1984), 3:138; Miller et al., Blood (1983), 62:988; Hakimi et al., J. Immunol. (1991), 147:1352; Reichmann et al., Nature (1988), 332:323; Junghans et al., Cancer Res. (1990), 50:1495. Как описано в данном документе, в изобретении предлагаются антитела, которые гуманизированы так, чтобы реакция на HAMA была уменьшена или исключена. Варианты этих антител дополнительно могут быть получены с использованием обычных способов, известных в данной области, некоторые из которых дополнительно описаны ниже. Согласно так называемому "оптимизированному" методу последовательность вариабельного домена антитела грызуна скринировали против полной библиотеки известных человеческих последовательностей вариабельных доменов. Идентифицировали последовательность человеческого V-домена, которая является близкой такой последовательности грызуна, и человеческий каркасный участок (FR) внутри нее акцептировали для гуманизированного антитела (Sims et al., J. Immunol. 151:2296 (1993); Chothia et al., J. Mol. Biol., 196:901 (1987)). В другом методе используют конкретный каркасный участок, выделенный из консенсусной последовательности всех человеческих антител конкретной подгруппы легкой и тяжелой цепей. Такой же каркасный участок может быть использован для нескольких различных гуманизированных антител (Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al., J. Immunol. 151:2623 (1993)).

Например, как описано в данном документе, аминокислотная последовательность из антитела служит в качестве стартовой (родительской) последовательности для разнообразия каркасных и/или гипервариабельных последовательностей. Выбранная каркасная последовательность, с которой связывается стартовая гипервариабельная последовательность, обозначается в данном описании как человеческий акцепторный каркасный участок. В то время как человеческие акцепторные каркасные участки могут быть из человеческого иммуноглобулина или могут быть выделены из человеческого иммуноглобулина (его участков VL и/или VH), человеческие акцепторные каркасные участки могут быть из консенсусной последовательности человеческого каркасного участка или могут быть выделены из консенсусной последовательности человеческого каркасного участка, в качестве таковых были продемонстрированы каркасные участки, которые обладают минимальной иммуногенностью, или она отсутствует у пациентов-людей. "Человеческий акцепторный каркасный участок", предназначенный для целей настоящего изобретения, представляет собой каркасный участок, включающий аминокислотную последовательность каркасного участка VL или VH, выделенного из каркасного участка человеческого иммуноглобулина или из консенсусной последовательности человеческого каркасного участка. Акцепторный человеческий каркасный участок, "выделенный из" каркасного участка человеческого иммуноглобулина или из консенсусной последовательности человеческого каркасного участка, может включать их аминокислотную последовательность, или может содержать ранее существующие аминокислотные замены. Там где присутствуют ранее существующие аминокислотные замены, они присутствуют в количестве, составляющем, предпочтительно, не более чем 5 и, предпочтительно, 4 или менее, или 3 или менее. В одном варианте осуществления человеческий акцепторный каркасный участок VH идентичен последовательности каркасного участка VH человеческого иммуноглобулина или консенсусной последовательности человеческого каркасного участка. В одном варианте осуществления человеческий акцепторный каркасный участок VL идентичен последовательности каркасного участка VL человеческого иммуноглобулина или консенсусной последовательности человеческого каркасного участка. "Консенсусная последовательность человеческого каркасного участка" представляет собой каркасный участок, который представляет собой наиболее часто встречающиеся аминокислотные остатки в выборке каркасных последовательностей VL или VH человеческого иммуноглобулина. Как правило, выборка последовательностей VL или VH человеческого иммуноглобулина представлена из подгруппы последовательностей вариабельного домена. Как правило, подгруппа последовательностей представляет собой подгруппу по Kabat et al. В одном варианте осуществления, для VL, подгруппа представляет собой подгруппу каппа I по Kabat et al. В одном из вариантов осуществления, для VH, подгруппа представляет собой подгруппу III по Kabat et al.

Там где акцепторная последовательность выделена из человеческого иммуноглобулина, специалист необязательно может выбрать последовательность человеческого каркасного участка, которая выбирается на основе ее гомологии с донорной последовательностью каркасного участка путем сравнения донорной последовательности каркасного участка с разнообразными последовательностями человеческого каркасного участка из коллекции последовательностей человеческого каркасного участка, и выбрать наиболее гомологичную последовательность каркасного участка в качестве акцептора. Акцепторная последовательность человеческого каркасного участка может быть из зародышевых последовательностей человеческого антитела или может быть выделена из зародышевых последовательностей человеческого антитела, доступных из общих баз данных.

В одном варианте осуществления представленные в данном описании человеческие консенсусные последовательности каркасного участка представляют собой последовательности из подгруппы VH VII и/или из подгруппы VL каппа I консенсусных последовательностей каркасного участка, или представляют собой последовательности, выделенные из подгруппы VH VII и/или из подгруппы VL каппа I консенсусных последовательностей каркасного участка.

В одном варианте осуществления матрица человеческого каркасного участка, используемая для получения антитела к фактору D, может включать последовательности каркасного участка из матрицы, включающие комбинацию VI-4.1 b+ (семейство VH7) и JH4d для VH цепи (фиг.3) и/или комбинацию DPK4 (семейство VκI) и JK2 для VL цепи (фиг.4).

Таким образом, акцепторный человеческий каркасный участок VH может включать одну, две, три или все из следующих последовательностей каркасного участка: FR1, включающий QX1QLVQSGX2ELKKPGASVKVSCKAS (аминокислоты 1-25 последовательности SEQ ID NO: 27), где X1 представляет собой I или V, X2 представляет собой P или S; FR2, включающий WVX3QAPGQGLE (аминокислоты 36-46 последовательности SEQ ID NO: 27), где X3 представляет собой K или R; FR3, включающий RFVFSLDTSVSTAYLQISSLKAEDTAX4YYCX5R (аминокислоты 67-98 последовательности SEQ ID NO: 27), где X4 представляет собой T или V, X5 представляет собой E или A; FR4, включающий WGQGTLVTVSS (аминокислоты 105-115 последовательности SEQ ID NO: 8 или аминокислоты 105-115 последовательности SEQ ID NO: 27).

Примеры консенсусных каркасных участков VH включают:

подгруппу VH I консенсусной последовательности человеческого каркасного участка без участков CDR по Kabat (SEQ ID NO: 28);

подгруппу VH I консенсусной последовательности человеческого каркасного участка без протяженных гипервариабельных участков (SEQ ID NO: 29-31);

подгруппу VH II консенсусной последовательности человеческого каркасного участка без участков CDR по Kabat (SEQ ID NO: 32);

подгруппу VH II консенсусной последовательности человеческого каркасного участка без протяженных гипервариабельных участков (SEQ ID NO: 33-35);

подгруппу VH III консенсусной последовательности человеческого каркасного участка без участков CDR по Kabat (SEQ ID NO: 36);

подгруппу VH III консенсусной последовательности человеческого каркасного участка без протяженных гипервариабельных участков (SEQ ID NO: 37-39);

подгруппу VH VII консенсусной последовательности человеческого каркасного участка без участков CDR по Kabat (SEQ ID NO: 55);

подгруппу VH VII консенсусной последовательности человеческого каркасного участка без протяженных гипервариабельных участков (SEQ ID NO: 56-58);

акцепторный человеческий каркасный участок VH без участков CDR по Kabat (SEQ ID NO: 40);

акцепторный человеческий каркасный участок VH без протяженных гипервариабельных участков (SEQ ID NO: 41-42);

акцепторный человеческий каркасный участок VH 2 без участков CDR по Kabat (SEQ ID NO: 43); или акцепторный человеческий каркасный участок VH 2 без протяженных гипервариабельных участков (SEQ ID NO: 44-45).

В одном варианте осуществления акцепторный человеческий каркасный участок VH включает одну, две, три или все из следующих последовательностей каркасного участка:

FR1, включающий QVQLVQSGPELKKPGASVKVSCKAS (аминокислоты 1-25 последовательности SEQ ID NO: 8),

FR2, включающий WVRQAPGQGLE (аминокислоты 36-46 последовательности SEQ ID NO: 8),

FR3, включающий RFVFSLDTSVSTAYLQISSLKAEDTAVYYCER (аминокислоты 67-98 последовательности SEQ ID NO: 8),

RFVFSLDTSVSTAYLQISSLKAEDTAVYYCE (аминокислоты 67-97 последовательности SEQ ID NO: 8),

RFVFSLDTSVSTAYLQISSLKAEDTAVYYC (аминокислоты 67-96 последовательности SEQ ID NO: 8),

RFVFSLDTSVSTAYLQISSLKAEDTAVYYCS (SEQ ID NO: 51) или

RFVFSLDTSVSTAYLQISSLKAEDTAVYYCSR (SEQ ID NO: 52);

FR4, включающий WGQGTLVTVSS (аминокислоты 105-115 последовательности SEQ ID NO: 8 или аминокислоты 105-115 последовательности SEQ ID NO: 27).

Акцепторный человеческий каркасный участок VL может включать одну, две, три или все из следующих последовательностей каркасного участка:

FR1, включающий DIQX6TQSPSSLSX7SVGDRVTITC (аминокислоты 1-23 последовательности SEQ ID NO: 26), где X6 представляет собой V или M, X7 представляет собой M или A;

FR2, включающий WYQQKPGKX8PKLLIX9 (аминокислоты 35-49 последовательности SEQ ID NO: 26), где X8 представляет собой P или V, X9 представляет собой S или Y;

FR3, включающий GVPSRFSX10SGSGX11DFTLTISSLQPEDVATYYC (аминокислоты 57-88 последовательности SEQ ID NO: 26), где X10 представляет собой S или G, X11 представляет собой A или T;

FR4, включающий FGQGTKX12EIK (SEQ ID NO: 54), где X12 представляет собой V или L.

Примеры консенсусных последовательностей каркасных участков VL включают:

подгруппу VL каппа I консенсусной последовательности человеческого каркасного участка (SEQ ID NO: 47);

подгруппу VL каппа II консенсусной последовательности человеческого каркасного участка (SEQ ID NO: 48);

подгруппу VL каппа III консенсусной последовательности человеческого каркасного участка (SEQ ID NO: 49); или

подгруппу VL каппа IV консенсусной последовательности человеческого каркасного участка (SEQ ID NO: 50).

В одном варианте осуществления акцепторная последовательность человеческого каркасного участка может включать одну, две, три или все из следующих последовательностей каркасного участка:

FR1, включающий DIQVTQSPSSLSASVGDRVTITC (аминокислоты 1-23 последовательности SEQ ID NO: 7),

FR2, включающий WYQQKPGKVPKLLIS (аминокислоты 35-49 последовательности SEQ ID NO: 7),

FR3, включающий GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (аминокислоты 57-88 последовательности SEQ ID NO: 7),

FR4, включающий FGQGTKLEIK (аминокислоты 98-107 последовательности SEQ ID NO: 7) или FGQGTKVEIK (SEQ ID NO: 53).

В то время как акцепторная последовательность может быть идентична выбранной последовательности человеческого каркасного участка или той, которая из человеческого иммуноглобулина, или той, которая из консенсусной последовательности человеческого каркасного участка, в настоящем изобретении предполагается, что акцепторная последовательность может включать ранее существующие аминокислотные замены по отношению к последовательности человеческого иммуноглобулина или к консенсусной последовательности человеческого каркасного участка.

Ранее существующие замены предпочтительно являются минимальными; имеют обычно четыре, три, два или одно отличие по аминокислотам только по отношению к последовательности человеческого иммуноглобулина или к консенсусной последовательности каркасного участка.

Остатки гипервариабельного участка, отличного от человеческого антитела, вводят в акцепторные последовательности VL и/или VH человеческого каркасного участка. Например, специалист может ввести остатки, соответствующие остаткам участка CDR по Kabat, остаткам гипервариабельной петли по Chothia, остаткам Abm и/или остаткам контактного участка. Необязательно вводятся следующие остатки протяженного гипервариабельного участка: 24-34 (L1), 50-56 (L2) и 89-97 (L3), 26-35 (H1), 50-65 или 49-65 (Н2) и 93-102, 94-102 или 95-102 (Н3).

В одном аспекте изобретения предлагается антитело, включающее, по меньшей мере, один, два, три, четыре, пять или шесть участков HVR, выбранных из (а) участка HVR-H 1, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 13 и SEQ ID NO: 25; (b) участка HVR-H2, включающего аминокислотную последовательность SEQ ID NO: 14; (с) участка HVR-H3, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 15 и SEQ ID NO: 20; (d) участка HVR-L1, включающего аминокислотную последовательность SEQ ID NO: 16; (e) участка HVR-L2, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 17, SEQ ID NO; 21 и SEQ ID NO: 24; и (f) участка HVR-L3, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 18, SEQ ID NO: 22 и SEQ ID NO: 19.

В одном аспекте изобретения предлагается антитело к фактору D, включающее, по меньшей мере, один, два, три, четыре, пять или шесть участков HVR, выбранных из (а) участка HVR-H1, включающего аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности, выбранной из SEQ ID NO: 13 и SEQ ID NO: 25; (b) участка HVR-H2, включающего аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 14; (с) участка HVR-H3, включающего аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности, выбранной из SEQ ID NO: 15 и SEQ ID NO: 20; (d) участка HVR-L1, включающего аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 16; (e) участка HVR-L2, включающего аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности, выбранной из SEQ ID NO: 17, SEQ ID NO; 21 и SEQ ID NO: 24; и (f) участка HVR-L3, включающего аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности, выбранной из SEQ ID NO: 18, SEQ ID NO: 22 и SEQ ID NO: 19. В некоторых вариантах осуществления участок HVR, содержащий аминокислотную последовательность, имеющую, по меньшей мере, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности, содержит замены, вставки или делеции по отношению к эталонной последовательности, но при этом антитело, включающее эту аминокислотную последовательность, сохраняет способность связываться с фактором D. В некоторых вариантах осуществления заменяют, вставляют или делегируют аминокислоты общим количеством, составляющим 1-10, в эталонной последовательности, выбранной из группы, состоящей из SEQ ID NO: 13, SEQ ID NO: 25, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 20, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 21, SEQ ID NO: 23, SEQ ID NO: 18, SEQ ID NO: 22 и SEQ ID NO: 24. В некоторых вариантах осуществления изобретения предлагается антитело, включающее, по меньшей мере, один, два, три, четыре, пять или шесть участков HVR, выбранных из (а) участка HVR-H1, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 13 и SEQ ID NO: 25;

(b) участка HVR-H2, включающего аминокислотную последовательность SEQ ID NO: 14; (с) участка HVR-НЗ, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 15 и SEQ ID NO: 20; (d) участка HVR-L1, включающего аминокислотную последовательность SEQ ID NO: 16; (e) участка HVR-L2, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 17, SEQ ID NO; 21 и SEQ ID NO: 24; и (f) участка HVR-L3, включающего аминокислотную последовательность, выбранную из SEQ ID NO: 18, SEQ ID NO: 22 и SEQ ID NO: 19.

В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, выбранный из SEQ ID N0: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен легкой цепи, выбранный из SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9 и SEQ ID NO: 11. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 6. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен легкой цепи, включающий SEQ ID NO: 5. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 6, и вариабельный домен легкой цепи, включающий SEQ ID NO: 5. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 8. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен легкой цепи, включающий SEQ ID NO: 7. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 8, и вариабельный домен легкой цепи, включающий SEQ ID NO: 7. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 10. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен легкой цепи, включающий SEQ ID NO: 9. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 10, и вариабельный домен легкой цепи, включающий SEQ ID NO: 9. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 12. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен легкой цепи, включающий SEQ ID NO: 11. В одном аспекте изобретения предлагается антитело, содержащее вариабельный домен тяжелой цепи, включающий SEQ ID NO: 12, и вариабельный домен легкой цепи, включающий SEQ ID NO: 11.

В одном аспекте изобретения предлагается антитело к фактору D, содержащее вариабельный домен тяжелой цепи, включающий аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO: 6, 8, 10 и 12. В некоторых вариантах осуществления аминокислотная последовательность, имеющая, по меньшей мере, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности, содержит замены, вставки или делеции по отношению к эталонной последовательности, но при этом антитело, включающее эту аминокислотную последовательность, сохраняет способность связываться с фактором D. В некоторых вариантах осуществления заменяют, вставляют или делетируют аминокислоты общим количеством, составляющим 1-10, в эталонной последовательности, выбранной из группы, состоящей из SEQ ID NO: 6, 8, 10 или 12. В некоторых вариантах осуществления замены, вставки или делеции осуществляются в участках, которые расположены вне HVR (т.е. в участках FR). В некоторых вариантах осуществления антитело к фактору D содержит вариабельный домен тяжелой цепи, включающий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 6, 8, 10 или 12.

В некоторых вариантах осуществления изобретения предлагается антитело к фактору D, содержащее вариабельный домен легкой цепи, включающий аминокислотную последовательность, идентичную, по меньшей мере, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO: 5, 7, 9 и 11. В некоторых вариантах осуществления аминокислотная последовательность, имеющая, по меньшей мере, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности, содержит замены, вставки или делеции по отношению к эталонной последовательности, но при этом антитело, включающее эту аминокислотную последовательность, сохраняет способность связываться с фактором D. В некоторых вариантах осуществления заменяют, вставляют или делетируют аминокислоты общим количеством, составляющим 1-10, в последовательности, выбранной из группы, состоящей из SEQ ID NO: 5, 7, 9 и 11. В некоторых вариантах осуществления замены, вставки или делеции осуществляются в участках, которые расположены вне HVR (т.е. в участках FR). В некоторых вариантах осуществления антитело к фактору D содержит вариабельный домен легкой цепи, включающий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 5, 7, 9 и 11.

Антитело к фактору D может включать любую подходящую последовательность каркасного участка вариабельного домена при условии, что антитело сохраняет способность связывания с фактором D. Например, в некоторых вариантах осуществления антитела к фактору D по изобретению включают последовательность каркасного участка вариабельного домена тяжелой цепи, которая представляет собой комбинацию Vl.4.1 b+ и JH4d (см. фиг.3). В некоторых вариантах осуществления антитело к фактору D по изобретению включает консенсусную последовательность человеческого каркасного участка тяжелой цепи подгруппы VII. В некоторых вариантах осуществления антитела к фактору D по изобретению включают последовательность человеческого каркасного участка вариабельного домена тяжелой цепи, содержащую участок FR1, включающий аминокислоты 1-25 последовательности SEQ ID NO: 8, участок FR2, включающий аминокислоты 36-46 последовательности SEQ ID NO: 8, участок FR3, включающий аминокислоты 67-98 последовательности SEQ ID NO: 8, и участок FR4, включающий аминокислоты 105-115 последовательности SEQ ID NO: 8. В одном варианте осуществления этих антител последовательность вариабельного домена тяжелой цепи включает замену(ы) в положении 40 и/или 88 (нумерация по Kabat). В одном варианте осуществления этих антител аминокислота в положении 40 представляет собой цистеин (C) или аланин (A), и/или аминокислота в положении 88 представляет собой цистеин (C) или аланин (A). В некоторых вариантах осуществления антитела к фактору D по изобретению включают последовательность каркасного участка вариабельного домена легкой цепи, которая представляет собой комбинацию DPK4 и JK2 (см. фиг.4). В некоторых вариантах осуществления антитела к фактору D по изобретению включают консенсусную последовательность человеческого каркасного участка легкой цепи каппа I (κI). В некоторых вариантах осуществления антитела к фактору D по изобретению включают последовательность каркасного участка вариабельного домена легкой цепи, содержащую участок FR1, включающий аминокислоты 1-23 последовательности SEQ ID NO: 7, участок FR2, включающий аминокислоты 35-49 последовательности SEQ ID NO: 7, участок FR3, включающий аминокислоты 57-88 последовательности SEQ ID NO: 7, и участок FR4, включающий аминокислоты 98-107 последовательности SEQ ID NO: 7. В одном варианте осуществления этих антител последовательность каркасного участка вариабельного домена легкой цепи включает одну или более замен в положении 15, 43 и/или 104 (нумерация по Kabat). В одном варианте осуществления этих антител аминокислота в положении 15 представляет собой цистеин (C) или валин (V), аминокислота в положении 43 представляет собой цистеин (C) или аланин (A) и/или аминокислота в положении 104 представляет собой валин (V) или лейцин (L).

Кроме того, антитело к фактору D может включать любую подходящую последовательность константного домена при условии, что антитело сохраняет способность связывания с фактором D. Например, в некоторых вариантах осуществления антитела к фактору D по изобретению включают, по меньшей мере, часть константного домена тяжелой цепи. В одном варианте осуществления антитела к фактору D по изобретению включают константный домен тяжелой цепи любого из типов тяжелой цепи α, β, ε, γ и µ или их комбинации. В зависимости от аминокислотной последовательности константного домена их тяжелых цепей (CH) иммуноглобулины могут быть отнесены к различным классам или изотипам. Существует пять классов иммуноглобулинов: IgA, IgD, IgE, IgG и IgM, имеющих тяжелые цепи, обозначенные α, β, ε, γ и µ соответственно. Классы γ и α дополнительно подразделяются на подклассы на основании относительно минорных различий в последовательности CH и в функции, например, у людей экспрессируются следующие подклассы: IgG1, lgG2, lgG3, lgG4, IgA1 и lgA2. В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен тяжелой цепи, включающий замены в положениях аминокислот, которые приводят в результате к получению целевого эффекта, влияющего на эффекторную функцию (например, аффинность связывания). В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен тяжелой цепи, включающий замены в положениях аминокислот, которые не приводят в результате к получению эффекта, влияющего на эффекторную функцию (например, аффинность связывания). В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен тяжелой цепи иммуноглобулина типа IgG (например, IgG1, lgG2, lgG3 или lgG4) и дополнительно включают замену в положении 114 (нумерация по Kabat; эквивалентно положению 118 в EU-нумераци), 168 (нумерация по Kabat; эквивалентно положению 172 в EU-нумераци), 172 (нумерация по Kabat; эквивалентно положению 176 в EU-нумераци) и/или 228 (EU-нумерация). В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен тяжелой цепи иммуноглобулина типа IgG (например, IgG1, lgG2, lgG3 или lgG4) и дополнительно включают замену в положении 114, где аминокислота в положении 114 представляет собой цистеин (C) или аланин (A), в положении 168, где аминокислота в положении 168 представляет собой цистеин (C) или аланин (A), в положении 172, где аминокислота в положении 172 представляет собой цистеин (C) или аланин (A), и/или в положении 228, где аминокислота в положении 228 представляет собой пролин (P), аргинин (R) или серин (S).

Кроме того, например, в некоторых вариантах осуществления антитела к фактору D по изобретению включают, по меньшей мере, часть константного домена легкой цепи. В одном варианте осуществления антитела к фактору D по изобретению включают константный домен легкой цепи любого из типов легкой цепи - каппа или лямбда, или их комбинацию, поскольку легкая цепь из любого вида позвоночных может быть отнесена к одному из двух абсолютно различных типов, называемых каппа и лямбда, на основании аминокислотных последовательностей их константных доменов. В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен легкой цепи, включающий замены в положениях аминокислот, которые приводят в результате к получению целевого эффекта, влияющего на эффекторную функцию (например, аффинность связывания). В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен легкой цепи, включающий замены в положениях аминокислот, которые не приводят в результате к получению эффекта, влияющего на эффекторную функцию (например, аффинность связывания). В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен легкой цепи типа каппа и дополнительно включают замену в положении 110, 144, 146 и/или 168 (нумерация по Kabat). В одном варианте осуществления антитела к фактору D по изобретению содержат константный домен легкой цепи типа каппа и дополнительно включают замену в положении 110, где аминокислота в положении 110 представляет собой цистеин (C) или валин (V), в положении 144, где аминокислота в положении 144 представляет собой цистеин (C) или аланин (A), в положении 146, где аминокислота в положении 146 представляет собой изолейцин (I) или валин (V), и/или в положении 168, где аминокислота в положении 168 представляет собой цистеин (C) или серин (S).

В одном аспекте изобретения предлагаются антитела, которые конкурируют с мышиным антителом 166-32 и/или с клонами #56, #111, #250 или #416 гуманизированного антитела к фактору D, и/или с антителом, включающим вариабельный домен или HVR-последовательности клонов #56, #111, #250 или #416 гуманизированного антитела к фактору D. Также предлагаются антитела, которые связываются с тем же эпитопом, что и мышиное антитело 166-32, и/или клоны #56, #111, #250 или #416 гуманизированного антитела к фактору D, и/или антитело, включающее вариабельный домен или HVR-последовательности клонов #56, #111, #250 или #416 гуманизированного антитела к фактору D.

В одном варианте осуществления изобретения предлагается антитело к фактору D, где моновалентная аффинность антитела к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) ниже, например, по меньшей мере, в 1 или в 2 раза, чем моновалентная аффинность химерного антитела (например, аффинность химерного антитела в виде Fab-фрагмента к фактору D), включающего, состоящего из или по существу состоящего из вариабельного домена легкой цепи последовательности SEQ ID NO: 2 и вариабельного домена тяжелой цепи последовательности SEQ ID NO: 1.

В одном варианте осуществления изобретения предлагается антитело к фактору D, где бивалентная аффинность антитела к фактору D (например, аффинность антитела в виде IgG к фактору D) ниже, например, по меньшей мере, в 1 или в 2 раза, чем бивалентная аффинность химерного антитела (например, аффинность химерного антитела в виде IgG к фактору D), включающего, состоящего из или по существу состоящего из вариабельного домена легкой цепи последовательности SEQ ID NO: 2 и вариабельного домена тяжелой цепи последовательности SEQ ID NO: 1.

В другом варианте осуществления изобретения предлагается антитело к фактору D, где моновалентная аффинность антитела к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) больше, например, по меньшей мере, в 1 или в 2 раза, чем моновалентная аффинность химерного антитела (например, аффинность химерного антитела в виде Fab-фрагмента к фактору D), включающего, состоящего из или по существу состоящего из вариабельного домена легкой цепи последовательности SEQ ID NO: 2 и вариабельного домена тяжелой цепи последовательности SEQ ID NO: 1.

В другом варианте осуществления изобретения предлагается антитело к фактору D, где бивалентная аффинность антитела к фактору D (например, аффинность антитела в виде IgG к фактору D) больше, например, по меньшей мере, в 1 или в 2 раза, чем бивалентная аффинность химерного антитела (например, аффинность химерного антитела в виде IgG к фактору D), включающего, состоящего из или по существу состоящего из вариабельного домена легкой цепи последовательности SEQ ID NO: 2 и вариабельного домена тяжелой цепи последовательности SEQ ID NO: 1.

В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет 1,0 нМ (1×10-9 M) или лучше. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет 0,5 нМ (0,5×10-9 M) или лучше. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет 1,0 пМ (1×10-12 M) или лучше. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет 0,5 пМ (0,5×10-12 M) или лучше.

В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет 1,0 пМ (1,0×10-9 M) или лучше. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет 0,5 пМ (0,5×10-9 M) или лучше. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет 1,0 пМ (1×10-12 M) или лучше. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет 0,5 пМ (0,5×10-12 M) или лучше.

В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) находится в интервале между 0,5 мМ (0,5×10-6 M) и 0,5 пМ (0,5×10-12 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) находится в интервале между 15 нМ (15×10-9 M) и 0,1 нМ (0,1×10-9 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) находится в интервале между 5,5 нМ (5,5×10-9 M) и 1 нМ (1×10-9 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) находится в интервале между 0,5 пМ (0,5×10-12 M) и 2 пМ (2×10-12 M).

В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) находится в интервале между 0,5 мМ (0,5×10-6 M) и 0,5 пМ (0,5×10-12 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) находится в интервале между 10 нМ (10×10-9 M) и 0,05 нМ (0,05×10-9 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) находится в интервале между 5,5 нМ (5,5×10-9 М) и 1 нМ (1×10-9 М). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) находится в интервале между 0,5 пМ (0,5×10-12 М) и 2 пМ (2×10-12 М).

В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 0,37 нМ (3,7×10-10 М). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 0,33 нМ (3,3×10-10 М). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 0,51 нМ (5,1×10-10 М). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 2,7 нМ (2,7×10-9 М). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 1,4 нМ (1,4×10-9 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 1,4 пМ (1,4×10-12 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет примерно 1,1 пМ (1,1×10-12 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 0,19 нМ (0,19×10-9 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет примерно 0,08 нМ (0,08×10-9 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 12,3 нМ (12,3×10-9 M). В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет примерно 9 нМ (9×10-9 M).

В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 1,4 пМ (1,4×10-12 M) +/- 0,5. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет примерно 1,1 пМ (1,1×10-12 M) +/- 0,6. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 0,19 нМ (0,19×10-9 M) +/- 0,01. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет примерно 0,08 нМ (0,08×10-9 M) +/- 0,01. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D) составляет примерно 12,3 нМ (12,3×10-9 M) +/- 2. В другом варианте осуществления изобретения предлагается антитело к фактору D, где аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D) составляет примерно 9,0 нМ (9,0×10-9 M) +/- 1.

В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 3,7 нМ (3,7×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 3,3 нМ (3,3×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 5,1 нМ (5,1×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 2,7 нМ (2,7×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 1,4 нМ (1,4×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 1,4 пМ (1,4×10-12 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D), составляющую примерно 1,1 пМ (1,1×10-12 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 0,19 нМ (0,19×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D), составляющую примерно 0,08 нМ (0,08×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его моновалентной форме к фактору D (например, аффинность антитела в виде Fab-фрагмента к фактору D), составляющую примерно 12,3 нМ (12,3×10-9 M) +/- 2. В другом варианте осуществления антитело к фактору D может иметь аффинность антитела в его бивалентной форме к фактору D (например, аффинность антитела в виде IgG к фактору D), составляющую примерно 9,0 НМ (9,0×10-9 M) +/- 2.

Как хорошо известно из области техники, аффинность связывания лиганда с его рецептором может быть определена с использованием любого из разнообразных анализов и может выражаться разнообразными количественными величинами. Соответственно, в одном варианте осуществления аффинность связывания выражается в виде величин Kd и отражает истинную аффинность связывания (например, с минимизированными эффектами авидности). Как правило и предпочтительно, аффинность связывания измеряется in vitro либо в бесклеточной системе или в системе, ассоциированной с клетками. Как описано в данном документе более подробно, кратное различие в аффинности связывания может быть количественно определено с помощью соотношения величины моновалентной аффинности связывания гуманизированного антитела (например, в форме Fab) и величины моновалентной аффинности связывания эталонного/сравнительного антитела (например, в форме Fab) (например, мышиного антитела, содержащего донорные последовательности гипервариабельного участка), где величины аффинности связывания определяются при одинаковых условиях анализа. Таким образом, в одном варианте осуществления кратное различие в аффинности связывания определяется как соотношение величин Kd гуманизированного антитела в форме Fab и указанного эталонного/сравнительного антитела Fab. Например, в одном варианте осуществления, если антитело по изобретению (A) имеет аффинность, которая представляет собой величину "в 3 раза ниже", чем аффинность эталонного антитела (M), затем, если величина Kd для A составляет 3×, то величина Kd для M будет составлять 1×, и соотношение Kd для A к Kd для M составит 3:1. Наоборот, в одном варианте осуществления, если антитело по изобретению (C) имеет аффинность, которая представляет собой величину "в 3 раза больше", чем аффинность эталонного антитела (R), затем, если величина Kd для C составляет 1×, то величина Kd для R будет составлять 3×, и соотношение Kd для C и Kd для R составит 1:3. Любой из ряда анализов, известных в данной области, включая те, что описаны в данном документе, может быть использован для получения измерений аффинности связывания, включая, например, анализ Biacore, радиоиммуноанализ (RIA) и ELISA.

Кроме того, величины Kd для антитела по изобретению могут изменяться в зависимости от условий конкретного используемого анализа. Например, в одном варианте осуществления измерения аффинности связывания могут быть получены с помощью анализа, где Fab или антитело являются иммобилизованными, и измеряется связывание лиганда, т.е. фактора D, или, альтернативно, лиганд, т.е. фактор D, для Fab или антитела является иммобилизованным, и измеряется связывание Fab или антитела. В одном варианте осуществления измерения аффинности связывания могут быть получены с помощью анализа, где условия регенерации могут включать (1) 10мМ глицин или 4M MgCl2 при pH 1,5 и (2) значение pH, которое находится в интервале между 1 и 7,5, включая значения pH 1,5, pH 5,0, pH 6,0 и pH 7,2. В одном варианте осуществления измерения аффинности связывания могут быть получены с помощью анализа, где условия связывания могут включать (1) солевой раствор с буфером PBS или HEPES и (2) Tween-20, т.е. 0,1% Tween-20. В одном варианте осуществления измерения аффинности связывания могут быть получены с помощью анализа, где источник лиганда, т.е. фактора D, может быть получен из коммерчески доступных источников. В одном варианте осуществления измерения аффинности связывания могут быть получены с помощью анализа, где (1) Fab или антитело иммобилизованы, и измеряется связывание лиганда, т.е. фактора D, (2) условия регенерации включают 4M MgCl2 при pH 7,2 и (3) условия связывания включают солевой раствор с буфером HEPES, pH 7,2, содержащий 0,1% Tween-20. В одном варианте осуществления измерения аффинности связывания могут быть получены с помощью анализа, где (1) лиганд, т.e. фактор D, иммобилизован, и измеряется связывание Fab или антитела, (2) условия регенерации включают 10 мМ глицин при pH 1,5 и (3) условия связывания включают буфер PBS.

Термины "клетка", "клеточная линия" и "культура клеток" включают потомство. Также понятно, что все потомство не может быть в точности идентичным по содержимому ДНК из-за намеренных или случайных мутаций. Также включен вариант потомства, которое имеет такую же функцию или биологическое свойство, какие имели место у исходно трансформированной клетки. "Клетки-хозяева", используемые в настоящем изобретении, как правило, представляют собой прокариотические или эукариотические клетки-хозяева.

Термин "вектор" означает ДНК-конструкцию, содержащую последовательность ДНК, которая функционально связана с подходящей контрольной последовательностью, способной воздействовать на экспрессию ДНК в подходящем хозяине. Такие контрольные последовательности включают промотор для воздействия на транскрипцию, необязательную последовательность оператора для контроля такой транскрипции, последовательность, кодирующую подходящие сайты связывания мРНК с рибосомой, и последовательности, которые контролируют терминацию транскрипции и трансляции. Вектор может представлять собой плазмиду, фаговую частицу или просто потенциальную геномную вставку. Трансформированный в подходящего хозяина вектор может реплицироваться и функционировать независимо от генома хозяина или может, в некоторых случаях, интегрироваться в сам геном. В настоящем описании "плазмида" и "вектор" иногда используются взаимозаменяемо, поскольку плазмида представляет собой наиболее используемую форму вектора. Однако подразумевается, что изобретение включает такие другие формы векторов, выполняющие эквивалентную функцию, которые являются или становятся известными в данной области.

Используемое в данном описании слово "метка" обозначает детектируемое соединение или композицию, которые могут быть конъюгированы непосредственно или косвенно с молекулой или белком, например, антителом. Метка может быть детектирована сама по себе (например, радиоизотопные метки или флуоресцентные метки) или, в случае ферментной метки, может катализировать химическое изменение соединения субстрата или композиции, которые могут быть детектированы.

Используемый в данном описании термин "твердая фаза" означает безводную форму, с которой может сцепляться антитело по настоящему изобретению. Примеры твердых фаз, охваченных данным описанием, включают твердые фазы, образованные частично или полностью из стекла (например, стекло с контролируемым размером пор), полисахаридов (например, агарозы), полиакриламидов, полистирола, поливинилового спирта и силиконов. В определенных вариантах осуществления, в зависимости от контекста, твердая фаза может включать лунку аналитического планшета; в других случаях она представляет собой колонку для очистки (например, колонку для аффинной хроматографии).

ПОЛУЧЕНИЕ АНТИТЕЛ

СЕЛЕКЦИЯ И ТРАНСФОРМАЦИЯ КЛЕТОК-ХОЗЯЕВ

Представленные в данном описании подходящие клетки-хозяева для клонирования или экспрессии ДНК в векторах представляют собой прокариотические, дрожжевые клетки или клетки высших эукариот. Подходящие для этих целей прокариоты включают как грамположительные, так и грамотрицательные организмы, например, энтеробактерии, такие как E.coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, Serratia и Shigella, а также Bacilli, Pseudomonas и Streptomyces. Предпочтительным хозяином для клонирования типа E.coli является E.coli 294 (ATCC 31,446), хотя другие штаммы, такие как E.coli B, E.coli X1776 (ATCC 31,537) и E.coli W3110 (ATCC 27,325) также являются подходящими. Эти примеры являются больше иллюстративными, чем ограничивающими.

Кроме прокариот, эукариотические микробы, такие как мицелиальные грибы или дрожжи, являются подходящими хозяевами для клонирования или экспрессии векторов, кодирующих антитело. Saccharomyces cerevisiae является наиболее широко используемым среди низших эукариотических микроорганизмов-хозяев. Однако ряд других родов, видов и штаммов широко доступен и используется в настоящем изобретении, например, Schizosaccharomyces pombe; Kluyveromyces; Candida; Thchoderma; Neurospora crassa; и мицелиальные грибы, такие как, например, Neurospora, Penicillium, Tolypocladium, и организмы-хозяева Aspergillus, такие как A. nidulans и A. niger.

Подходящие клетки-хозяева для экспрессии гликозилированных антител выделены из многоклеточных организмов. В принципе, любая культура высших эукариотических клеток является работоспособной, будь то культура клеток от позвоночного или беспозвоночного. Примеры клеток беспозвоночного включают клетки растений и насекомых, Luckow et al., Bio/Technology 6, 47-55 (1988); Miller et al., Genetic Engineering, Setlow et al. eds. Vol.8, pp.277-279 (Plenam publishing 1986); Mseda et al., Nature 315, 592-594 (1985). Были идентифицированы многочисленные бакуловирусные штаммы и варианты и соответствующие пермиссивные клетки-хозяева насекомых от хозяев, таких как Spodoptera frugiperda (гусеница), Aedes (комар), Drosophila melanogaster (плодовая мушка) и Bombyx mori. Разнообразные вирусные штаммы являются общедоступными, например, L-1 вариант Autographa californica NPV и штамм Bm-5 Bombyx mori NPV, и такие вирусы могут быть в данном описании использованы в качестве вируса согласно настоящему изобретению, конкретно, для трансфекции клеток Spodoptera frugiperda. Кроме того, культуры растительных клеток хлопка, кукурузы, картофеля, сои, петунии, томата и табака также могут быть использованы в качестве клеток-хозяев.

Клетки позвоночных и рост и размножение клеток позвоночных в культуре (тканевой культуре) является обычной процедурой. См. публикацию Tissue Culture, Academic Press, Kruse and Patterson, eds. (1973). Примерами подходящих для использования клеточных линий млекопитающих, выступающих в роли клеток-хозяев, являются клетки почек обезьяны; линия эмбриональных клеток почки; клетки почки новорожденного хомяка; клетки яичника китайского хомячка/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980)); мышиные клетки Сертоли (Sertoli); клетки карциномы шейки матки человека (HELA); клетки почки собаки; клетки легкого человека; клетки печени человека; опухолевые клетки молочной железы; и клетки NSO.

Клетки-хозяева трансформируются вышеописанными векторами для продуцирования антитела и культивируются в подходящей питательной среде, модифицированной подходящим образом для индуцирования промоторов, селекции трансформантов или амплификации генов, кодирующих целевые последовательности.

Клетки-хозяева, используемые для продуцирования варианта антитела по настоящему изобретению, можно культивировать в разнообразных средах. Коммерчески доступные среды, такие как Ham F10 (Sigma), минимальная поддерживающая среда (MEM, Sigma), RPMI-1640 (Sigma) и модифицированная Дульбекко среда Игла (DMEM, Sigma), являются подходящими для культивирования клеток-хозяев. Кроме того, любая из сред, описанных в публикации Ham et al., Meth. Enzymol. 58: 44 (1979), Barnes et al., Anal. Biochem. 102: 255 (1980), патент США №4767704; 4657866; 4560655; 5122469; 5712163; или 6048728, может быть использована в качестве культуральной среды для клеток-хозяев. Любая из этих сред может быть по необходимости снабжена гормонами и/или другими факторами роста (такими как инсулин, трансферрин или фактор роста эпидермиса), солями (такими как X-хлориды, где X представляет собой натрий, кальций, магний; и фосфаты), буферами (такими как HEPES), нуклеотидами (такими как аденозин и тимидин), антибиотиками (такими как лекарственное средство ГЕНТАМИЦИН.TM.), следовыми элементами (определенными как неорганические соединения, которые обычно присутствуют в конечной концентрации, которая находится в микромолярном диапазоне) и глюкозой или эквивалентным источником энергии. Любые другие необходимые добавки также включены в подходящих концентрациях, которые известны специалисту в данной области. Условия культивирования, такие как температура, pH и тому подобное, представляют собой условия, которые ранее использовались для клеток-хозяев, выбранных для экспрессии, и эти условия очевидны специалисту в данной области.

ОЧИСТКА АНТИТЕЛ

При использовании рекомбинантных методов антитело может продуцироваться внутриклеточно в периплазматическом пространстве или может непосредственно секретироваться в среду. Если вариант антитела продуцируется внутриклеточно, в качестве первой стадии может удаляться нерастворимый дебрис либо в виде клеток-хозяев, либо лизированных фрагментов путем центрифугирования или ультрафильтрации. В публикации Carter et al., Bio/Technology 10: 163-167 (1992) описана методика выделения антител, которые секретируются в периплазматическое пространство E.coli. В кратком изложении, клеточная масса размораживается в присутствии ацетата натрия (pH 3,5), EDTA и фенилметилсульфонилфторида (PMSF) в течение примерно 30 минут. Клеточный дебрис может быть удален центрифугированием. В случае, где вариант антитела секретируется в среду, супернатанты из таких экспрессирующих систем, как правило, сначала концентрируют с использованием коммерчески доступного фильтра для концентрации белка, например, установки для ультрафильтрации фирмы Amicon или Millipore Pellicon. Протеазный ингибитор, такой как PMSF, может быть включен на любой из вышеописанных стадий для ингибирования протеолиза, и антибиотики могут быть включены для предотвращения роста случайных загрязнений.

Композиция, содержащая антитела, полученная из клеток, может быть очищена с использованием, например, хроматографии с гидроксилапатитом, гель-электрофореза, диализа и аффинной хроматографии, причем аффинная хроматография является предпочтительным методом очистки. Пригодность белка A в качестве аффинного лиганда зависит от вида и изотипа любого иммуноглобулинового Fc-домена, который присутствует в варианте антитела. Белок A может быть использован для очистки антител на основе тяжелых цепей IgGI, IgG2 или IgG4 человека (Lindmark et al., J. Immunol Meth. 62: 1-13 (1983)). Белок G рекомендован для всех мышиных изотипов и для IgG3 человека (Guss et al., EMBO J. 5: 1567-1575 (1986)). Форма, к которой присоединяется аффинный лиганд, наиболее часто представляет собой агарозу, но другие формы также доступны. Механически стабильные формы, такие как стекло с контролируемым размером пор или поли(стиролдивинил)бензол, допускают более высокие скорости потока и меньшее время процессирования, чем те, что могут быть достигнуты с использованием агарозы. В случае, где вариант антитела включает домен CH3, для очистки используется смола Bakerbond ABXTM (J. T. Baker, Phillipsburg, N.J.). В зависимости от получаемого варианта антитела также доступны другие методы очистки белка, такие как фракционирование на ионообменной колонке, осаждение этанолом, обращенно-фазная ВЭЖХ, хроматография на силикагеле, хроматография на гепарин-СЕФАРОЗЕ™, хроматография на анионообменной или катионообменной смоле (такая как с использованием колонки с полиаспарагиновой кислотой), хроматофокусирование, SDS-PAGE и осаждение сульфатом аммония.

После любой предварительной стадии(й) очистки смесь, содержащая вариант интересующего антитела, и примеси могут быть подвергнуты хроматографии гидрофобного взаимодействия при низком pH с использованием буфера для элюирования, имеющего значение pH примерно 2,5-4,5, причем хроматографию предпочтительно осуществляют при низких концентрациях соли (например, примерно от 0-0,25M соли).

ФАРМАЦЕВТИЧЕСКИЕ КОМПОЗИЦИИ

Терапевтические композиции, содержащие полипептид или антитело, могут быть получены для хранения в виде лиофилизованных композиций или водных растворов путем смешивания полипептида, имеющего целевую степень чистоты, с необязательными "фармацевтически приемлемыми" носителями, эксципиентами или стабилизаторами, обычно используемыми в данной области (все из которых обозначаются термином "эксципиенты"). Например, буферные агенты, стабилизирующие агенты, консерванты, изотонические агенты, неионные детергенты, антиоксиданты и другие разнообразные добавки. (См. публикацию Remington's Pharmaceutical Sciences, 16th edition, A. Osol, Ed. (1980)). Такие добавки должны быть нетоксичными для реципиентов в используемых дозировках и концентрациях.

Буферные агенты помогают поддерживать уровень pH в интервале, который приближен к физиологическим условиям. Они предпочтительно присутствуют в концентрации, которая находится в интервале примерно от 2 мМ до примерно 50 мМ. Подходящие буферные агенты для использования по настоящему изобретению включают как органические, так и неорганические кислоты и их соли, такие как цитратные буферы (например, смесь мононатрия цитрата-динатрия цитрата, смесь лимонной кислоты-тринатрия цитрата, смесь лимонной кислоты-мононатрия цитрата и т.д.), сукцинатные буферы (например, смесь янтарной кислоты - мононатрия сукцината, смесь янтарной кислоты - натрия гидроксида, смесь янтарной кислоты - динатрия сукцината и т.д.), тартратные буферы (например, смесь винной кислоты-натрия тартрата, смесь винной кислоты-калия тартрата, смесь винной кислоты-натрия гидроксида и т.д.), фумаратные буферы (например, смесь фумаровой кислоты-мононатрия фумарата, смесь фумаровой кислоты-динатрия фумарата, смесь мононатрия фумарата-динатрия фумарата и т.д.), глюконатные буферы (например, смесь глюконовой кислоты-натрия глюконата, смесь глюконовой кислоты-натрия гидроксида, смесь глюконовой кислоты-калия глюконата, и т.д.), оксалатный буфер (например, смесь щавелевой кислоты-натрия оксалата, смесь щавелевой кислоты-натрия гидроксида, смесь щавелевой кислоты-калия оксалата и т.д.), лактатные буферы (например, смесь молочной кислоты-натрия лактата, смесь молочной кислоты-натрия гидроксида, смесь молочной кислоты-калия лактата и т.д.) и ацетатные буферы (например, смесь уксусной кислоты-натрия ацетата, смесь уксусной кислоты-натрия гидроксида и т.д.). Дополнительно можно отметить фосфатные буферы, гистидиновые буферы и соли триметиламина, такие как Tris.

Для задержки микробного роста могут быть добавлены консерванты в количествах, которые находятся в интервале, составляющем 0,2%-1% (масс./об.). Подходящие консерванты для использования по настоящему изобретению включают фенол, бензиловый спирт, метакрезол, метилпарабен, пропилпарабен, октадецилдиметилбензиламмония хлорид, бензалкония галогениды (например, хлорид, бромид, йодид), гексаметония хлорид, алкилпарабены, такие как матилпарабен или пропилпарабен, катехин, резорцин, циклогексанол и 3-пентанол.

Изотонические агенты, иногда известные как "стабилизаторы", могут быть добавлены для гарантии изотоничности жидких композиций по настоящему изобретению и включают многоатомные сахарные спирты, предпочтительно трехатомные или высшие сахарные спирты, такие как глицерин, эритрит, арабит, ксилит, сорбит и маннит.

Стабилизаторы обозначают широкий спектр эксципиентов, функциональный интервал которых может представлять собой от наполнителя до добавки, которая солюбилизирует терапевтический агент или помогает предотвратить денатурацию или адгезию на стенке контейнера. Типичные стабилизаторы могут представлять собой многоатомные сахарные спирты (перечисленные выше); аминокислоты, такие как аргинин, лизин, глицин, глутамин, аспарагин, гистидин, аланин, орнитин, L-лейцин, 2-фенилаланин, глутаминовая кислота, треонин и т.д., органические сахара или сахарные спирты, такие как лактоза, трегалоза, стахиоза, маннит, сорбит, ксилит, рибит, миоинизит, галактит, глицерин и тому подобное, включая циклиты, такие как инозит; полиэтиленгликоль; полимеры аминокислот; серосодержащие восстанавливающие агенты, такие как мочевина, глутатион, тиоктовая кислота, натрия тиогликолят, тиоглицерин, альфа-монотиоглицерин и натрия тиосульфат; низкомолекулярные полипептиды (т.e. <10 остатков); белки, такие как человеческий сывороточный альбумин, бычий сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон, моносахариды, такие как ксилоза, манноза, фруктоза, глюкоза; дисахариды, такие как лактоза, мальтоза, сахароза, и трисахариды, такие как раффиноза; полисахариды, такие как декстран. Стабилизаторы могут присутствовать в количестве, которое находится в интервале от 0,1 до 10000 весовых частей на часть веса активного белка.

Неионные поверхностно-активные вещества или детергенты (также известные как "увлажняющие агенты") могут быть добавлены для того, чтобы помочь солюбилизировать терапевтический агент, а также чтобы защитить терапевтический белок против агрегации, индуцированной при встряхивании, которые допускают воздействие на композицию напряжения сдвига поверхностного слоя, не вызывая при этом денатурации белка. Подходящие неионные поверхностно-активные вещества включают полисорбаты (20, 80 и т.д.), полоксамеры (184, 188 и т.д.), плюроник.RTM. полиолы, моноэфиры полиоксиэтиленсорбитана (Tween.RTM.-20, Tween.RTM.-80 и т.д.). Неионные поверхностно-активные вещества могут присутствовать в количестве, которое находится в интервале, составляющем примерно от 0,05 мг/мл до 1 мг/мл, предпочтительно примерно от 0,07 мг/мл до 0,2 мг/мл.

Дополнительные разнообразные эксципиенты включают наполнители (например, крахмал), хелатирующие агенты (например, EDTA), антиоксиданты (например, аскорбиновая кислота, метионин, витамин E) и сорастворители. Композиция, представленная в настоящем описании, может также по необходимости содержать более одного активного соединения для лечения конкретного симптома, предпочтительно, соединения с комплементарными активностями, которые не оказывают отрицательного влияния друг на друга. Например, может быть целесообразным дополнительно предоставлять иммуноподавляющий агент. Такие молекулы подходящим образом представлены в комбинации в количествах, которые эффективны для предназначенной цели. Активные ингредиенты также могут быть заключены в микрокапсулу, полученную, например, методами коацервации или полимеризацией на границе фаз, например, в гидроксиметилцеллюлозную или желатиновую микрокапсулу и в поли(метилметакрилатную) капсулу, соответственно, в коллоидных системах доставки лекарственного средства (например, липосомах, альбуминовых микросферах, микроэмульсиях, наночастицах и нанокапсулах) или в макроэмульсиях. Такие методы описаны в публикации Remington's Pharmaceutical Sciences, 16th edition, A. Osal. Ed. (1980).

Композиции, используемые для введения in vivo, должны быть стерильными. Это легко выполнимо, например, с помощью фильтрации через стерильные фильтрационные мембраны. Могут быть получены препараты с длительным высвобождением. Подходящие примеры препаратов с длительным высвобождением включают полупроницаемые формы твердых гидрофобных полимеров, содержащие вариант антитела, которые представлены в форме штампованных изделий, например, пленок или микрокапсул. Примеры форм с длительным высвобождением включают сложные полиэфиры, гидрогели (например, поли(2-гидроксиэтилметакрилат) или поли(виниловый спирт)), полилактиды (патент США №3773919), сополимеры L-глутаминовой кислоты и этил-L-глутамата, недеградируемый сополимер этилена и винилацетата, деградируемые сополимеры молочной кислоты и гликолевой кислоты, такие как LUPRON DEPOT™ (инъецируемые микросферы, состоящие из сополимера молочной кислоты и гликолевой кислоты и лейпролида ацетата), и поли-D-(-)-3-оксимасляная кислота. В то время как полимеры, такие как сополимер этилена и винилацетата и сополимер молочной кислоты и гликолевой кислоты, дают возможность высвобождения молекул в течение времени до 100 дней, определенные гидрогели высвобождают белки за более короткие периоды времени. Когда инкапсулированные антитела сохраняются в организме в течение продолжительного времени, они могут денатурировать или агрегировать в результате воздействия влажности при 37°C, приводя к потере биологической активности и возможным изменениям в иммуногенности. Могут быть разработаны рациональные стратегии для стабилизации в зависимости от вовлеченных механизмов. Например, если обнаружено, что механизм агрегации представляет собой образование внутримолекулярной связи S-S за счет тиодисульфидного взаимообмена, то стабилизации можно достичь путем модификации остатков сульфгидрила, лиофилизации из кислых растворов, контроля содержания влажности, использования подходящих добавок и разработки композиций, содержащих специфическую полимерную форму.

Количество терапевтического полипептида, антитела или его фрагмента, которое будет эффективно для лечения конкретного нарушения или состояния, будет зависеть от природы нарушения или состояния и может быть определено стандартными клиническими методами. Где возможно, целесообразно перед тестированием на людях определять кривую зависимости дозы-реакции фармацевтической композиции по изобретению сначала in vitro, а затем в подходящих системах животных-моделей.

В предпочтительном варианте осуществления водный раствор терапевтического полипептида, антитела или его фрагмента вводят путем подкожной инъекции. Каждая доза может находиться в интервале, составляющем примерно от 0,5 мкг до примерно 50 мкг на килограмм веса тела или, более предпочтительно, примерно от 3 мкг до примерно 30 мкг на килограмм веса тел.

Режим дозирования для подкожного введения может изменяться от введения раз в месяц до ежедневного введения в зависимости от ряда клинических факторов, включающих тип заболевания, тяжесть заболевания и чувствительность субъекта к терапевтическому агенту.

ПРИМЕНЕНИЯ ГУМАНИЗИРОВАННЫХ АНТИТЕЛ

Гуманизированные антитела по настоящему изобретению могут быть использованы в диагностических анализах, например, для детекции экспрессии интересующей мишени в специфических клетках, тканях или сыворотке. Для диагностических применений вариант антитела обычно метят детектируемым компонентом. Многочисленные метки являются доступными. Методы количественной оценки изменения флуоресценции описаны выше. Хемилюминесцентный субстрат становится электронно-возбужденным за счет химической реакции и может затем испускать свет, который может быть измерен (например, с использованием хемилюминометра), или передает энергию флуоресцентному акцептору. Примеры ферментных меток включают люциферазы (например, люциферазу светляка и бактериальную люциферазу; патент США №4737456), люциферин, 2,3-дигидрофталазиндионы, малатдегидрогеназу, уреазу, пероксидазу, такую как пероксидаза хрена (HRPO), щелочную фосфатазу, бета-галактозидазу, глюкоамилазу, лизоцим, оксидазы сахаридов (например, глюкозоксидазу, галактозоксидазу и глюкоза-6-фосфатдегидрогеназу), гетероциклические оксидазы (такие как уриказа и ксантиноксидаза), лактопероксидазу, микропероксидазу и тому подобное. Методы конъюгации ферментов с антителами описаны в публикации O'Sullivan et al., Methods for the Preparation of Enzyme-Antibody Conjugates for Use in Enzyme Immunoassay, in Methods in Enzym. (Ed. J. Langone & H. Van Vunakis), Academic press, New York, 73: 147-166 (1981).

Иногда метка опосредованно конъюгируется с вариантом антитела. Специалисту в данной области известны разнообразные методы для достижения этой цели. Например, вариант антитела может быть конъюгирован с биотином, и любая из трех широких категорий меток, описанных выше, может быть конъюгирована с авидином или наоборот. Биотин связывается селективно с авидином и, таким образом, метка может быть конъюгирована с вариантом антитела таким опосредованным способом. Альтернативно, для достижения опосредованной конъюгации метки с вариантом антитела вариант антитела конъюгируют с коротким гаптеном (например, диглоксином), и один из различных типов меток, описанных выше, конъюгируют с вариантом антитела к гаптену (например антителом к диглоксину). Таким образом, может быть достигнута опосредованная конъюгация метки с вариантом антитела.

В другом варианте осуществления изобретения нет необходимости в мечении варианта антитела, и его присутствие можно детектировать с использованием меченого антитела, которое связывается с вариантом антитела.

Антитела по настоящему изобретению могут быть использованы в любом известном методе анализа, таком как анализы конкурентного связывания, прямой и косвенный сэндвич-анализы и анализы иммунопреципитации. Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc. 1987).

Анализы конкурентного связывания основаны на способности меченого стандарта конкурировать с тестируемым образцом за связывание с ограниченным количеством варианта антитела. Количество мишени в тестируемом образце обратно пропорционально количеству стандарта, который связывается с антителами. Для облегчения определения количества стандарта, который становится связанным, антитела, как правило, переводят в нерастворимую форму перед или после анализа конкуренции. В результате стандарт и тестируемый образец, которые связаны с антителами, могут быть легко отделены от стандарта и тестируемого образца, которые остались не связанными.

Сэндвич-анализ включает использование двух антител, каждое из которых способно к связыванию с различными иммуногенными частями или эпитопами, или детектируемыми белками. В сэндвич-анализе тестируемый образец, подлежащий анализу, связывается с первым антителом, которое иммобилизовано на твердой подложке, и затем второе антитело связывается с тестируемым образцом, таким образом, образуя нерастворимый комплекс из трех частей. См., например, патент США №4376110. Второе антитело может быть само мечено детектируемым компонентом (прямые сэндвич-анализы) или может быть измерено с использованием антитела к иммуноглобулину, которое является меченным детектируемым компонентом (косвенный сэндвич-анализ). Например, один тип сэндвич-анализа представляет собой анализ ELISA, в случае которого детектируемым компонентом является фермент.

Для иммуногистохимии образец опухоли может быть свежим или замороженным или может быть помещен в парафин и фиксирован консервантом, таким как, например, формалин.

Антитела также могут быть использованы для in vivo диагностических анализов. Как правило, вариант антитела является меченным радионуклеотидом (таким как 111In, 99Tc, 14C, 131I, 3H, 32P или 35S) так, чтобы опухоль можно было локализовать с использованием иммуносцинтиграфии. Например, высокоаффинное антитело к IgE по настоящему изобретению можно использовать для детекции количества IgE, присутствующего, например, в легких пациентов-астматиков.

Антитело по настоящему изобретению может быть представлено в наборе, т.е. упакованной комбинации реагентов в определенных количествах вместе с инструкциями по проведению диагностического анализа. В случае, где вариант антитела является меченным ферментом, набор может включать субстраты и кофакторы, необходимые для фермента (например, предшественник субстрата, который обеспечивает получение детектируемого хромофора или флуорофора). Кроме того, могут быть включены другие добавки, такие как стабилизаторы, буферы (например, блокирующий буфер или лизирующий буфер) и тому подобное. Относительные количества разнообразных реагентов могут широко варьироваться с получением концентраций в растворе реагентов, которые по существу оптимизируют чувствительность анализа. Конкретно, реагенты могут быть представлены в виде сухих порошков, обычно лиофилизованных, включающих эксципиенты, которые при растворении обеспечивают получение раствора реагентов, имеющего подходящую концентрацию.

IN VIVO-ПРИМЕНЕНИЯ АНТИТЕЛА

Предполагается, что антитела по настоящему изобретению можно применять для лечения млекопитающего. В одном варианте осуществления антитело вводят отличному от человека млекопитающему в целях получения, например, доклинических данных. Типичные отличные от человека млекопитающие, подвергаемые лечению, включают отличных от человека приматов, собак, кошек, грызунов и других млекопитающих, для которых осуществляют доклинические исследования. Такие млекопитающие могут представлять собой признанных животных моделей для заболевания, подлежащего лечению с помощью антитела, или могут использоваться для исследования токсичности интересующего антитела. В каждом из этих вариантов осуществления исследования повышения дозы можно осуществлять на млекопитающем.

Антитело или полипептид вводят любыми подходящими средствами, включающими парентеральное введение, подкожное, внутрибрюшинное, внутрилегочное и интраназальное, и, если целесообразно для местного иммуноподавляющего лечения, введение внутрь пораженных тканей. Парентеральные инфузии включают внутримышечное, внутривенное, внутриартериальное, внутрибрюшинное или подкожное введение. Кроме того, вариант антитела вводят подходящим образом путем импульсной инфузии, конкретно, с уменьшением доз варианта антитела. Предпочтительно, дозирование осуществляют путем инъекций, наиболее предпочтительно, путем внутривенных или подкожных инъекций, зависящих частично от того, является ли введение кратким или продолжительным.

Предотвращение или лечение заболевания, подходящее дозирование антитела или полипептида будут зависеть от типа заболевания, подлежащего лечению, тяжести и стадии заболевания, от того, водится ли вариант антитела в профилактических целях или в терапевтических целях, от предыдущей терапии, от клинической истории пациента и реакции на антитело и от выбора лечащего врача.

В зависимости от типа и тяжести заболевания доза, составляющая примерно от 0,1 мг/кг до 150 мг/кг (например, 0,1-20 мг/кг) антитела, представляет собой исходную кандидатную дозу для введения пациенту, либо, например, путем одного или более отдельных введений, либо путем продолжительной инфузии. Обычная ежедневная доза может находиться в интервале, составляющем примерно от 1 мг/кг до 100 мг/кг или более, в зависимости от факторов, указанных выше. Для повторных введений в течение нескольких дней или более, в зависимости от состояния, лечение продолжается до желательного подавления наблюдаемых симптомов заболевания. Однако можно применять и другие режимы дозирования. Мониторинг прогресса этой терапии легко осуществляется подходящими методами и анализами. Обычный режим дозирования описан в WO 94/04188.

Композиции, содержащие антитело, могут быть составлены в лекарственную форму, разделены на дозы и введены способом, соответствующим надлежащей медицинской практике. Факторы для обсуждения в этом контексте включают конкретное нарушение, подвергнутое лечению, конкретное млекопитающее, подвергнутое лечению, клиническое состояние индивидуального пациента, причину нарушения, место доставки агента, способ введения, схему введения и другие факторы, известные клиницистам. "Терапевтически эффективное количество" антитела для введения будет регулироваться такими соображениями и является минимальным количеством, необходимым пациенту для предотвращения, улучшения или лечения заболевания или нарушения. В этом нет необходимости, но антитело необязательно включено в состав лекарственной формы с одним или более агентами, в настоящее время используемыми для предотвращения или лечения рассматриваемого нарушения. Эффективное количество таких других агентов зависит от количества антитела, присутствующего в композиции, типа нарушения или лечения и других факторов, обсуждаемых выше. Они, как правило, используются в таких же дозах и вводятся такими же путями, какие использовались выше, или в количестве, составляющем примерно от 1 до 99% от ранее используемых доз.

Антитела по настоящему изобретению, которые распознают фактор D в качестве их мишени, могут применяться для лечения опосредованных системой комплемента нарушений. Эти нарушения ассоциированы с избыточной или неконтролируемой активацией системы комплемента. Они включают: активацию системы комплемента во время операций искусственного кровообращения; активацию системы комплемента по причине ишемии-реперфузии после острого инфаркта миокарда, аневризмы, инсульта, геморрагического шока, повреждения с размозжением тканей, полиорганной недостаточности, гиповолемического шока и кишечной ишемии. Эти нарушения также могут включать заболевание или состояние, ассоциированное с воспалительным состоянием, таким как тяжелые ожоги, эндотоксемия, септический шок, синдром нарушения дыхания у взрослых, гемодиализ; анафилактический шок, тяжелое астматическое состояние, ангиоэдема, болезнь Крона, серповидно-клеточная анемия, постстрептококковый гломерулонефрит и панкреатит. Нарушение может быть результатом побочного действия лекарственного средства, аллергии на лекарственное средство, индуцированного с помощью IL-2 синдрома просачивания из сосудов или аллергии на рентгеноконтрастные средства. Нарушение также включает аутоиммунное заболевание, такое как системная красная волчанка, миастения гравис, ревматоидный артрит, болезнь Альцгеймера и рассеянный склероз. Активация системы комплемента также ассоциирована с отторжением трансплантата. Недавно было показано наличие существенной корреляции между активацией системы комплемента и глазными заболеваниями, такими как возрастная дегенерация желтого пятна, диабетическая ретинопатия.

ПРИМЕРЫ

Следующие примеры предлагаются с целью иллюстрации, но не с целью ограничения.

Пример 1: Гуманизация мышиного антитела MAb 166-32 к фактору D

Последовательности вариабельного участка тяжелой цепи (VH) и вариабельного участка легкой цепи (VL) мышиного антитела mAb 166-32 сравнивали с зародышевыми последовательностями человеческого антитела, представленными в общедоступных базах данных. Использовали несколько критериев при выборе матрицы, как описано на стадии 1 выше, включая полную длину, подобные положения участков CDR внутри каркасного участка, полную гомологию, размер участка CDR и т.д. Все из этих критериев, взятые вместе, обеспечили результат для выбора оптимальной человеческой матрицы, как показано путем сравнения последовательностей между последовательностями тяжелой и легкой цепи антитела 166-32 MAb и соответствующими последовательностями человеческой матрицы, как изображено на фиг.3 и 4.

В этом случае для создания этого антитела использовали более чем одну матрицу человеческого каркасного участка. Человеческая матрица, выбранная для цепи VH, представляла собой комбинацию VI-4.1 b+ (7-04.1 локус)(# X62110)(семейство VH7) и JH4d (см. фиг.3). Человеческая матрица, выбранная для цепи VL, представляла собой комбинацию DPK4 (семейство VK I), объединенную с JK2 (см. фиг.4).

После выбора матрицы конструировали Fab-библиотеку с помощью синтеза ДНК и перекрывающей реакции ПЦР. Библиотека состояла из синтезированных участков MAb 166-32 CDR, синтезированных с соответствующими выбранными человеческими матрицами. Перекрывающие нуклеотиды, кодирующие частичные последовательности VH и VL, были синтезированы с размером в интервале, составляющем примерно 63-76 нуклеотидов с перекрыванием в 18-21 нуклеотид. Конструировали векторы, экспрессирующие библиотеку гуманизированных Fab против антигена в виде фактора D, и трансформировали в клетки E. coli DH10B, затем сажали на бактериальный газон XL-1B.

Качество библиотеки оценивали по размеру (ряд независимых клонов) и разнообразию (распределение мутаций). Индивидуальные клоны с двойной вставкой обеих цепей, тяжелой и легкой, составили примерно 14 из 20 определенных последовательностей. Мутации качания в области каркасного участка были равномерно распределены.

ПЦР-амплификацию генов VL и VH осуществляли с использованием биотинилированного прямого праймера, содержащего специфичную последовательность для каркасного участка FR1, и выступающая последовательность отжигается с концом лидерной последовательности (генIII) и обратным праймером из консервативного константного участка (CK или CH1) при стандартных условиях ПЦР. ПЦР-продукт очищали с помощью электрофореза на агарозном геле или с помощью коммерческого набора реагентов для очистки ПЦР-продуктов, чтобы удалить не введенные биотинилированные праймеры и неспецифичные продукты ПЦР.

ПРИМЕР 2: Скрининг библиотеки

Анализ с использованием фильтра, содержащего ловушку (Capture Filter Lift), использовали для первичного скрининга. Действительный объем скрининга был более чем в три раза больше, чем теоретический размер библиотеки. Кандидаты дополнительно скринировали с помощью анализа ELISA одной точки. Лучшие связывающие агенты дополнительно подтверждали прямым антигенным титрованием с использованием фактора D на основе концентрации Fab.

Скрининг с использованием ловушки (Capture lift)

Анализ с использованием фильтра, содержащего ловушку (Capture Filter Lift), использовали для первичного скрининга на связывание Fab с фактором D. Фаг с высоким титром высевали и инкубировали при 37°C до момента использования (примерно 6-8 ч). Козьи антитела к каппа-цепи человека разводили до 10 мкг/мл в 10 мл PBST. Нитроцеллюлозные фильтры для переноса и роста бляшек получали согласно стандартным процедурам переноса и роста бляшек и затем погружали в 10 мл блокирующего буфера на 2 часа на шейкере. Фильтры промывали 3× с помощью PBST. Фильтры применяли для газона бляшек и инкубировали при комнатной температуре приблизительно в течение 15-24 часов. Фильтры затем удаляли из планшетов и промывали 3× с помощью TBST.

Фактор D (50 мкг/мл) разводили в PBST до 0,1 мкг/мл и добавляли по 4 мл на фильтр. Фильтры инкубировали в растворе в течение 2 часов на шейкере при комнатной температуре с последующим промыванием 3×, каждое по 5 минут. Разведенное антитело 166-222-HRP (1:10000 в PBST) добавляли до конечного объема, составляющего 4 мл на фильтр, и фильтры инкубировали в течение 1 часа на шейкере. Фильтры промывали 4×. Фильтры сушили и затем погружали в TMB-субстрат с последующим погружением в воду для остановки реакции. Идентифицировали позитивные клоны.

ПРИМЕР 3: Скрининг с использованием ELISA одной точки

Анализ ELISA одной точки использовали для вторичного скрининга. На планшеты lmmulon II наносили покрытие в виде козьего антитела к Fab человека (1:12000, 50 мкл/на лунку) в течение ночи при комнатной температуре. На следующий день планшеты промывали 4× с использованием машины для промывания планшетов. Блокирующий буфер добавляли в объеме 100 мкл на лунку и планшеты инкубировали в течение 1 часа при комнатной температуре. Затем планшеты промывали 4×.

Каждое антитело Fab, которое следует подвергнуть скринингу, добавляли в объеме 50 мкл на лунку (либо из 15 мл периплазматического препарата или из супернатанта) и инкубировали в течение 1 часа при комнатной температуре. Планшеты промывали 4× с последующим добавлением 50 мкл/на лунку биотинилированного фактора D в концентрации 0,01 мкг/мл. Планшеты инкубировали в течение 1 часа при комнатной температуре и затем промывали 4×. Добавляли стрептавидин-HRP (1:10000 в PBST) и инкубировали в течение 1 часа при комнатной температуре. Планшеты промывали 5× и затем проявляли путем добавления TMB-субстрата в количестве 50 мкл/на лунку. Стоп-буфер добавляли в объеме 50 мкл, когда сигнал проявлялся надлежащим образом (10-45 мин), и планшеты считывали при 450 нм.

Пример 4: Секвенирование клонов гуманизированных антител к фактору D

Секвенировали шестнадцать гуманизированных клонов с надлежащей аффинностью связывания с фактором D человека (см. таблицу 1). Среди них положение 2 (100% человеческий участок) и положение 49 (100% мышиный участок) в легкой цепи, и положение 93 (100% мышиный участок) в тяжелой цепи представляют собой высококонсервативные участки, что указывает на их важность в поддержании способности связывания антитела.

Таблица 1
Анализ аминокислотных последовательностей гуманизированных клонов из гуманизированной библиотеки
VK 2 4 13 43 49 64 69 VH 2 9 38 93 97
Мышь T V M P S S A I P K T E
Человек I M A V Y G T V S R V A
7 I M M V S S T I P K V E
30 I V A V S S A V P K T E
45 I V M V S G A I S R V E
46 I V M V S S T I S R V E
47 I V A V S S T I S R V E
48 I V M V S S T V P R V E
50 I V M V S G A V P R T E
51 I M M V S G T I S K T E
56 I V A V S G T V P K T E
57 I M M V S S A V S R V E
58 I V M P S G A V P R V E
59 I V A P S S T V P K V E
60 I V M P S G T V P R V E
63 I V M V S S T V S R T E
74 I V M V S S T I S R V E

Клон #56 оценивали с помощью анализа BIAcore и анализа гемолитического ингибирования. Анализ BIAcore показал, что клон #56 обладает аффинностью к фактору D человека, подобной аффинности химерного антитела 166-32 Fab (см. таблицу 4). Анализ гемолитического ингибирования показал, что клон #56 является чуть более активным, чем химерное антитело 166-32 Fab (см. фиг.6). Клон #56 содержит два мышиных аминокислотных остатка в каркасном участке легкой цепи и четыре мышиных аминокислотных остатка в тяжелой цепи (см. таблицу 1). На основе этих результатов проводили дополнительную оптимизацию.

Таблица 2
Анализ аминокислотной последовательности оптимизированных антител из гуманизированной/CDR3-оптимизированной библиотеки
VK положения 2 4 13 43 49 64 69 CDR-L3 92 93 97
166-32 T V M P S S A D N T
Человеческая матрица I M A V Y G T
104 I V M P S S T D S T
109 I V A V S G A M N T
111 I V A V S G T D S T
112 I V A V S G T D S T
114 I V A V S G T D C T
121 I V A V S S A D N T
125 I V A P S S T D N T
130 I V A V S S T D N S
VH Положения 2 9 38 93 97 CDR-H3 98 99 100
166-32 I P K T E V D N
Человеческая Матрица V S R V A
104 V S R V E V D T
109 V S R V E V N N
111 V S R V E V N N
112 V S R V E V N N
114 V S K V E V N N
121 I S R V E V N T
125 V S R V E P D N
130 V S R V E V D H

Клоны #111 и #114 характеризовали с помощью анализа BIAcore (см. таблицу 4). Клоны #104, #111, #114 и #130 также характеризовали с помощью анализа гемолитического ингибирования (см. фиг.6). Эти клоны обладали более высокими значениями аффинности связывания, чем химерное антитело 166-32, и были более активными, чем химерное антитело Fab в ингибировании альтернативного пути, как показано анализом гемолитического ингибирования (фиг.7). Клон #111 содержит те же мышиные аминокислотные остатки в легкой цепи (положение 4 и 49), что и клон #56. Он также содержит консервативный мышиный аминокислотный остаток в положении 97 тяжелой цепи, какой также обнаружен в клоне #56. Существует одна полезная мутация в участке CDR3 обеих цепей, легкой и тяжелой, в клоне #111. На основании результатов, полученных из скрининга двух независимых библиотек (гуманизированной библиотеки и гуманизированной/CDR3-оптимизированной библиотеки), обнаружено, что лучшие клоны содержат подобные консенсусные аминокислотные остатки.

Для дополнительной оптимизации аффинности клона #111 сконструировали библиотеку антител путем введения единичных мутаций одновременно в участки CDR-H1 и CDR-L2. В кратком изложении способ сайтнаправленного мутагенеза использовали для конструирования таких библиотек путем отжига олигонуклеотидов, кодирующих единичные мутации, на матрице клона #111. В целом были секвенированы 24 клона с очень высокой аффинностью к фактору D. Среди этих 24 клонов было идентифицировано несколько новых полезных мутаций. Клоны #250, #315, #345 и #416 были выбраны для анализа BIAcore (см. таблицу 4). Данные, полученные с помощью анализа BIAcore, показали, что эти клоны обладают более высокой аффинностью к фактору D человека, чем исходный клон #111. Клоны #250, #315, #348 и #416 также тестировали с помощью анализа гемолитического ингибирования (см. фиг.6) и ингибирования альтернативного пути (фиг.7).

Пример 5: Анализ гемолиза AP

Биологическую функцию гуманизирванных клонов определяли с использованием анализа гемолитического ингибирования и анализа BIAcore (см. пример 6 ниже). Гемолитический анализ осуществляли согласно следующей методике. 20 мкл разведенных 1:20 кроличьих эритроцитов (RRBC) (0,5 мл + 9,5 мл буфера GVB/Mg-EGTA) в 20 мл солевого раствора (0,9% NaCl) с разведением, составляющим приблизительно 1:2×104, считывали с помощью прибора Coulter Counter. Концентрацию клеток затем доводили до концентрации примерно 2-5×104 клеток/мл. В каждый планшет добавляли примерно 500×106 RRBC/на планшет или примерно 1 мл RRBC/на планшет (500×106/2-5×104).

Клетки разводили в 6 мл буфера GVB/Mg-EGTA/на планшет, смешивали и промывали 3 раза путем центрифугирования при 1360 об/мин в течение 4 минут при 4°C. Осадок RRBC суспендировали в 3 мл буфера GVB/Mg-EGTA/на планшет и держали на льду.

Человеческую сыворотку, замороженную до -80°C, размораживали непосредственно перед использованием. Сыворотку разводили до концентрации, составляющей 20% сыворотки в буфере GVB/Mg-EGTA, 5 мл/на планшет (до конечной концентрации 10%) и держали на льду.

Таблица 3
1 2 3 S SB
GVB/Mg-EGTA: 50 мкл 50 мкл 50 мкл 50 мкл 50 мкл
mAb: 50мкл-смесь 50 мкл 50 мкл 50 мкл - -
20% человеческая сыворотка 50 мкл 50 мкл 50 мкл 50 мкл 50 мкл
Встряхнуть 30 сек при 5-6°C, затем держать при комнатной температуре в течение 7 мин
Кроличьи RBC 30 мкл 30 мкл 30 мкл 30 мкл

Образцы встряхивали в течение 30 сек при 5-6°C и затем в течение 40 минут при 37°C. Образцы охлаждали до 5-6°C во время встряхивания и затем центрифугировали при 2000 об/мин в течение 3 мин при 4°C. Приблизительно 80 мкл супернатанта переносили на дно 96-луночного планшета и считывали OD-величину при 590 нм с использованием стандартного прибора для считывания планшетов. Процент ингибирования рассчитывали следующим образом: % ингибирования = {[(S-SB)-(U-SB)]/(S-SB)}×100%. (U = образец 1, 2 или 3 (колонки 1, 2 или 3 таблицы 3, соответственно).

Пример 6: Кинетический анализ антитела Fab к фактору D человека с помощью анализа BiaCore

Иммобилизация - Фактор D человека (Advanced Research Inc, 0,1 мг/мл) непосредственно иммобилизовали на чип CM5 (BiaCore) с использованием метода аминокислотной конденсации. Методика кратко описывается следующим образом: (1) Непрерывный поток (PBS) составляет 5 мкл/мин. (2) Инъекция 35 мкл EDC/NHS (1:1). (3) Инъекция 35 мкл фактора D человека в ацетатном буфере, pH 4,5. (4) Блокирование активной группы путем инъекции 35 мкл этиламина. (5) Очистка поверхности с помощью 5 мкл 10 мМ глицина pH 1,5. Уровень иммобилизации лиганда (фактора D человека) составляет примерно 1000 RU. Тестовым прогоном с использованием α-фактора D человека (huDi, 40 мкл, 31,5 мкг/л) получили относительный результат, составляющий примерно 900 RU.

Кинетический анализ - Все антитела Fab к фактору D человека разводили в буфере PBS. Каждый образец получали с серией концентраций: 12,5 нМ, 25 нМ, 50 нМ, 75 нМ, 100 нМ, 125 нМ и 150 нМ, с помощью 40 мкл импульсной инъекции с высокой скоростью обегания. Регенерацию выполняли путем применения импульсной инъекции 5 мкл 10 мМ глицина при рН 1,5. Кинетические параметры получали путем подбора следов связывания Fab к модели связывания 1:1 при условиях кинетики псевдопервого порядка с использованием программы BIAvaluation версии 3.0. Результаты представлены в таблице 4 ниже. Все данные получены с помощью всеобъемлющего анализа подбора.

Таблица 4
Результаты анализа BIAcore
Fab-клон ka (M-1s-1) kd (s-1) Kd (M)
Клон 315 антитела Fab к фактору D 7,1×105 2,7×10-4 3,7×10-10
Клон 416 антитела Fab к фактору D 8,2×105 l,8×10-4 3,3×10-10
Клон 345 антитела Fab к фактору D 6,8×105 3,5×10-4 5,1×10-10
Клон 250 антитела Fab к фактору D 5,7×105 l,9×10-4 3,3×10-10
Клон 56 антитела Fab к фактору D 3,6×105 9,8×10-4 2,7×10-9
Химерное антитело 4,4×105 l,2×10-3 2,7×10-9
Клон 111 антитела Fab к фактору D 3,3×105 3,7×10-4 1,14×10-9

Специалисты в данной области смогут распознать или они смогут обнаружить множество эквивалентов определенным вариантам осуществления описанного здесь изобретения с использованием не более чем обычных экспериментов. Подразумевается, что такие эквиваленты охвачены следующими пунктами формулы изобретения.

1. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит последовательность вариабельного домена тяжелой цепи SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12 и последовательность вариабельного домена легкой цепи SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9 или SEQ ID NO: 11.

2. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит последовательность вариабельного домена SEQ ID NO: 5 и последовательность вариабельного домена SEQ ID NO: 6.

3. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит последовательность вариабельного домена SEQ ID NO: 7 и последовательность вариабельного домена SEQ ID NO: 8, где аминокислотный остаток в положении 104 SEQ ID NO: 7 может быть замещен валином.

4. Антитело к фактору D или его функциональный фрагмент по п.3, в котором аминокислотный остаток в положении 104 последовательности SEQ ID NO: 7 представляет собой валин.

5. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит последовательность вариабельного домена SEQ ID NO: 9 и последовательность вариабельного домена SEQ ID NO: 10.

6. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит последовательность вариабельного домена SEQ ID NO: 11 и последовательность вариабельного домена SEQ ID NO: 12.

7. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит вариабельный участок легкой цепи, включающий участок CDR-L1, имеющий последовательность SEQ ID NO: 16; участок CDR-L2, имеющий последовательность SEQ ID NO: 17, 21 или 24, и участок CDR-L3, имеющий последовательность SEQ ID NO: 18, 19 или 22; и вариабельный участок тяжелой цепи, включающий участок CDR-H1, имеющий последовательность SEQ ID NO: 13, 23 или 25; участок CDR-H2, имеющий последовательность SEQ ID NO: 14; и участок CDR-H3, имеющий последовательность SEQ ID NO: 15 или 20, где антитело не содержит вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность SEQ ID NO: 1, и вариабельный домен легкой цепи, содержащий аминокислотную последовательность SEQ ID NO: 2.

8. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит вариабельный участок легкой цени, включающий участок CDR-L1, имеющий последовательность SEQ ID NO: 16; участок CDR-L2, имеющий последовательность SEQ ID NO: 21 или 24, и участок CDR-L3, имеющий последовательность SEQ ID NO: 18, 19 или 22; и вариабельный участок тяжелой цепи, включающий участок CDR-H1, имеющий последовательность SEQ ID NO: 13, 23 или 25; участок CDR-H2, имеющий последовательность SEQ ID NO: 14; и участок CDR-H3, имеющий последовательность SEQ ID NO: 15 или 20.

9. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит вариабельный участок легкой цепи, включающий участок CDR-L1, имеющий последовательность SEQ ID NO: 16; участок CDR-L2, имеющий последовательность SEQ ID NO: 17, 21 или 24, и участок CDR-L3, имеющий последовательность SEQ ID NO: 19 или 22; и вариабельный участок тяжелой цепи, включающий участок CDR-H1, имеющий последовательность SEQ ID NO: 13, 23 или 25; участок CDR-H2, имеющий последовательность SEQ ID NO: 14; и участок CDR-H3, имеющий последовательность SEQ ID NO: 15 или 20.

10. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит вариабельный участок легкой цепи, включающий участок CDR-L1, имеющий последовательность SEQ ID NO: 16; участок CDR-L2, имеющий последовательность SEQ ID NO: 17, 21 или 24, и участок CDR-L3, имеющий последовательность SEQ ID NO: 18, 19 или 22; и вариабельный участок тяжелой цепи, включающий участок CDR-H1, имеющий последовательность SEQ ID NO: 23 или 25; участок CDR-H2, имеющий последовательность SEQ ID NO: 14; и участок CDR-H3, имеющий последовательность SEQ ID NO: 15 или 20.

11. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит вариабельный участок легкой цепи, включающий участок CDR-L1, имеющий последовательность SEQ ID NO: 16; участок CDR-L2, имеющий последовательность SEQ ID NO: 17, 21 или 24, и участок CDR-L3, имеющий последовательность SEQ ID NO: 18, 19 или 22; и вариабельный участок тяжелой цепи, включающий участок CDR-H1, имеющий последовательность SEQ ID NO: 13, 23 или 25; участок CDR-H2, имеющий последовательность SEQ ID NO: 14; и участок CDR-H3, имеющий последовательность SEQ ID NO: 20.

12. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит вариабельный участок легкой цепи, включающий участок CDR-L1, имеющий последовательность SEQ ID NO: 16; участок CDR-L2, имеющий последовательность SEQ ID NO: 17, и участок CDR-L3, имеющий последовательность SEQ ID NO: 19; и вариабельный участок тяжелой цепи, включающий участок CDR-H1, имеющий последовательность SEQ ID NO: 13; участок CDR-H2, имеющий последовательность SEQ ID NO: 14; и участок CDR-H3, имеющий последовательность SEQ ID NO: 20.

13. Антитело к фактору D или его функциональный фрагмент по п.7, где антитело содержит полипептид, содержащий следующую аминокислотную последовательность: QX1QLVQSGX2E LKKPGASVKV SCKASGYTFT SYGMNWVX3QA PGQGLEWMGW INTYTGETTYADDFKGRFVF SLDTSVSTAY LQISSLKAED TAX4YYCX5REG GVNNWGQGTL VTVSS (SEQ ID NO: 27), где Х1 представляет собой I или V; Х2 представляет собой Р или S; Х3 представляет собой К или R; X4 представляет собой Т или V; и Х5 представляет собой Е или А.

14. Антитело к фактору D или его функциональный фрагмент по п.7, где антитело содержит полипептид, содержащий следующую аминокислотную последовательность: DIQX6TQSPSSLSX7SVGDRVTITCITSTDIDDDMNWYQQKPGKX8PKLLIX9DGNTLRPGVPSRFSX10SGSGX11DFTLTISSLQPEDV ATYYCLQSDSLPYTFGQGTKLEIK (SEQ ID NO: 26), где X6 представляет собой V или М; Х7 представляет собой М или A; X8 представляет собой Р или V; Х9 представляет собой S или Y; Х10 представляет собой S или G; и Х11 представляет собой А или Т, где аминокислотный остаток в положении 104 последовательности SEQ ID NO: 26 может быть замещен валином.

15. Антитело к фактору D или его функциональный фрагмент для лечения нарушений, опосредованных системой комплемента, где антитело содержит полипептид, содержащий аминокислотную последовательность SEQ ID NO: 27, и полипептид, содержащий аминокислотную последовательность SEQ ID NO: 26, где аминокислотный остаток в положении 104 последовательности SEQ ID NO: 26 может быть замещен валином.

16. Антитело к фактору D по п.15, где X1 означает I или V, X2 означает Р или S, Х3 означает К или R, X4 означает Т или V, Х5 означает Е или А, Х6 означает V или М, X7 означает М или A, X8 означает Р или V, Х9 означает S или Y, Х10 означает S или G, и X11 означает А или Т.

17. Антитело к фактору D или его функциональный фрагмент по пп.14, 15 или 16, в котором аминокислотный остаток в положении 104 последовательности SEQ ID NO: 26 представляет собой валин.

18. Антитело к фактору D или его функциональный фрагмент по любому из пп.1-16, где фрагмент представляет собой Fab, Fab', F(ab')2 или Fv фрагмент.

19. Антитело к фактору D или его функциональный фрагмент по любому из пп.1-16, где антитело является гуманизированным.

20. Антитело к фактору D или его функциональный фрагмент по любому из пп.1-16, где нарушение представляет собой глазное заболевание, такое как возрастная дегенерация желтого пятна или диабетическая ретинопатия.

21. Антитело к фактору D или его функциональный фрагмент по п.17, где фрагмент представляет собой Fab, Fab', F(ab')2 или Fv фрагмент.

22. Антитело к фактору D или его функциональный фрагмент по п.17, где антитело является гуманизированным.

23. Антитело к фактору D или его функциональный фрагмент по п.17, где нарушение представляет собой глазное заболевание, такое как возрастная дегенерация желтого пятна или диабетическая ретинопатия.

24. Выделенная нуклеиновая кислота, кодирующая антитело к фактору D или его функциональный фрагмент по любому из пп.1-23.

25. Вектор для экспрессии антитела к фактору D или его функционального фрагмента, включающий нуклеиновую кислоту по п.24.

26. Клетка-хозяин для продуцирования антитела к фактору D или его функционального фрагмента, содержащая вектор по п.25, где клетка-хозяин является прокариотической или эукариотической клеткой.

27. Композиция для лечения нарушений, опосредованных системой комплемента, содержащая антитело к фактору D или его функциональный фрагмент по любому из пп.1-19, 21 и 22, где антитело к фактору D или его функциональный фрагмент содержатся в дозе от 0,1 до 150 мг/кг массы тела субъекта.

28. Композиция по п.27, которая предназначена для введения человеку.

29. Композиция по п.27 или 28, где нарушение представляет собой глазное заболевание, такое как возрастная дегенерация желтого пятна или диабетическая ретинопатия.

30. Применение антитела к фактору D или его функционального фрагмента по любому из пп.1-19, 21 и 22 для лечения нарушений, опосредованных системой комплемента.

31. Применение по п.30, где нарушение представляет собой глазное заболевание, такое как возрастная дегенерация желтого пятна или диабетическая ретинопатия.

32. Способ получения антитела к фактору D или его функционального фрагмента, включающий культивирование клетки-хозяина по п.26 и очистку антитела или его функционального фрагмента антитела, экспрессированных в ней.



 

Похожие патенты:

Изобретение относится к области биотехнологии, в частности к полипептиду и его гомодимеру, которые обладают агонистической активностью в отношении рецептора гормона роста, молекуле нуклеиновой кислоты, их кодирующей, вектору, который включает данную нуклеиновую кислоту, клетке для экспрессии данного полипептида, фармацевтической композиции и способу с применением вышеуказанных полипептидов для лечения дефицита гормона роста.

Изобретение относится к области молекулярной генетики и касается рекомбинантной плазмиды pVA891-2[mutR], способа получения мутантных по гену mutR штаммов Streptococcus pyogenes и рекомбинантных штаммов Streptococcus pyogenes.

Изобретение относится к области биотехнологии, а именно к лиофилизированному ДНК-составу для применения в способе лечения ишемического заболевания и к способу лечения ишемического заболевания у индивидуума.

Изобретение относится к диагностическому и терапевтическому применению связывающих полипептидов по изобретению. .

Изобретение относится к области биотехнологии, а именно к плазмидной ДНК pCID-PROC для экспрессии рекомбинантного протеина С человека, линии клеток яичника китайского хомячка DG-CID-PROC-1 и способу получения рекомбинантного протеина С человека.

Изобретение относится к области биотехнологии, а именно к выделенному декапептиду или нонапептиду, способному индуцировать цитотоксические Т-клетки, а также к данным пептидам, в которых 1 аминокислота заменена, к полинуклеотиду, который кодирует данные пептиды, к фармацевтической композиции и вакцине, которые включают данные пептиды, способу индукции антиген-презентирующих клеток, способу индукции цитотоксических Т-клеток, выделенной цитотоксической CD8+Т-клетке, дендритной клетке, индуцирующей CTL и способу лечения заболевания, связанного с повышенной экспрессией генов SEQ ID NO: 1, 3 и/или 5.

Изобретение относится к диагностическому и терапевтическому применению связывающих полипептидов по изобретению. .

Изобретение относится к биохимии и представляет собой варианты гуманизированных антител и их фрагменты, которые связываются с белком Е2 вируса гепатита С. .

Гуманизированные антитела к фактору d и их применения

Наверх