Антитела к интерлейкину-1α и способы применения

Авторы патента:

 


Владельцы патента RU 2498998:

ИксБиотеч, Инк. (CA)

Изобретение раскрывает полностью человеческие моноклональные антитела (IgG аутоантитела), которые связываются с человеческим IL-1α. Антитело содержит тяжелую цепь, ковалентно связанную с легкой цепью, для которых определены аминокислотные последовательности. Антиген-связывающий вариабельный участок демонстрирует очень высокую аффинность связывания с IL-1α, а константный участок является эффективным как в активации системы комплемента посредством связывания C1q, так и в связывании с несколькими различными Fc-рецепторами. Описан также набор выделенных нуклеиновых кислот (НК), содержащий первую НК, кодирующую тяжелую цепь человеческого IgG mab, и вторую НК, кодирующую легкую цепь IgG mab. Набор выделенных НК может содержаться в экспрессирующем векторе или клетке-хозяине, в частности клетке млекопитающего, экспрессирующей легкую и тяжелую цепи антитела. Использование изобретения позволяет успешно применять такие Abs для лечения, предупреждения или обнаружения патологии, ассоциированной с абберантной экспрессией IL-1α. 2 н. и 5 з.п. ф-лы, 13 пр.

 

ПЕРЕКРЕСТНАЯ ССЫЛКА НА РОДСТВЕННЫЕ ЗАЯВКИ

В настоящей заявке заявлен приоритет предварительных заявок на патент США, серийные номера 61/057,586; 61/121,391 и 61/178,350, поданных 30 мая 2008 г., 10 декабря 2008 г. и 14 мая 2009 г., соответственно.

ПОЛОЖЕНИЕ ОТНОСИТЕЛЬНО ИССЛЕДОВАНИЯ, ФИНАНСИРУЕМОГО ИЗ ФЕДЕРАЛЬНОГО БЮДЖЕТА

Неприменимо.

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Изобретение относится к областям иммунологии, воспаления, рака, сосудистых расстройств и медицины. Более конкретно изобретение относится к антителам (Abs), которые специфически связывают интерлейкин-1α (IL-1α), и способам применения таких Abs для лечения, предупреждения или обнаружения патологии, ассоциированной с абберантной экспрессией IL-1α.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

IL-1α представляет собой провоспалительный цитокин, который играет роль во многих различных активностях, включая воспаление, иммунные ответы, опухолевые метастазы и кроветворение. IgG аутоантитела против (IL-1α) возникают естественным путем в стандартной человеческой популяции и, как полагают, являются полезными при таких заболеваниях, как атеросклероз.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Изобретение основано на разработке полностью человеческих моноклональных антител (mAbs), которые включают (1) антиген-связывающий вариабельный участок, который демонстрирует очень высокую аффинность связывания с человеческим IL-1α, и (2) и константный участок, который является эффективным как при активации системы комплемента через связывание с C1q, так и при связывании с несколькими различными Fc-рецепторами. Описанные в данной заявке mAbs, специфичные к IL-1α, были получены посредством замещения константного участка человеческого IgG4 mAb, имеющего вариабельный участок, специфичный в отношении человеческого IL-1α, константным участком человеческого IgG1 mAb.

Соответственно, изобретение относится к очищенному человеческому IgG1 mAb, которое специфически связывается с человеческим IL-1α, содержащему тяжелую цепь, ковалентно связанную с легкой цепью. Тяжелая цепь может включать аминокислотную последовательность SEQ ID NO: 9, и легкая цепь может включать аминокислотную последовательность SEQ ID NO: 11.

Изобретение также относится к набору выделенных нуклеиновых кислот, включающему первую нуклеиновую кислоту, кодирующую тяжелую цепь человеческого IgG1 mAb, которая специфически связывается с IL-1α, и вторую нуклеиновую кислоту, кодирующую легкую цепь человеческого IgG1 mAb, которая специфически связывается с человеческим IL-1α. Первая нуклеиновая кислота может кодировать аминокислотную последовательность SEQ ID NO: 9, и вторая нуклеиновая кислота может кодировать аминокислотную последовательность SEQ ID NO: 11. Первая нуклеиновая кислота может включать нуклеотидную последовательность SEQ ID NO: 10, и вторая нуклеиновая кислота может включать нуклеотидную последовательность SEQ ID NO: 12.

В другом аспекте изобретение относится к экспрессирующему вектору, включающему нуклеиновую кислоту, кодирующую аминокислотную последовательность SEQ ID NO: 9 или SEQ ID NO: 11.

Другой аспект изобретения относится к выделенной клетке-хозяину (например, клетке млекопитающих, такой как клетка CHO), включающей набор выделенных нуклеиновых кислот, в том числе первую нуклеиновую кислоту, кодирующую тяжелую цепь человеческого IgG1 mAb, которая специфически связывается с IL-1α, и вторую нуклеиновую кислоту, кодирующую легкую цепь человеческого IgG1 mAb, которая специфически связывается с человеческим IL-1α. Тяжелая цепь может включать аминокислотную последовательность SEQ ID NO: 9, и легкая цепь может включать аминокислотную последовательность SEQ ID NO: 11.

Изобретение также относится к способу уничтожения клетки, экспрессирующей человеческий IL-1α. Этот способ может включать стадию приведения клетки в контакт с очищенным человеческим IgG1 mAb, которое специфически связывается с человеческим IL-1α.

Способ ингибирования миграции человеческой клетки через матрикс базальной мембраны также находится в рамках данного изобретения. Этот способ может включать стадию добавления очищенного mAb, которое специфически связывается с человеческим IL-1α, к смеси, содержащей матрикс базальной мембраны и человеческую клетку.

Кроме того, в рамках изобретения предложен способ ингибирования IL-1α-индуцированного увеличения экспрессии ICAM-1 и/или Е-селектина на поверхности человеческой эндотелиальной клетки. Этот способ может включать стадию добавления очищенного mAb, которое специфически связывается с человеческим IL-1α, к смеси, содержащей эндотелиальную клетку и IL-1α.

Изобретение дополнительно включает способ контролирования воспаления у субъекта-человека, предварительно подвергнутого стадиям получения от субъекта первого образца мононуклеарных клеток периферической крови в первый раз; приведения первого образца в контакт с очищенным mAb, которое специфически связывается с человеческим IL-1α; и определения в первом образце процента клеток, которые связываются с моноклональным Ab. Этот способ может включать стадии: (а) получение от субъекта второго образца мононуклеарных клеток периферической крови во второй раз; (б) приведение второго образца в контакт с очищенным mAb, которое специфически связывается с человеческим IL-1α; (в) определение во втором образце процента клеток, которые связываются с моноклональным Ab; и (г) сравнение процента клеток в первом образце, которые связываются с mAb, с процентом клеток во втором образце, которые связываются с mAb.

В вышеупомянутых способах очищенное mAb может представлять собой человеческое IgG1 mAb, включающее тяжелую цепь, ковалентно связанную с легкой цепью, например, где тяжелая цепь содержит аминокислотную последовательность SEQ ID NO: 9, и легкая цепь содержит аминокислотную последовательность SEQ ID NO: 11.

Другой способ в рамках изобретения включает стадии: (а) обогащения биологического образца, полученного от субъекта-человека с использованием фильтра для разделения молекул в соответствии с молекулярной массой на первую фракцию, содержащую интактный IgG в комплексе с IL-1α, и вторую фракцию, содержащую молекулы менее 100 кДа; и (б) определения количества IL-1α в первой фракции.

Еще один способ в рамках изобретения включает стадии: (а) обогащение образца плазмы, полученной от субъекта-человека с использованием фильтра, который разделяет молекулы в соответствии с молекулярной массой на первую фракцию, включающую интактный IgG в комплексе с IL-1α, и вторую фракцию, включающую молекулы менее 100 кДа; (б) добавление первой фракции к субстрату, включающему иммобилизованные Abs против IgG человека в условиях, которые позволяют IgG в первой фракции специфически связываться с Abs против IgG человека, иммобилизованными на субстрате; (в) промывание субстрата для удаления из первой фракции вещества, которое не связывается специфически с имобилизованными Abs против IgG человека; (г) приведение субстрата, промытого на стадии (в), в контакт с Ab, которое специфически связывается с человеческим IL-1α, в условиях, которые позволяют Ab, которое специфически связывается с человеческим IL-1α, специфически связываться с любым человеческим IL-1α, связанными с указанным субстратом; (д) промывание субстрата для удаления любого Ab, которое специфически связывается с человеческим IL-1α, который не связан с субстратом; и (е) определение количества Ab, которое специфически связывается с человеческим IL-1α, оставшегося связанным с субстратом после стадии (д).

Если не определено иное, то все технические термины, используемые в данной заявке, имеют такое же значение, которое обычно понятно среднему специалисту в данной области техники, к которой относится данное изобретение. Общепринятые определения биологических терминов можно найти в Rieger et al., Glossary of Genetics: Classical and Molecular, 5th edition. Springer-Verlag: New York, 1991; и Lewin, Genes V, Oxford University Press: New York, 1994.

Термин "специфически связанный", используемый в данной заявке, в случае полипептида (включая Abs) или рецептора, относится к реакции связывания, которая определяет присутствие белка, или полипептида, или рецептора в гетерогенной популяции белков или других биологических агентов. Таким образом, при заданных условиях (например, условиях иммуноанализа в случае Ab) специфический лиганд или Ab связывается со своей конкретной "мишенью" и не связывается в значительном количестве с другими белками, присутствующими в образце, или с другими белками, с которыми лиганд или Ab может вступить в контакт в организме. Как правило, первая молекула, которая "специфически связывается" со второй молекулой, имеет равновесную константу аффинности, которая больше чем примерно 105 (например, 106, 107, 108, 109, 1010, 1011 и 1012 или более) литров/моль для этой второй молекулы.

Когда речь идет о молекуле белка, такой как Ab, "очищенный" означает отделенный от компонентов, которые в природных условиях сопровождают такие молекулы. Как правило, Ab или белок являются очищенными, когда они по меньшей мере примерно на 10% (например, 9%, 10%, 20%, 30% 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99,9% и 100%), по массе, свободны от не-Ab белков или других, встречающихся в природе органических молекул, с которым они естественным образом связаны. Чистота может быть измерена любым подходящим способом, например, посредством колоночной хроматографии, электрофореза в полиакриламидном геле или ВЭЖХ-анализа. Химически синтезированный белок или другой рекомбинантный белок, продуцируемый типом клетки, отличным от типа клетки, в котором он встречается в природе, является "очищенным".

Хотя способы и вещества, аналогичные или эквивалентные описанным в данной заявке, могут быть использованы на практике и при тестировании настоящего изобретения, подходящие методы и вещества описаны ниже. Все публикации, упомянутые в данной заявке, включены посредством ссылки во всей своей полноте. В случае противоречия настоящее описание, включая определения, будет контролироваться. Кроме того, конкретные воплощения, описанные ниже, являются только иллюстративными и не предназначены быть ограничивающими.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Изобретение охватывает композиции и способы, относящиеся к полностью человеческим mAbs, которые включают (1) антиген-связывающий вариабельный участок, который демонстрирует очень высокую аффинность связывания с IL-1α, и (2) константный участок, который является эффективным как при активации системы комплемента посредством связывания C1q, так и при связывании с несколькими разными Fc-рецепторами. Нижеописанные предпочтительные воплощения иллюстрируют применение этих композиций и способов. Однако из описания этих воплощений могут быть получены и/или применены на практике другие аспекты изобретения, основанные на описании, приведенном ниже.

В данной заявке описаны способы, включающие стандартные иммунологические и молекулярно-биологические методики. Иммунологические методы (например, анализы в отношении обнаружения и локализации комплексов антиген-Ab, иммуноприцепитация, иммуноблоттинг и тому подобное) широко известны в данной области техники и описаны в таких монографиях по методологии, как Current Protocols in Immunology, Coligan et al., ed., John Wiley & Sons, New York. Методы молекулярной биологии подробно описаны в таких монографиях, как Molecular Cloning: A Laboratory Manual, 2nd ed., vol. 1-3, Sambrook et al,, ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001 и Current Protocols in Molecular Biology, Ausubel et al., ed., Greene Publishing and Wiley-Interscience, New York. Методы с Ab описаны в Handbook of Therapeutic Abs, Dubel, S., ed., Wiley-VCH, 2007. Методы культивирования клеток, как правило, известны в данной области техники и подробно описаны в таких монографиях по методологии, как Culture of Animal Cells: A Manual of Basic Technique, 4th edition, by R Ian Freshney, Wiley-Liss, Hoboken, N.J., 2000 и General Techniques of Cell Culture, by Maureen A Harrison and Ian F Rae, Cambridge University Press, Cambridge, UK, 1994. Способы очистки белков описаны в Guide to Protein Purification: Methods in Enzymology, Vol.182, Deutscher M P, ed., Academic Press, San Diego, Calif., 1990.

В одном аспекте изобретение относится к полностью человеческому mAb, которое включает (1) антиген-связывающий вариабельный участок, который демонстрирует очень высокую аффинность связывания с человеческим IL-1α, и (2) константный участок, который является эффективным как при активации системы комплемента посредством связывания C1q, так и при связывании с несколькими разными Fc-рецепторами. Человеческое Ab представляют собой предпочтительно IgG1. Ка Ab составляет предпочтительно по меньшей мере 1×109 М-1 или более (например, более чем 9×1010 М-1, 8×1010 M-1, 7×1010 M-1, 6×1010 M-1, 5×1010 M-1, 4×1010 M-1, 3×1010 М-1, 2×1010 М-1 или 1×1010 М-1).

Поскольку В-лимфоциты, которые экспрессируют Ig, специфичные в отношении человеческого IL-1α, появляются естественным образом у человеческих существ, в настоящее время предпочтительный способ увеличения mAbs заключается, во-первых, в выделении такого В-лимфоцита из субъекта с последующей его иммортализацией таким образом, чтобы он мог непрерывно реплицироваться в культуре. Субъекты, лишенные большого количества встречающихся в природе В-лимфоцитов, которые экспрессируют Ig, специфичный в отношении человеческого IL-1α, могут быть иммунизированы одним или более человеческими антигенами IL-1α для увеличения количества таких В-лимфоцитов. Человеческие mAbs получают посредством иммортализации клетки, секретирующей человеческое Ab (например, человеческой плазматической клетки). См., например, патент США №4,634,664.

В примерном способе один или более (например, 5, 10, 25, 50, 100, 1000 или более) субъектов-людей (например, субъектов, которым предварительно не вводили вакцину против человеческого IL-1α) подвергают скринингу на присутствие в их крови такого Ab, специфичного в отношении человеческого IL-1α. Те субъекты, которые экспрессируют желаемое Ab, затем могут быть использованы в качестве доноров В-лимфоцитов. В одном возможном способе периферическую кровь получают от донора-человека, который имеет В-лимфоциты, экспрессирующие Ab, специфичное к человеческому IL-1α. Такие В-лимфоциты затем выделяют из образца крови, например, посредством сортировки клеток (например, активированной флуоресценцией сортировки клеток, "FACS"; или сортировки клеток с помощью магнитных шариков) для выделения В-лимфоцитов, экспрессирующих Ig, специфичный в отношении человеческого IL-1α. Эти клетки затем могут быть иммортализованы посредством вирусной трансформации (например, с использованием EBV (вирус Эпштейна-Барр)) или путем слияния с другой иммортализованной клеткой, такой как человеческая миелома, в соответствии с известными способами. В-лимфоциты в пределах этой популяции, которая экспрессирует Ig, специфичный в отношении человеческого IL-1α, затем могут быть выделены способами ограничивающего разведения (например, клетки в лунках микротитрационного планшета, которые являются положительными в отношении Ig, специфичного в отношении человеческого IL-la, выделяют и субкультивируют и процесс повторяют до тех пор, пока не выделят желаемую клональную линию). См., например, Goding, Monoclonal Abs: Principles and Practice, pp.59-103, Academic Press, 1986. Эти клональные клеточные линии, которые экспрессируют Ig, имеющий по меньшей мере наномолярные или пикомолярные аффинности связывания с человеческим IL-1α, являются предпочтительными. MAbs, секретируемые этими клональными клеточными линиями, могут быть очищены из культуральной среды или жидкости организма (например, асцитов) стандартными процедурами очистки Ig, такими как высаливание, эксклюзионная хроматография, ионообменное разделение и аффинная хроматография.

Хотя иммортализованные В-лимфоциты могут быть использованы в культурах in vitro для непосредственной продукции mAbs, в некоторых случаях может быть желательным использование гетерологичных экспрессирующих систем для продукции mAbs. См., например, способы, описанные в заявке на патент США №11/754,899. Например, гены, кодирующие mAb, специфичное в отношении человеческого IL-1α, могут быть клонированы и встроены в экспрессирующий вектор (например, экспрессирующий вектор на основе плазмиды) для экспрессии в гетерологичной клетке-хозяине (например, клетках СНО, клетках COS, клетках миеломы и клетках E. coli). Поскольку Igs включают тяжелую (H) и легкую (L) цепи в H2L2-конфигурации, гены, кодирующие каждую из них, могут быть отдельно выделены и экспрессированы в различных векторах.

Хотя обычно менее предпочтительно, в данном изобретении могут быть использованы химерные mAbs (например, "гуманизированные" mAbs), которые представляют собой антиген-связывающие молекулы, имеющие различные участки, происходящие из различных видов животных (например, вариабельный участок мышиного Ig, слитый с константным участком человеческого Ig). Такие химерные Abs могут быть получены способами, известными в данной области техники. Например, Morrison et al., Proc. Nat'l. Acad. Sci. USA, 81:6851, 1984; Neuberger et al., Nature, 312:604, 1984; Takeda et al., Nature, 314:452, 1984. Аналогично, Abs могут быть гуманизированы способами, известными в данной области техники. Например, моноклональные Abs с желаемой специфичностью связывания могут быть коммерчески гуманизированы или, как описано в патентах США №№5,693,762; 5,530,101 либо 5,585,089.

mAbs, описанные в данной заявке, могут быть созревшими в отношении аффинности для увеличения или иным образом изменения специфичности связывания посредством известных способов, таких как перестановка VH- и VL-доменов (Marks et al. Bio/Technology 10:779-783, 1992), случайный мутагенез гипервариабельных участков (HVRs) и/или каркасных остатков (Barbas et al. Proc Nat. Acad. Sci. USA 91:3809-3813, 1994; Schier et al. Gene 169:147-155, 1995; Yelton et al. J. Immunol. 155:1994-2004, 1995; Jackson et al., J. Immunol. 154(7):3310-9, 1995 и Hawkins et al, J. Mol. Biol. 226:889-896, 1992. Варианты аминокислотных последовательностей Ab могут быть получены посредством внесения соответствующих изменений в нуклеотидную последовательность, кодирующую Ab. Кроме того, модификации последовательностей нуклеиновых кислот, кодирующих mAbs, могут быть изменены (например, без изменения аминокислотной последовательности mAb) для увеличения продукции mAb в некоторых экспрессирующих системах (например, удаление интрона и/или оптимизация кодонов для данной экспрессирующей системы). mAbs, описанные в данной заявке, также могут быть изменены путем конъюгации с другим белком (например, другим mAb) или небелковой молекулой. Например, mAb может быть конъюгировано с водорастворимым полимером, таким как полиэтиленгликоль или углеродная нанотрубка (См., например, Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605, 2005). См. заявку на патент США №11/754,899.

Предпочтительно, для обеспечения высоких титров mAb, специфичного в отношении человеческого IL-1α, при введении субъекту с минимальными побочными эффектами, композиции mAb по изобретению являются по меньшей мере на 0,5, 1, 2, 3, 4,5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 95, 96, 97, 98, 99, 99,9 или более процентов по массе чистыми (исключая какие-либо эксципиенты). Композиции mAb по изобретению могут включать только один тип mAb (то есть один, производимый одной клональной линией В-лимфоцитов) или могут включать смесь двух или более (например, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более) различных типов mAbs. В дополнение к mAbs против человеческого IL-1α композиции Ab и по изобретению также могут включать другие mAbs, которые специфически связывают иные, чем человеческий IL-1α, антигены.

Для модификации или усиления их функции mAbs против человеческого IL-1α могут быть конъюгированы с другой молекулой, такой как цитотоксин или детектируемый маркер. mAb, специфичное в отношении человеческого IL-1α, может быть конъюгировано с одним или более цитотоксинами для более эффективного уничтожения клеток, экспрессирующих IL-1α. Цитотоксины для применения в изобретении могут представлять собой любой цитотоксический агент (например, молекулу, которая может убить клетку после контактирования с ней), который может быть конъюгирован с mAb, специфичным к человеческому IL-1α. Примеры цитотоксинов включают, без ограничения, радионуклиды (например, 35S, 14C, 32P, 125I, 131I, 90Y, 89Zr, 201Tl, 188Re, 188Re, 57Cu, 213Bi и 211At), конъюгированные радионуклиды и химиотерапевтические агенты. Другие примеры цитотоксинов включают, но не ограничиваются этим, антиметаболиты (например, 5-фторурацил (5-FU), метотрексат (МТХ), флударабин и т.д.), антимикротрубочковые агенты (например, винкристин, винбластин, колхицин, таксаны (такие как паклитаксел и доцетаксел) и т.д.), алкилирующие агенты (например, циклофосфамид, мелфалан, бисхлорэтилнитрозомочевина (BCNU) и т.д.), платиновые агенты (например, цисплатин (также называемый cDDP), карбоплатин, оксалиплатин, JM-216, CI-973 и т.д.), антрациклины (например, доксорубицин, даунорубицин и т.д.), антибиотики (например, митомицин-С), ингибиторы топоизомераз (например, этопозид, тенипозид и камптотецин) или другие цитотоксические агенты, такие как рицин, дифтерийный токсин (DT), псевдомонадный экзотоксин (РЕ) A, PE40, абрин, сапорин, антивирусный белок лаконоса (pokeweed viral protein), бромистый этидий, глюкокортикоид, сибиреязвенный токсин и другие. См., например, патент США №5,932,188.

mAb, специфичное в отношении человеческого IL-1α, также может быть конъюгировано с детектируемым маркером. Используемые детектируемые маркеры в настоящем изобретении включают биотин или стрептавидин, магнитные шарики, флуоресцентные красители (например, флуоресцеинизотиоцианат, техасский красный, родамин, зеленый флуоресцентный белок и тому подобное), радиоактивные метки (например, 3H, 125I, 35S, 14C, 32P, 111In, 97Ru, 67Ga, 68Ga, or 72As), рентгеноконтрастные вещества, такие как металлы для радиовизуализации, парамагнитные агенты для магнитно-резонансной визуализации, ферменты (например, пероксидаза хрена, щелочная фосфатаза и другие, часто используемые в ELISA (твердофазный иммуноферментный анализ)) и колориметрические метки, такие как коллоидное золото, или цветное стекло, или пластмассовые (например, полистирольные, полипропиленовые, латексные и т.д.) шарики. Способы определения таких меток хорошо известны специалистам в данной области техники. Таким образом, например, радиоактивные метки могут быть обнаружены с использованием фотопленки или сцинтилляционных счетчиков. Флуоресцентные маркеры также могут быть использованы и могут быть обнаружены с использованием фотодетектора для обнаружения испускаемого света. Ферментативные метки обычно обнаруживают путем обеспечения фермента субстратом и определения продукта реакции, возникающего в результате действия фермента на субстрат, а колориметрические метки определяют простой визуализацией цветной метки.

Настоящее изобретение также охватывает молекулы нуклеиновой кислоты, кодирующие полностью человеческие mAbs, специфичные в отношении человеческого IL-1α. Хотя одна и та же молекула нуклеиновой кислоты может кодировать как тяжелую, так и легкую цепи mAb, специфичного в отношении человеческого IL-1α, могут быть использованы также две разные молекулы нуклеиновой кислоты: одна, кодирующая тяжелую цепь, и другая, кодирующая легкую цепь. Аминокислотные последовательности трех IgG1 mAbs, специфичных в отношении человеческого IL-1α, представлены в данной заявке. См. SEQ ID NO: 1, 3, 5, 7, 9 и 11. Типичные молекулы нуклеиновой кислоты, кодирующие аминокислотные последовательности, также описаны в данной заявке. См. SEQ ID NO: 2, 4, 6, 8, 10 и 12. В рамках изобретения также может быть использована любая другая подходящая нуклеиновая кислота, которая кодирует аминокислотные последовательности двух описанных IgG1 mAbs или других mAbs.

Для продукции mAbs молекулы нуклеиновой кислоты по изобретению могут быть включены в экспрессирующий вектор в ориентации, при которой такие молекулы нуклеиновой кислоты функциональным образом связаны с контролирующими экспрессию последовательностями, такими как транскрипционные и трансляционные контролирующие последовательности. Примеры экспрессирующих векторов включают векторы, происходящие из плазмид, и векторы, происходящие из вирусов, таких как аденовирусы, адено-ассоциированные вирусы и ретровирусы. Молекулы нуклеиновой кислоты, кодирующие легкую цепь и тяжелую цепь, могут быть включены в один вектор или разные векторы. Векторы по изобретению также могут включать регуляторные последовательности, такие как промоторы и/или энхансеры (См. патент США №5,168,062, патент США №4,510,245 и патент США №4,968,615), селектируемые маркеры или последовательности, кодирующие аффинные метки (для облегчения очистки), или детектируемый маркер.

Для продукции mAbs векторы по изобретению могут быть введены в подходящую клетку-хозяина, например прокариотическую клетку, такую как бактериальная или, предпочтительно, эукариотическая клетка, такая как хозяйская клетка млекопитающих, растений или дрожжей. Примеры способов введения гетерологичных полинуклеотидов в клетки-хозяева включают использование вирусных векторов, электропорации, инкапсуляции полинуклеотида(ов) в липосомы, декстран-опосредованной трансфекции, преципитации фосфатом кальция, полибрен-опосредованной трансфекции, слияния протопластов, трансформации с помощью агробактерий, биолистической трансформации и прямой микроинъекции ДНК в ядро. Клеточные линии млекопитающих в настоящее время являются предпочтительными для экспрессии mAbs из векторов. Примеры хозяйских клеток млекопитающих включают клетки яичника китайского хомячка (CHO) (например, клеточная линия CHO DG44), клетки HeLa, клетки почки сирийского хомячка (BHK), клетки почки африканской зеленой мартышки (COS), клетки человеческой гепатоцеллюлярной карциномы (например, Нер G2), клетки NSO, клетки SP2, клетки НЕК-293Т, клетки 293 Freestyle и клетки NIH-3T3. mAbs по изобретению также можно экспрессировать в трансгенных животных или растениях. См., например, патенты США №№5,827,690; 5,756,687; 5,750,172; 5,741,957; 6,046,037 и 5,959,177.

В изобретении предложен способ определения клетки, экспрессирующей человеческий IL-1α, в образце посредством приведения указанной клетки в контакт с mAb, специфичным в отношении человеческого IL-1α, и обнаружения mAb, связанного с указанной клеткой. В изобретении также предложен способ уничтожения клетки, экспрессирующей человеческий IL-1α, посредством приведения указанной клетки в контакт с mAb, специфичным в отношении человеческого IL-1α. Такое уничтожение может быть осуществлено посредством комплемент-опосредованного уничтожения, антитело-зависимой, клеточно-опосредованной цитотоксичности или антитело-опосредованной доставки цитотоксина. Показали, что Abs, описанные в данной заявке, являются полезными для других способов. Например, MABp1 снижали IL-1α-индуцированный ICAM1 и экспрессию Е-селектина на эндотелиальных клетках. Также показали, что MABp1 используют в иммуноанализах для выявления и количественного определения IL-1α в биологическом образце.

ПРИМЕРЫ

Пример 1 - Клонирование анти-hIL-1α IgG1 и каппа-цепей

Последовательности вариабельного участка тяжелой цепи (V-HC) и вариабельного участка легкой цепи (V-LC) были синтезированы с гена с использованием информации об аминокислотной последовательности, представленной в патенте США №5,959,085. V-HC амплифицировали с помощью ПЦР, внедряя Hindlll/Clal-сайты перед стартовым кодоном ATG и Nhel-сайт на 3'-конце. Константный участок IgG1 зародышевой линии человека (включая экзоны и интроны) амплифицировали с помощью ПЦР, модифицируя два 5'-триплета, кодирующих первые две аминокислоты Ala-Ser в Nhel-сайте, и внедряя BamHI-сайт на 3'-конце. Аминокислотная последовательность константного участка IgGI зародышевой линии человека соответствовала Swiss-Prot вход Р01857, за исключением K171Q и V261L обмена. V-HC и константную последовательность IgG1-HC лигировали с использованием Nhel-сайта и клонировали в pcDNA3 с использованием Hindlll- и BamHl-сайтов.

>hIL-1a-IgG1-HC

MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSMFGVHWV

RQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFLQMDSLRLEDTAV

YYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVFPLAPSSKSTSGGTAALGCLV

KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH

KPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSHEDPEVKFNWYVDGVEVHNAQTKPREEQYNSTYRVVSVLTVLHQDWLNG

KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP

SDIALEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA

LHNHYTQKSLSLSPGK (SEQ ID NO: 1)

>hIL-1a-IgG1-HC

atggagttcgggctgagttgggtgttcctggtggctctgctgcggggcgtgcagtgccaggtgcagctggtggagagtgggggtggc

gtggtgcagcctggccggtctctgcgcctgtcttgcactgcctccggttttaccttttctatgtttggtgtgcactgggtgcgccaggctcc

cggcaagggactggaatgggtggccgccgtgagttacgacgggtccaacaaatattacgctgagagcgtgaaaggcagattcaccat

cagcagagataattccaagaatattctgttcctgcagatggacagtctgagactggaggacactgctgtgtactactgcgctcgtggacg

ccctaaggtggtcatccccgcccccctggcacattggggccagggaactctggtgaccttttctagcgctagcaccaagggcccatcg

gtcttccccctggcaccctcctccaagagcacctctgggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccg

gtgacggtgtcgtggaactcaggcgccctgaccagcggcgtccacaccttcccggctgtcctacagtcctcaggactctactccctca

gcagcgtagtgaccgtgccctccagcagcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtg

gacaagaaagttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtct

tcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaaga

ccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgcccagacaaagccgcgggaggagcagtacaacagc

acgtaccgtgtggtcagcgtccteaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagcc

ctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccggga

tgagctgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccctggagtgggagagcaatgg

gcagccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaa

gagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctcctta agtccgggaaaataa (SEQ ID NO: 2)

V-LC амплифицировали с помощью ПЦР, внедряя Hmdlll/Clal-сайты перед стартовым кодовом ATG и BsiWI-сайт на 3'-конце. Человеческую константную последовательность каппа-LC амплифицировали с помощью ПЦР, внедряя 5' BsiWI-сайт, кодирующий дополнительный Arg и первые аминокислоты Thr, и BamHI-сайт на 3'-конце. Человеческая константная аминокислотная последовательность каппа-LC соответствовала Swiss-Prot вход Р01834. V-HC и константную последовательность каппа-LC лигировали с использованием BsiWI-сайта и клонировали в pcDNA3, используя HindIII и BamHI-сайты.

>hIL-1a-K-LC

MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQGISSWLAW

YQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSLQPEDFATYYCQQTSSF

LLSFGGGTKVEHRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN

ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF

NRGEC [SEQ ID NO: 3]

>hIL-1a-K-LC

Atggacatgcgcgtgcccgcccagctgctggggctgctgctgctgtggttccctggatctaggtgcgacattcagatgacccagtccc

ccagctcagtgtcagcctccgtgggcgacagagtgacaatcacctgccgcgcctctcagggaatctctagttggctggcctggtacca

gcagaagcctggaaaggcccccaagctgctgatctatgaagcctccaacctggagaccggcgtgccctctcgcttcagcggctcagg

ctcaggcagtgattttactctgaccatcagctccctgcagccagaggatttcgctacttactactgccagcagacctcttccttcctgctgtc

cttcgggggaggcacaaaggtggagcaccgtacggtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctg

gaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagtacagtggaaggtggataacgccctccaatcgggt

aactcccaggagagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaagcagact

acgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgagttcaccggtgacaaagagcttcaacaggggagagtgtt

ag [SEQ ID NO: 4]

Пример 2 - Получение NATHMAB-hIL-1a IgG1 и каппа-цепи

Полную последовательность, кодирующую тяжелую цепь NATHMAB-hlL-1a/lgG1, синтезировали с использованием гена. Последовательность V-HC соответствовала аминокислотной последовательности, описанной в патенте США №5,959,085. Человеческая константная последовательность IgG1-HC соответствовала Swiss-Prot вход Р01857. Нуклеотидную последовательность подвергали оптимизации кодонов для экспрессии в клетках CHO. Последовательность Козака (gccacc) добавляли перед стартовым ATG.

>NATHMAB-hIL-1A-IGG1-HC

MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSMFGVHWV

RQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFLQMDSLRLEDTAV

YYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVFPLAPSSKSTSGGTAALGCLV

KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH

KPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG

KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP

SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE

ALHNHYTQKSLSLSPGK [SEQ ID NO: 5]

>NATHMAB-hIL-1A-IGG1-HC

gccaccatggagtttggtctgtcctgggtgttcttggtggctctgctgaggggggtgcagtgccaggtocagctggtggagtctggtgg

gggagtggtgcagcctgggagatctctgcggctgtcttgcactgcctctggtttcactttctctatgtttggtgtgcattgggtcaggcaag

caccaggcaaaggactcgagtgggtcgcagctgtgagctatgacgggtctaacaaatattacgctgagtctgtcaagggtaggtttacc

atoagccgggataattccaaaaatatcctgttcctgcaaatggactctctgaggctggaagatactgcagtctactattgtgcaaggggg

aggccaaaggtggtgatccccgctcccctcgctcactggggacagggaaccctggtgactttcagctctgctagcaccaagggccct

agcgtgttcccattggctccttcctccaaatctacttctggaggcaccgccgccctgggatgtctcgtgaaagattattttcctgagcccgt

caccgtgagctggaacagcggcgccctgactagcggcgtgcacacctttcccgcagtgctgcaatctagcgggctgtactccctgag

ctctgtcgtgaccgtgccctccagcagcctcggaactcagacctacatctgcaatgtcaatcataaaccctctaataccaaagtcgataa

gaaggtcgaacctaaatcttgcgataaaacccatacctgccccccttgcccagcacccgaactgctgggcggtccctctgtgtttctgtt

cccccccaaacccaaagataccctgatgatctctaggacccccgaggtcacttgtgtcgtggtggatgtgtcccacgaagatccagaa

gtcaaattcaactggtatgtggacggggtcgaagtgcacaacgcaaagaccaagcctagggaggaacagtataatagcacatatagg

gtggtcagcgtcctgaccgtcctgcatcaggactggctgaatggcaaagaatataagtgtaaagtgtccaacaaggccctgccagccc

caatcgaaaagacaatctctaaagccaaggggcaaccccgggaacctcaggtctatacactgccaccctctcgggatgaactgacca

agaatcaggtgagcctgacatgtcttgtgaagggtttttatccctccgacattgccgtggagtgggagagcaatggacaaccagaaaat

aactacaaaaccacaccccctgtgctggactccgatggttccttcttcctctactctaagctgacagtggataagtctaggtggcagcag

gggaatgtgttctcctgctctgtgatgcacgaggcactgcacaatcattatacacaaaagtctctgtctctgtctccaggaaagtaa [SEQ ID NO: 6]

Полную последовательность, кодирующую NATHMAB-hlL-1a/каппа-легкую цепь, синтезировали с использованием гена. Последовательность V-HC соответствовала аминокислотной последовательности, описанной в патенте США №5,959,085. Человеческая константная последовательность каппа-LC соответствовала Swiss-Prof вход Р01834. Нуклеотидную последовательность подвергали оптимизации кодонов для экспрессии в клетках СНО. Последовательность Козака (gccacc) добавляли перед ATG.

>NATHMAB-hIL-1A-K-LC

MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQGISSWLAW

YQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSLQPEDFATYYCQQTSSF

LLSFGGGTKVEHTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA

LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR

GEC [SEQ ID NO: 7]

NATHMAB-hIL-1A-K-LC

gccaccatggacatgcgcgttcctgcccagctcctcggactgctgctgctttggttcccaggctcccggtgtgatattcagatgacacag

tctccctcctccgtatctgcatccgtgggcgacagggtcacaatcacttgtagggccagccaggggatctctagttggctcgcatggtac

caacaaaagccaggtaaggctccgaaactgctcatttacgaagctagtaacctcgaaacaggcgtgccaagccggtttagcggctcc

ggttccggttctgacttcaccctcactatttcctccctgcaacctgaggattttgccacatattactgtcagcaaacttcttcttttctgctctcc

tttggtgggggaactaaggtggagcacacagtggccgcccccagcgtctttatcttccccccaagcgatgaacagctgaagtcaggga

ccgccagcgtggtctgcctgctcaataatttttaccctcgcgaggctaaggtccaatggaaagtggataacgccctccagagcggtaac

tctcaggagtctgtcacagagcaagacagcaaggatagcacctattccctctccagcaccctgacactgtctaaggccgactacgaga

aacacaaagtgtacgcttgtgaggtgactcaccagggactgagtagccctgtgacaaaatctttcaataggggagaatgctga [SEQ ID NO: 8]

Пример 3 - Экспрессия NATHMAB-IL1-a (субтип IgG1/k)

NATHMAB-IL-1α экспрессировали и выделяли с использованием метода временной трансфекции. Супернатант клеточной культуры или Аb, очищенное с помощью протеин G-аффинной колонки, подвергали дальнейшему анализу, как описано ниже. Клетки эмбриональной почки человека (НЕК) 293Т культивировали в DMEM, содержащей 10% PCS, и подвергали временной трансфекции с использованием реагента jetPEI (Polyplus) согласно протоколу производителя. Клетки высевали на 10 см чашки (3×106 клеток на 10 см чашку) за 24 ч до трансфекции для достижения приблизительно 50%-ной плотности на момент трансфекции. Для трансфекции использовали 5 мкг pcDNAS-aHTH-hIL-1α-IgG1-HC и двукратный молярный избыток pcDNA3-анти-hIL-1α-каппа на чашку. После восстановления среду меняли на DMEM, содержащую 2% PCS (10 мл на чашку), и Ab собирали в течение 5-6 суток. Супернатант собирали, фильтровали, pH доводили до 7,5-8 и хранили при 4°C до следующего применения.

Часть супернатанта (250 мл) инкубировали с протеин G-сефарозой (GE Healthcare) в течение 3 ч при 4°C на вращающемся круге. Затем протеин G-сефарозу загружали в колонку самотечного типа и промывали PBS. Ab элюировали в 1 мл фракциях, используя 100 мМ глицин/150 мМ NaCl в 100 мкл Трис (pH 8), с последующим диализом в PBS, содержащем 10% глицерина. Концентрацию общего белка в каждой фракции измеряли с помощью набора для определения белка ВСА Protein Detection Kit (Pierce), Правильный размер тяжелых и легких цепей и собранного нативного Ab подтверждали с помощью SDS-PAGE (гель-электрофорез в полиакриламидном геле с додецилсульфатом натрия).

Супернатант, содержащий очищенное Ab NATHMAB-hIL-1α и Тритон X-100 клеточные лизаты клеток-продуцентов HEK 293Т, тестировали на связывание антигена в радиоиммунологическом анализе (RIA) с использованием 125I-hIL-1α. Связывание анализировали по поглощению белка G. Все образцы связывали 125I-hIL-1α с наибольшей активностью в элюате. Связывание очищенного NATHMAB-hIL-1α в концентрации 0,012% (полумаксимальная активность в RIA) с 125I-hIL-1α использовали для измерения коэффициента аффинности. Ка NATHMAB-hIL-1α в этих условиях составляла 3,03×1010 М-1. Расчет по результатам измерений выявил предполагаемую концентрацию приблизительно 30 мкг/мл активного анти-hIL-1α-IgG в очищенном элюате.

Нейтрализующую активность NATHMAB-hIL1α определяли в биоанализе с использованием мышиной сублинии EL4-6.1, которая продуцирует высокие уровни IL-2 при обработке мышиным или человеческим IL-1α (Zubler et а1., J. Immunol. 134:3662-3668, 1985). Указанные концентрации NATHMAB-hIL-1α (элюат) инкубировали в течение 30 мин при 37°C с различными концентрациями рекомбинантного hIL-1α (eBioscience) в конечном объеме 100 мкл/лунку в 96-луночном планшете для культивирования (плоскодонный). Каждую точку получали в трех повторах и в культуральной среде (DMEM, 5% FCS). В каждую лунку добавляли 100 мкл суспезии клеток EL4-6.1 (5×105 клеток/мл) в культуральной среде, содержащей 0,2 мкг/мл иономицина. После инкубации в течение 24 ч при 37°C в инкубаторе с 5% СО2 бесклеточные супернатанты собирали и анализировали в отношении концентраций IL-2 с помощью коммерчески доступного ELISA (R&D Systems). Результаты показали, что NATHMAB-IL-1α эффективно нейтрализовал hIL-1α-индуцированную секрецию IL-2 клетками EL-4.

Для тестирования нейтрализации мембраносвязанного ML-1α использовали такой же анализ на основе клеток EL-4, как описано выше, со следующими модификациями. Различные концентрации NATHMAB-hIL-1α (элюат) инкубировали с различными количествами человеческих активированных моноцитов. Для получения моноцитов выделяли РВМС (мононуклеарные клетки периферической крови) из лейкоцитарной пленки с использованием центрифугирования в Ficoll-Paque. Моноцитам давали возможность прикрепиться в течение 1,5 ч при 37°C в RPMI к пластиковым чашкам. Неприкрепившиеся лимфоциты отмывали с получением почти чистой культуры моноцитов. Моноциты культивировали в RPMI, содержащей Gln, Pyr и 10% FCS, в течение 24 ч с LPS (липополисахарид) (1 мкг/мл) при 37°C в инкубаторе с 5% CO2. Клетки открепляли с помощью PBS/2 мМ EDTA, тщательно соскабливали с чашек и переносили в пробирки Falcon. Клетки дважды промывали PBS, ресуспендировали в PBS/1% PFA (параформальдегид) и фиксировали в течение 10 мин при 20°C. Клетки промывали глициновым буфером (150 мМ глицин, 75 мМ NaCl, pH 7,4), затем культуральной средой и подсчитывали. Результаты показали, что NATHMAB-hIL-1α эффективно нейтрализует секрецию IL-2 клетками EL-4, индуцированную мембраносвязанным hIL-1α. В эксперименте, подобном описанному выше, тестировали NATHMAB-hIL-1α в отношении нейтрализации мышиного IL-1α. Указанные количества NATHMAB-hIL-1α супернатанта инкубировали с рекомбинантным человеческим (ч) или мышиным (м) IL-1α (eBioscience). Супернатант, содержащий Ab, нейтрализовал человеческий, но не мышиный IL-la.

Пример 4 - Ab-опосредованное уничтожение опухолевых клеток

Человеческие мононуклеарные клетки периферической крови (РВМС), выделенные из лейкоцитной пленки стандартным способом с помощью Ficoll-Paque, инкубировали либо в RPMI-1640 CM, либо в RPMI-1640-CM, содержащей rhIL-2 (30 нг/мл, ebioscience) при 37°C и 5% CO2 в течение ночи и использовали в качестве эффекторных клеток (Е). Клетки ТНР1 использовали в качестве мишеней (Т). Анализ проводили в 96-луночных планшетах с каждой точкой в трех повторах. После инкубации 1×104 клеток-мишеней с различными концентрациями МАВр1 в течение 15 мин добавляли эффекторные клетки в соотношении ЕТ 25:1 и 50:1 к 1×104 мишеней и инкубировали в течение еще 4 часов. 75 мкл объема образца переносили в новый 96-луночный планшет и цитотоксичность определяли с использованием набора для определения цитотоксичности LDH (Roche) в соответствии с протоколом производителя. % специфического лизиса = (среднее экспериментальное высвобождение - среднее спонтанное высвобождение без антитела) × 100/(среднее максимальное высвобождение из мишеней - среднее спонтанное высвобождение из мишеней) А. Необработанные РВМС использовали в качестве эффекторных клеток. Б. rhIL-2-обработанные РВМС использовали в качестве эффекторных клеток. В обоих случаях увеличение концентраций (1,25-20 мкг/мл) МАВр1 привело к увеличению гибели клеток-мишеней (вплоть до примерно 90%) при обоих соотношениях ЕТ.

Пример 5 - Последовательности mAb, специфичного к IL1α человека.

Полная последовательность, кодирующая другую человеческую анти-hIL-1aIgG1/каппа-легкую цепь, специфичную в отношении человеческого IL1α (MABp1), синтезировали и экспрессировали, как описано выше. В нуклеиновые кислоты, кодирующие тяжелые и легкие цепи, добавляли последовательность Козака (gccacc) перед стартовым ATG.

Тяжелая цепь

MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSMFGVHWV

RQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFLQMDSLRLEDTAV

YYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVFPLAPSSKSTSGGTAALGCLV

KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH

KPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV

VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE

YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD

IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL

HNHYTQKSLSLSPGK [SEQ ID NO: 9]

gccaccatggagtttggtctgtcctgggtgttcttggtggctctgctgaggggggtgcagtgccaggtccagctggtggagtctggtgg

gggagtggtgcagcctgggagatctctgcggctgtcttgcactgcctctggtttcactttctctatgtttggtgtgcattgggtcaggcaag

caccaggcaaaggactcgagtgggtcgcagctgtgagctatgacgggtctaacaaatattacgctgagtctgtcaagggtaggtttacc

atcagccgggataattccaaaaatatcctgttcctgcaaatggactctctgaggctggaagatactgcagtctactattgtgcaaggggg

aggccaaaggtggtgatccccgctcccctcgctcactggggacagggaaccctggtgactttcagctctgctagcaccaagggccct

agcgtgttcccattggctccttcctccaaatctacttctggaggcaccgccgccctgggatgtctcgtgaaagattattttcctgagcccgt

caccgtgagctggaacagcggcgccctgactagcggcgtgcacacctttcccgcagtgctgcaatctagcgggctgtactccctgag

ctctgtcgtgaccgtgccctccagcagcctcggaactcagacctacatctgcaatgtcaatcataaaccctctaataccaaagtcgataa

gagggtcgaacctaaatcttgcgataaaacccatacctgccccccttgcccagcacccgaactgctgggcggtccctctgtgtttctgtt

cccccccaaacccaaagataccctgatgatctctaggacccccgaggtcacttgtgtcgtggtggatgtgtcccacgaagatccagaa

gtcaaattcaactggtatgtggacggggtcgaagtgcacaacgcaaagaccaagcctagggaggaacagtataatagcacatatagg

gtggtcagcgtcctgaccgtcctgcatcaggactggctgaatggcaaagaatataagtgtaaagtgtccaacaaggccctgccagccc

caatcgaaaagacaatctctaaagccaaggggcaaccccgggaaccteaggtctatacactgccaccctctcgggaggaaatgacca

agaatcaggtgagcctgacatgtcttgtgaagggtttttatccctccgacattgccgtggagtgggagagcaatggacaaccagaaaat

aactacaaaaccacaccccctgtgctggactccgatggttccttcttcctctactctaagctgacagtggataagtctaggtggcagcag

gggaatgtgttctcctgctctgtgatgcacgaggcactgcacaatcattatacacaaaagtctctgtctctgtctccaggaaagtaa

[SEQ ID NO: 10]

Легкая цепь

MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQGISSWLAW

YQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSLQPEDFATYYCQQTSSF

LLSFGGGTKVEHKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD

NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS

FNRGEC [SEQ ID NO: 11]

gccaccatggacatgcgcgttcctgcccagctcctcggactgctgctgctttggttcccaggctcccggtgtgatattcagatgacacag

tctccctcctccgtatctgcatccgtgggcgacagggtcacaatcacttgtagggccagccaggggatctctagttggctcgcatggtac

caacaaaagccaggtaaggctccgaaactgctcatttacgaagctagtaacctcgaaacaggcgtgccaagccggtttagcggctcc

ggttccggttctgacttcaccctcactatttcctccctgcaacctgaggattttgccacatattactgtcagcaaacttcttcttttctgctctoc

tttggtggaggaactaaggtggagcacaagcggacagttgctgctcctagcgtctttatcttccctccaagcgatgaacagctgaagtca

gggaccgccagcgtggtctgcctgctcaataatttttaccctcgcgaggctaaggtccaatggaaagtggataacgccctccagagcg

gtaactctcaggagtctgtcacagagcaagacagcaaggatagcacctattccctctccagcaccctgacactgtctaaggccgactac

gagaaacacaaagtgtacgcttgtgaggtgactcaccagggactgagtagccctgtgacaaaatctttcaataggggagaatgctga

[SEQ ID NO: 12]

Пример 6 - Аффинность связывания MABp1

Аффинность связывания очищенного MABp1 определяли с помощью поверхностного плазменного резонанса (SPR) на приборе BIAcore 2000 (GE Health Sciences). Мышиное моноклональное Ab против IgG (Fc) человека ковалентно иммобилизовали на проточных кюветах сенсорного чипа СМ5 с использованием набора для захвата человеческого Ab и набора для аминосочетания (GE Health Sciences). Как правило, достигают уровней иммобилизации в 8000-14000 RU (единиц резонанса). После иммобилизации мышиного Ab для захвата человеческого IgG (Fc) проводили три пусковых цикла с подвижным буфером HBS-EP (GE Health Sciences) и два пусковых цикла с МАВр1 для стабилизации поверхности СМ5 и для удаления любого нековалентно связанного Ab. Для анализа Ab MABp1 разводили в подвижном буфере HBS-EP до конечной концентрации 1 мкг/мл и иммобилизовали до 700 RU на одной проточной кювете сенсорного чипа СМ5. Свободный от носителя человеческий цитокин IL-1A (eBioscience, #34-8019) последовательно разбавляли в подвижном буфере HBS-EP в пределах тестируемого диапазона от 100 нМ до 0,05 нМ. Скорость потока составляла 30 мкл/мин. Данные о диссоциации для каждого разведения цитокина записывали в течение 15 минут.Поверхность СМ5 регенерировали после каждого цикла с помощью однократного введения 3 М MgCl2 в течение 25 секунд при скорости потока 30 мкл/мин. Программное обеспечение BiaEvaluation и модель связывания Лэнгмюра использовали для подгонки данных. Определили, что КD для MABp1 составляла менее 2,0×10-10 М.

Пример 7 - MABp1 ингибирует инвазию опухолевых клеток матрикс базальной мембраны.

Матригель (BD), матрикс базальной мембраны, оттаивали при 4°C в течение ночи и разбавляли (5 мг/мл до 1 мг/мл) бессывороточной холодной средой для культивирования клеток. 100 мкл разбавленного матригеля помещали в верхние камеры 24-луночного transwell (Costar) и transwell инкубировали при 37°C в течение по меньшей мере 4-5 ч для гелеобразования. Опухолевые клетки (MDA-MB-231 и ТНР-1) собирали из культуральных флаконов с помощью трипсин/ЭДТА, промывали культуральной средой и ресуспендировали в среде, содержащей 1% FBS, при плотности 1×106 клеток/мл. Желатинизированный матригель осторожно промывали теплой бессывороточной средой и в каждую лунку добавляли 100 мкл клеточной суспензии. Нижнюю камеру transwell заполняли 600 мкл культуральной среды и планшеты инкубировали при 37°C в течение 12-24 ч. Клетки, которые не инвазировали матригель, аккуратно соскребали с верхней части каждой вставочной лунки (transwell) ватным тампоном. Вставочные ячейки затем удаляли из 24-луночных планшетов и окрашивали кристаллическим фиолетовым после фиксации инвазивных клеток 70%-ным этанолом или метанолом. Инвазивные клетки подсчитывали под световым микроскопом. Процент клеток, инвазирующих матригель, значительно ингибировался в присутствии MABpl.

Пример 8 - MABp1 ингибирует увеличение экспрессии ICAM1 в эндотелиальных клетках

Человеческие эндотелиальные клетки пупочной вены (HUVEC) (BD Biosciences) высевали на 24-луночных планшетах в концентрации 5х105 на лунку в 1 мл среды М-200, дополненной низкосывороточной ростовой добавкой (Invitrogen). Клеткам позволяли оседать в течение 3-4 часов. Среду удаляли и добавляли 1 мл свежей среды М-200 в лунку. MABpl добавляли непосредственно к клеткам в концентрации 4,26 мкг/мл, совместно инкубировали в течение 15 минут при комнатной температуре и затем добавляли рекомбинатный человеческий IL-la (rhIL1A, eBioscience) до конечной концентрации 40 пг/мл. В лунки с положительным контролем добавляли только IL-1α. Клетки HUVEC в отсутствие IL-1α или в отсутствие MABp1 служили в качестве отрицательных контролей. После 17-20 часов инкубации при 37°C, 5% CO2, клетки снимали с планшетов посредством неферментативной обработки в течение 20 минут с использованием реагента CellStripper (Cellgro Mediatech) и затем непосредственно анализировали на экспрессию CD54 (ICAM-1), используя стандартные протоколы проточной цитометрии. Окрашивающий буфер включал PBS в модификации Дульбекко с добавлением 2% инактивированной нагреванием эмбриональной телячьей сыворотки. РЕ-конъюгированное мышиное mAb против CD54 (ICAM-1) человека (eBioscience, клон НА58) или РЕ-конъюгированный мышиный изотипический контроль IgGlk (eBiocience, #12-4714) использовали в соответствии с инструкциями производителя для окрашивания клеток HUVEC в 100 мкл окрашивающего объема в течение 20 минут в темноте при комнатной температуре. Последовательно выполняли две промывки в окрашивающем буфере и затем образцы анализировали на проточном цитометре FACSCalibur (BD Biosciences). Среди нескольких независимых экспериментов (n=5) повышенную регуляцию молекул адгезии ICAM-1, индуцированную rhIL1A на поверхности клеток HUVEC, нейтрализовали с помощью MABp1 до базовых уровней, демонстрируемых нестимулированными клетками HUVEC.

Пример 9 - MABp1 блокирует увеличение экспрессии Е-селектина в эндотелиальных клетках

Подобно его эффектам на индукцию ICAM-1 также наблюдали MABp1-опосредованную нейтрализацию индукции CD62E (Е-селектина) в клетках HUVEC. Этот эффект был наиболее выраженным, когда клетки HUVEC стимулировали не растворимым rhIL-1α, а мембранным IL-1α, заякоренным гликозил-фосфатидилинозитолом на поверхности клеток СНО DG44 (клетки GPI-IL1A). В этом эксперименте конфлюэнтные культуры клеток HUVEC в 6-луночных планшетах культивировали в течение ночи вместе с 5×106 клеток GPI-IL1A DG44 только в среде М-200, в присутствии 10 мкг/мл МАВр1 или в присутствии 10 мкг/мл изотипического контрольного Ab D5. Через 17-20 часов монослои HUVEC интенсивно промывали PBS в модификации Дульбекко, потом снимали посредством неферментативной обработки в течение 20 минут реагентом CellStripper (Cellgro Mediatech) и затем непосредственно анализировали на экспрессию CD62E (Е-селектина) с использованием стандартных протоколов проточной цитометрии. Окрашивающий буфер содержал PBS в модификации Дульбекко с добавлением 2% инактивированной нагреванием эмбриональной телячьей сыворотки. PE-конъюгированное мышиное mAb против CD62E человека (eBioscience, клон Р2НЗ) или РЕ-конъюгированный мышиный изотипический контроль IgG1k (eBiocience, клон P3) использовали в соответствии с инструкциями производителя для окрашивания клеток HUVEC в 100 мкл окрашивающего объема в течение 20 минут в темноте при комнатной температуре. Последовательно выполняли две промывки в окрашивающем буфере и затем образцы анализировали на проточном цитометре FACSCalibur (BD Biosciences). Повышенную экспрессию E-селектина на поверхности клеток HUVEC, индуцированную мембранным GPI-IL-1α, нейтрализовали с помощью МАВр1 до базовых уровней, демонстрируемых нестимулированными клетками HUVEC.

Пример 10 - MRC-5 биологический анализ на активность МАВр1 (нейтрализация rhIL1A)

Клеточную линию MRC-5, происходящую из фибробластов легкого эмбриона человека, получали из коллекции АТСС (CCL-171). IL-1-нейтрализующую активность МАВр1 определяли путем измерения IL-lA-индуцированного высвобождения IL-6 из клеток MRC-5. Клетки MRC-5 высевали при плотности 5×103 на лунку в 96-луночном планшете в 100 мкл полной среды DMEM. Клетки культивировали в течение ночи при 37°C в увлажненном инкубаторе с 5% CO2. Конфлюэнтные клетки MRC-5 затем культивировали еще 24 часа с 20 пг/мл рекомбинантного человеческого IL-1A (rhIL1A, eBioscience) либо отдельно, либо в присутствии возрастающих концентраций MABp1. Клетки для отрицательного контроля не стимулировали посредством rhIL1A. Через 24 часа собирали супернатанты и анализировали высвобождение IL-6 с использованием набора для ELISA IL-6 от eBioscience. IC50, или концентрация MABp1, необходимая для ингибирования 50% максимального высвобождения IL-6, находилась в диапазоне 0,001-0,01 мкг/мл.

Пример 11 - MABp1 идентифицирует IL-1a+ клетки.

Обработанную гепарином натрия, антикоагулированную цельную кровь аликвотировали по 100 мкл в полистироловые пробирки FACS. Образцы инкубировали при комнатной температуре в течение 15 минут с 1 мг человеческого IgG (очищенный с помощью протеин-А) плюс 2 мл инактивированной нагреванием эмбриональной телячьей сыворотки для блокирования Fc-рецепторов. Затем к образцу добавляли первичные Abs: либо 1 мг Alexa-488-меченого MABp1, 1 мг FITC-меченого моноклонального Ab против мембранного IL1A человека (FAB200F, R&D Systems) или 1 мг мышиного изотипического контроля (IC002F, R&D Systems). Первичные Abs инкубировали с образцом в течение 30 минут при комнатной температуре в темноте. Эритроциты из образца затем лизировали (раствор BD Biosciences PharmLyse) при комнатной температуре в течение 15 минут, центрифугировали при 300×g в течение 5 минут и подвергали аспирации. Осадки образца промывали три раза 1 мл сбалансированного солевого раствора Хэнкса (HBSS), содержащего 2% инактивированной нагреванием эмбриональной телячьей сыворотки. Образец ресуспендировали в 0,3 мл HBSS + 2% FBS, данные получали на проточном цитометре FACSCalibur и анализировали с использованием программного обеспечения CellQuest. Анализ человеческих РВМС методом проточной цитометрии с использованием MABp1 показал, что только 0,2% РВМС были положительными в отношении IL-1α.

Пример 12 - MABp1 для обнаружения и контролирования инфекций и воспаления

Анализ методом проточной цитометрии (как в Примере 11) человеческих РВМС с использованием MABp1 показал увеличение в 3,6 раз процента РВМС, положительных в отношении IL-1α+, у субъекта с субклинической инфекцией по сравнению с нормальным контролем. Аналогично, у субъекта с воспаленным зубом мудрости увеличивался процент РВМС, положительных в отношении IL-1α+. Существенное уменьшение количества IL-1α+ РВМС наблюдали в течение от 14 до 45 суток после удаления зуба мудрости.

Пример 13 - Иммуноанализ для обнаружения и/или количественного определения IL-1α

В целом, очень низкие уровни IL-1α присутствуют в плазме субъектов-людей. Поскольку эти уровни часто находятся за порогом обнаружения стандартными иммунологическими анализами, разработали ELISA с повышенной чувствительностью. В этом ELISA-анализе экзогенное анти-IL-1α Ab (например, МАВр1) может быть добавлено к тестируемому биологическому образцу (например, человеческой плазме) в условиях, которые позволяют Ab связываться с IL-1α в данном образце. Поскольку наблюдали, что практически весь IL-1α в образцах человеческой плазмы находится уже в связанном с эндогенными анти-IL-1α Ab состоянии, последняя стадия часто может быть пропущена. Образец с комплексами IL-1α-Ab затем наносят на фильтр (центрифужное устройство Amicon) с порогом отсечения молекулярной массы, примерно 100 кДа для отделения комплексов IL-1α-Ab от молекул в образце с меньшим порогом отсечения молекулярной массы. В одном эксперименте это привело к 50-кратной концентрации. Обработанный образец (и его разведения) затем добавляли в лунки микротитрационного планшета, покрытые захватывающим Ab против IgG человека (2 мкг/мл мышинон против IgG человека, Fc-специфичное, Southern Biotech код продукта #9042-01). После предоставления времени, необходимого для связывания комплексов IL-1α-Ab в образце, лунки промывали для удаления несвязавшегося материала. Затем в лунки добавляли меченое вторичное Ab против IL-1α человека (0,2 мкг/мл биотин-конъюгированное моноклональное мышиное Ab против IL-1A человека, клон CRM6, eBioscience каталог # 13-7017). После предоставления времени для связывания IL-1α в лунках планшет промывали и определяли количество меченого Ab против IL-1α человека в каждой лунке как показатель концентрации IL-1α в тестируемом образце.

Другие воплощения

Следует понимать, что хотя изобретение было описано в сочетании с его подробным описанием, вышеприведенное описание предназначено для иллюстрации, а не для ограничения объема изобретения, которое определено объемом прилагаемой формулы изобретения. Другие аспекты, преимущества и модификации находятся в рамках следующей формулы изобретения.

1. Очищенное человеческое IgGI mAb (моноклональное антитело), которое специфически связывается с человеческим IL-1α, содержащее тяжелую цепь, ковалентно связанную с легкой цепью, где тяжелая цепь содержит аминокислотную последовательность SEQ ID NO: 9, и легкая цепь содержит аминокислотную последовательность SEQ ID NO: 11.

2. Набор выделенных нуклеиновых кислот, содержащих первую нуклеиновую кислоту, кодирующую тяжелую цепь человеческого IgG1 mAb, которое специфически связывается с IL-1α, и вторую нуклеиновую кислоту, кодирующую легкую цепь человеческого IgG1 mAb, которое специфически связывается с человеческим IL-1α, где первая нуклеиновая кислота кодирует аминокислотную последовательность SEQ ID NO: 9, и вторая нуклеиновая кислота кодирует аминокислотную последовательность SEQ ID NO: 11.

3. Набор выделенных нуклеиновых кислот по п.2, где первая нуклеиновая кислота содержит нуклеотидную последовательность SEQ ID NO: 10, и вторая нуклеиновая кислота содержит нуклеотидную последовательность SEQ ID NO: 12.

4. Набор выделенных нуклеиновых кислот по п.2, который содержится по меньшей мере в одном экспрессирующем векторе.

5. Набор выделенных нуклеиновых кислот по п.3, который содержится по меньшей мере в одном экспрессирующем векторе.

6. Набор выделенных нуклеиновых кислот по п.4, который содержится в выделенной клетке-хозяине.

7. Набор выделенных нуклеиновых кислот по п.6, где клетка-хозяин представляет собой клетку млекопитающих.



 

Похожие патенты:

Изобретение относится к области биотехнологии и медицины. Описан иммуноген, для индукции иммунного ответа на IgE.

Изобретение относится к иммунологии. .

Изобретение относится к области биотехнологии и иммунологии. .

Изобретение относится к области кристаллизации антител. .

Изобретение относится к областям молекулярной биологии, вирусологии, иммунологии и медицины. .
Изобретение относится к биохимии, конкретнее к биологически активным пептидам, обладающим стресспротекторной активностью, которые могут найти применение в медицине и фармакологии.
Изобретение относится к области биотехнологии и фармацевтики. .

Изобретение раскрывает антитело (варианты), обладающее иммунологической реактивностью в отношении неполного полипептида CAPRIN-1 (аминокислотные последовательности приведены в описании), и фармацевтическую композицию (варианты) для лечения и/или профилактики злокачественной опухоли, в частности рак молочной железы, опухоль головного мозга, лейкоз, лимфома, рак легких, пищевода или толстой кишки.

Изобретение относится к способу лечения псориаза у субъекта путем введения субъекту антитела или его антигенсвязывающей части, способных связываться с субъединицей p40 IL-12 и/или IL-23, в дозе от приблизительно 0,1 до 5,0 мг/кг по определенной схеме.

Группа изобретений относится к фармацевтике и касается обеспечения жидкой стабильной антителосодержащей композиции и способа ингибирования димеризации молекул антитела в жидкой композиции.

Группа изобретений относится к области медицины и фармацевтики и касается стабильной изотонической действующей композиции, содержащей протеин в количестве по крайней мере 50 мг/мл и растворитель, который разбавляет композицию, полученную из лиофилизированной смеси протеина и лиопротектора, где мольное соотношение лиопротектора и протеина в смеси составляет 100-600 моль лиопротектора на 1 моль протеина, причем концентрация протеина в разбавленной действующей композиции в 2-40 раз выше, чем концентрация протеина в смеси до лиофилизации.

Настоящее изобретение относится к поверхностно-модифицированным частицам и способам их изготовления и применения, фармацевтическим суспензиям, содержащим указанные поверхностно-модифицированные частицы, и способу усиления поглощения клетками активного агента.

Настоящее изобретение относится к области иммунологии. Предложено гуманизированное моноклональное антитело против CD19 человека, полученное из антитела HB12B, и его фрагмент, охарактеризованные через аминокислотные последовательности вариабельных доменов.

Настоящее изобретение относится к области биохимии и иммунологии. Рассмотрена изолированная молекула антитела, которая связывает альфа-цепь рецептора колониестимулирующий фактор гранулоцитов/макрофагов (GM-CSFRα) человека и ингибирует связывание GM-CSF с GM-CSFRα человека.

Изобретение относится к области биотехнологии и медицины. Описан иммуноген, для индукции иммунного ответа на IgE.
Наверх