Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты



Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты
Применение mva (модифицированный вирус коровьей оспы анкара) для лечения рака простаты

 


Владельцы патента RU 2499606:

Бавэариан Нордик Инк. (US)

Группа изобретений относится к композициям, наборам, способам профилактики и терапии рака с использованием рекомбинантных вирусов MVA (модифицированный вирус коровьей оспы Анкара), кодирующих антигены, ассоциированные с опухолью: PSA (простато-специфический антиген) и РАР (простатическая кислая фосфатаза). Данные рекомбинантные вирусы MVA способны индуцировать В- и Т-клеточные ответы. Заявленные рекомбинантые модифицированные вирусы эффективны в профилактике и терапии рака. Также рекомбинантные вирусы MVA можно применять в комбинации с таксаном. 5 н. и 18 з.п. ф-лы, 27 ил., 6 пр.

 

Данное изобретение относится к профилактике и лечению раковых заболеваний, конкретно рака простаты, с использованием вирусов MVA, кодирующих антигены, ассоциированные с опухолью, конкретно простато-специфический антиген (PSA) и простатическую кислую фосфатазу (РАР).

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Модифицированный вирус коровьей оспы Анкара (MVA) является родственным вирусу коровьей оспы, члену рода Orthopoxvirus в семействе Poxviridae. MVA генерировали 516 последовательными пассажами вируса коровьей оспы (CVA) штамма Анкара на фибробластах куриного эмбриона (для обзора смотрите Mayr, A., et al. Infection 3:6-14 (1975)). В результате этих долговременных пассажей геном образующегося вируса MVA имел делеции примерно 31 т.п.о. его геномной последовательности и, следовательно, был описан как имеющий репликацию, в значительной степени органиченную клетками-хозяевами - клетками птиц (Meyer, H. et al., J. Gen. Virol. 72:1031-1038 (1991)). В целом ряде животных моделей было показано, что образующийся MVA был в значительной степени авирулентным (Meyr, А. & Danner, К., Dev. Biol. Stand. 41:225-34 (1978)). Кроме того, это штамм MVA протестировали в клинических испытаниях в качестве вакцины для иммунизации против человеческой натуральной оспы (Mayr et al., Zbl. Bakt. Hyg. I, Abt. Org. В 167:375-390 (1987); Stickl et al., Dtsch. med. Wschr. 99:2386-2392 (1974)). Эти исследования включали свыше 120000 человек, включая пациентов, подверженных высокому риску, и доказали, что по сравнению с вацинами на основе вируса коровьей оспы, MVA имел пониженную вирулентность или инфективность при индукции хорошего специфичного иммунного ответа. В следующие десятилетия MVA преобразовали при помощи генной инженерии для применения в качестве вирусного вектора для экспрессии рекомбинантных генов или в качестве рекомбинантной вакцины (Sutter, G. et al., Vaccine 12:1032-40 (1994)).

Даже несмотря на то, что Mayr et al. продемонстрировали на протяжении 1970 гг., что MVA является высокоаттенуированным и авирулентным у человека и млекопитающих, некоторые исследователи сообщали, что MVA не является полностью аттенуированным в линиях клеток млекопитающих и человека, так как в этих клетках может происходить остаточная репликация (Blanchard et al., J Gen Virol 79:1159-1167 (1998); Carroll & Moss, Virology 238:198-211 (1997); Altenberger, патент США №5185146; Ambrosini et al., J Neurosci Res 55(5);569 (1999)). Предполагается, что результаты, доложенные в этих публикациях, были получены с разными известными штаммами MVA, так как использованные вирусы существенно отличались по их свойствам, особенно по их характеру роста в разных линиях клеток. Такая остаточная репликация является нежелательной по разным причинам, включая соображения безопасности в связи с применением у людей.

Были описаны штаммы MVA, имеющие улучшенные профили безопасности, для разработки более безопасных продуктов, таких как вакцины или лекарственные средства. Смотрите патенты США №6761893 и 6193752. Такие штаммы способны к репродуктивной репликации в клетках и линиях клеток, не являющихся человеческими, особенно в фибробластах куриных эмбрионов (CEF), но не способны к репродуктивной репликации в определенных линиях клеток человека, которые, как известно, обеспечивают репликацию известных штаммов вируса коровьей оспы. Эти линии клеток включают линию клеток человеческих кератиноцитов, HaCat (Boukamp et al. J Cell Biol 106(3):761-71 (1988)), линию клеток человеческого рака шейки матки, HeLa (ATCC No. CCL-2), линию клеток почки человеческого эмбриона, 293 (ЕСАСС No. 85120602) и линию клеток человеческой остеосаркомы кости, 143В (ЕСАСС No. 91112502). Такие вирусные штаммы также не способны к репродуктивной репликации in vivo, например, в определенных мышиных штаммах, таких как трансгенная мышиная модель AGR 129, которая имеет сильно ослабленный иммунитет и является высокочувствительной к реплицирующемуся вирусу. Смотрите патент США №6761893. Был описан один такой штамм MVA и его производные и рекомбинанты, именуемые "MVA-BN®". Смотрите патенты США №6761893 и 6193752.

Каждый из MVA и MVA-BN® был сконструирован для применения в качестве вирусного вектора для экспрессии рекомбинантных генов или в качестве рекомбинантной вакцины. Смотрите, например, Sutter, G. et al., Vaccine 12:1032-40 (1994), патенты США №6761893 и 6193752.

Заболевания, связанные с раком, являются ведущей причинной смертности и заболеваемости во всем мире. Например, оценивается, что только в США один из шести мужчин будет страдать от рака простаты. Кроме того, аутопсические исследования показывают, что значительная доля мужского населения имеет данное заболевание, хотя и на его самых ранних, незлокачественных стадиях, уже к возрасту 30 лет. Смотрите, например, Taichman et al., JCI 117(9):2351-2361 (2007); Webster et al., J. Clin. Oncol. 23:8262-8269 (2005). Недавние подходы для иммунотерапии рака включали вакцинацию антигенами, ассоциированными с опухолью. В определенных случаях такие подходы включали применение системы доставки для стимуляции иммунных ответов хозяина на антигены, ассоциированные с опухолью. Такие системы доставки включали рекомбинантные вирусные векторы, а также клеточные терапии. Смотрите, например, Harrop et al., Front. Biosci. 11:804-817 (2006); Arlen et al., Semin. Oncol. 32:549-555 (2005); Liu et al., Proc. Natl. Acad. Sci. USA 101 (suppl. 2): 14567-14571 (2004). MVA использовали в качестве носителя вакцины для онкофетального антигена 5Т4 в клинических испытаниях у пациентов с метастатическим раком прямой и ободочной кишки, метастатическим раком почки и раком простаты, невосприимчивым к гормонам. Amato, RJ., Expert Opin. Biol. Ther. 7(9):1463-1469 (2007).

К числу известных антигенов, ассоциированных с опухолью, относятся простато-специфический антиген (PSA) и простатическая кислая фосфатаза (РАР). Смотрите, например, Taichman et al., JCI 117(9):2351-23б1 (2007); Webster et al., J. Clin. Oncol. 23:8262-8269 (2005). PSA продуцируется простатой и обнаруживается в повышенном количестве в крови мужчин, которые имеют рак простаты, доброкачественную гиперплазию простаты, или инфекцию, или воспаление простаты. PSA был идентифицирован как мишень для подходов клеточно-опосредованной иммунотерапии для лечения рака. Смотрите, например, McNeel, D.G., Curr. Opin. Urol. 17:175-181 (2007); Nelson W.G., Curr. Opin. Urol. 17:.157-167 (2007). PAP является ферментом, измеряемым в крови, уровни которого могут быть повышенными у пациентов с раком простаты, который распространился или метастазировал где-либо. РАР не увеличивается, если опухоль не распространилась вовне анатомической капсулы простаты, либо путем локализованной инвазии, либо удаленного метастаза. Следовательно, этот простатический опухолевый антиген исследуется как антиген-мишень в нескольких испытаниях человеческой вакцины, причем некоторые из них имеют доказательство клинической пользы. Смотрите, например, McNeel, D.G., Curr. Opin. Urol. 17:175-181 (2007); Waeckerle-Men et al., Cancer Immunol. Immunother. 66:811-821 (2006); Machlenkin et al. Cancer Immunol Immunother. 56(2):217-226 (2007).

Вакцины, содержащие PAP, генерировали с использованием рекомбинантного вируса коровьей оспы, очищенной РАР, ДНК вакцин и дендритных клеток, загруженных антигенами. Valone et al., The Cancer Journal 7:

Suppl 2:S53-61 (2001); Fong et al., J. Immunol. 2001 Dec 15;167(12):7150-6; Fong et al., J. Immunol. 159(7):3,113-7 (1997); Johnson et al., Vaccine 24(3);293-303 (2006); Johnson et al., Cancer Immunol Immunother. 56(6):885-95 (2007). В одном исследовании, когда дендритные клетки, испульсно меченые PAP-GM-CSF, инъецировали крысам, не было обнаружено антител к PAP. (Valone et al. at S55). В другом исследовании введение рекомбинантного вируса коровьей оспы, содержащего гены, кодирующие крысиную РАР или человеческую РАР, не генерировало измеримый антительный ответ к крысиной или человеческой РАР (Fong et al. (1997) at 3116-7). В другом исследовании РАР-специфичный IgG мог быть определен в сыворотке животных, иммунизированных белком hPAP, а также у животных, которые получили вакцинацию вирусом коровьей оспы, кодирующим человеческую РАР, с последующим введением белка hPAP в качестве бустер-иммунизации, но не у животных, дважды иммунизированных вирусом коровьей оспы, кодирующим человеческую РАР (Johnson et al. (2007) at 890).

Активная иммунотерапия рака основана на индукции иммунного ответа против опухолевых клеток у раковых пациентов. Индукция как гуморальных, так и клеточных компонентов адаптивного иммунитета против широкого спектра антигенов, ассоциированных с опухолью (ТАА), и сопутствующая активация компонентов врожденного иммунитета являются существенными для максимальной эффективности активного иммунотерапевтического продукта. Конкретно считается, что адаптивный иммунитет Типа 1 или Th1, характеризующийся индукцией антигенспецифичных IFNγ-продуцирующих цитотоксичных Т-клеток (Т-клетки CD8), является важным для противораковой иммунотерапии.

Несмотря на недавние успехи в лечении рака, рак простаты остается второй ведущей причиной смерти среди раковых пациентов в Америке. Таким образом, необходимы терапевтические подходы, которые могли бы лучше ослабить данное заболевание путем нацеливания на многие аспекты роста опухоли и образования метастазов.

Таксаны, такие как паклитаксел и доцетаксел, использовали в качестве химиотерапевтических агентов для раковых пациентов. Смотрите, например, Tannock et al., N. Engl. J. Med. 351:1502-1512 (2004). Химиотерапию таксанами объединяли с разными обработками противоопухолевыми вакцинами, что приводило к разнообразным результатам. Смотрите Chu et al., J. Immunotherapy 29:367-380 (2006); Machiels et al., Cancer Res. 61:3689-3697 (2001); Prell et al., Cancer Immunol. Immunother. 55: 1285-1293 (2006); Arlen et al., Clinical Breast Cancer 7:176-179 (2006); и Arlen et al., Clinical Cancer Res. 12:1260-1269 (2006). Обзор комбинации противораковых вакцин с химиотерапиями сделан у Chong et al., Expert Opin. Pharmacother. 6:1-8 (2005); Emens et al., Endocrine-Related Cancer 12:1-17 (2005); и McNeel, D.G., Curr. Opin. Urol. 17:175-181 (2007).

Основываясь на вышеуказанном, в данной области существует потребность в реагентах и способах для противораковой терапии.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Данное изобретение охватывает способы, реагенты и наборы для профилактики рака и для лечения раковых пациентов как с первичными опухолями, так и с метастазами рака.

Данное изобретение охватывает способ лечения ракового пациента-человека, включающий введение данному пациенту рекомбинантного MVA, кодирующего полипептид, содержащий человеческий простато-специфический антиген (PSA), и полипептид, содержащий антиген человеческой простатической кислой фосфатазы (РАР). В одном воплощении MVA представляет собой MVA-BN. В одном воплощении вирус MVA содержит нуклеотидную последовательность SEQ ID NO:1 и SEQ ID NO:2. В одном воплощении антиген PSA и антиген РАР вставлены в межгенную область 014L/015L MVA. В определенных воплощениях раковое заболевание представляет собой рак простаты или метастаз рака простаты.

В одном воплощении рекомбинантный MVA вводят перед введение дозы таксана, уничтожающей опухолевые клетки. В одном воплощении рекомбинантный MVA вводят в то же самое время, что и дозу таксана, уничтожающую опухолевые клетки. В одном воплощении рекомбинантный MVA вводят после дозы таксана, уничтожающей -опухолевые клетки. В предпочтительных воплощениях таксаном является доцетаксел или паклитаксел.

Данное изобретение охватывает наборы для профилактики рака простаты, содержащие рекомбинантный MVA, кодирующий полипептид, содержащий человеческий антиген PSA, и полипептид, содержащий человеческий антиген РАР, и инструкции по введению рекомбинантного MVA до определения рака простаты.

Данное изобретение охватывает наборы для лечения рака простаты, содержащие рекомбинантный MVA, кодирующий полипептид, содержащий человеческий антиген PSA, и полипептид, содержащий человеческий антиген РАР, и инструкции по введению рекомбинантного MVA пациенту с раком простаты.

Данное изобретение охватывает наборы для лечения ракового пациента, содержащие рекомбинантный MVA, кодирующий полипептид, содержащий человеческий антиген PSA, и полипептид, содержащий человеческий антиген РАР, и инструкции по введению рекомбинантного MVA до, в то же самое время или после лечения дозой таксана, уничтожающей опухолевые клетки.

Данное изобретение охватывает рекомбинантный вирус MVA, экспрессирующий полипептид, содержащий человеческий антиген РАР. В одном воплощении данный вирус MVA содержит SEQ ID NO:2. В одном воплощении MVA представляет собой MVA-BN.

Данное изобретение охватывает рекомбинантный вирус MVA, экспрессирующий полипептид, содержащий человеческий антиген PSA, и полипептид, содержащий человеческий антиген РАР. В одном воплощении данный вирус MVA содержит нуклеотидную последовательность SEQ ID NO:1. В одном воплощении данный вирус MVA содержит нуклеотидную последовательность SEQ ID NO:2. В одном воплощении MVA представляет собой MVA-BN.

Данное изобретение охватывает иммуногенную композицию, содержащую рекомбинантный вирус MVA, кодирующий полипептид, содержащий человеческий антиген РАР, где данная иммуногенная композиция индуцирует В-клеточные и Т-клеточные иммунные ответы против РАР при введении хозяину.

Данное изобретение охватывает иммуногенную композицию, содержащую рекомбинантный вирус MVA, кодирующий полипептид, содержащий человеческий антиген РАР, где данная иммуногенная композиция индуцирует антитела против РАР при введении хозяину. В одном воплощении данный вирус MVA содержит SEQ ID NO:2.

Данное изобретение охватывает иммуногенную композицию, содержащую рекомбинантный вирус MVA, кодирующий полипептид, содержащий человеческий антиген PSA, и полипептид, содержащий человеческий антиген РАР, где данная иммуногенная композиция индуцирует В-клеточные и Т-клеточные иммунные ответы против PSA и РАР при введении хозяину.

КРАТКОЕ ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ

Фиг.1А-Б. Схематические карты генома MVA-BN®. На 1А показаны положения шести сайтов делеции в геноме MVA-BN®: заштрихованные отрезки и буквы (от А до О) идентифицируют фрагменты расщепления рестрикционным ферментом HindIII, а положения и размеры последовательностей CVA, которые отсутствуют в MVA-BN®, показаны на стрелках. На 1Б показаны рестрикционные фрагменты Hindlll (буквы от А до О) и сайт IGR 014L/015L, используемый для генерации MVA-BN-PRO.

Фиг.2. Схематическое представление вируса MVA-BN-PRO. Карта генома MVA-BN® (карта рестрикции Hindlll, указано буквами А-O), описывающая рекомбинантную вставку, клонированную в межгенной области 014L/015L: гены PSA и РАР, каждый из которых находится под контролем промотора ATI вируса коровьей оспы (ATI).

Фиг.3А-Б. Определение РАР (А) и PSA (Б) в супернатанте культур клеток СТ26, инкубируемых с MVA-BN-PRO. Клетки СТ26 в плотности 6×105 клеток на лунку (темные квадраты и треугольники) или клетки 6Е4 (серые квадраты) инфицировали либо MVA-BN-PRO (квадраты), либо MVA-BN® (треугольники) при указанной множественности заражения (MOI). Через 24 часа супернатанты клеток собирали и уровни белков РАР и PSA измеряли ферментативным анализом РАР и ELISA (твердофазный иммуноферментный анализ) PSA, соответственно.

Фиг.4А-Б. Антительные ответы против PSA (А) и против РАР (Б) у мышей, обработанных MVA-BN-PRO. Животных иммунизировали три раза (сутки 1, 15 и 29) либо MVA-BN-PRO (белые квадраты), либо MVA-BN® (черные квадраты). Пробы крови брали до обработки, в сутки 14, 28 и 42. Титры представляют собой обратную величину последнего разведения с ОП (оптическая плотность) по меньшей мере в 2 раза большей, чем фон (сыворотка в том же самом разведении от животных, обработанных TBS). Титры, показанные как ноль, были отрицательными при наименьшем протестированном разведении сыворотки (1:50).

Фиг.5А-Б. Т-клеточные ответы против PSA и против РАР у мышей, обработанных MVA-BN-PRO. Спленоциты от животных, иммунизированных MVA-BN-PRO (А) и контрольных животных, (иммунизированных) TBS (Б), инкубировали с последовательностями OPL из РАР (серые квадраты), PSA (белые квадраты) или HER2 (черные квадраты) в указанных концентрациях. Пятна, указывающие на IFN-γ-продуцирующие Т-клетки, подсчитывали с использованием ImmunoSpot Analyzer. Средние значения от лунок в тройной повторности и стандартное отклонение представлены для каждой протестированной концентрации OPL.

Фиг.6А-Б. Т-клеточный вклад CD4 и CD8 в MVA-BN-PRO-опосредованные Т-клеточные ответы. Животных иммунизировали MVA-BN-PRO четыре раза (сутки 1, 15, 29 и 49), и спленоциты собирали через шесть суток после последней обработки, спленоциты, обедненные CD8 (А), и спленоциты, обедненные CD4 (Б), инкубировали с последовательностями OPL из РАР (серые квадраты), PSA (белые квадраты) или HER2 (черные квадраты) в указанных концентрациях. Данный анализ проводили, как описано для Фиг.5.

Фиг.7А-Е. Профилактическое предупреждение роста опухоли у мышей, обработанных MVA-BN-PRO. Животных обрабатывали 3 раза с 3-х недельными интервалами указанными TCID50 (средняя цитопатогенная доза) вируса, разведенного в TBS. Через шесть недель после третьей обработки животных внутрикожно заражали 1×105 опухолевых клеток Е5, экспрессирующих PSA. Рост опухоли измеряли дважды в неделю, используя циркуль. Объем опухоли рассчитывали как: (L×W2)/2 (Длина × Ширину2)/2).

7А-7Д: рост опухоли у отдельных мышей представлен для каждой экспериментальной группы. 7Е: средние размеры опухолей и стандартное отклонение представляли для всех экспериментальных групп.

Фиг.8. Предупреждение роста опухоли у мышей, обработанных MVA-BN-PRO. Сравнение измерений в сутки 29 в двух отдельных экспериментах. Животных обрабатывали три раза с 2-недельными интервалами (серые символы) 2×106 TCID50 указанного вируса, разведенного в TBS. Через две недели после последней обработки животных внутрикожно заражали 1×105 опухолевых клеток Е5, экспрессирующих PSA. Рост опухоли измеряли дважды в неделю, используя циркуль. Объем опухоли рассчитывали как: (L×W2)/2. Точки показывают объемы опухолей для каждого животного в сутки 29 после имплантации опухоли. Для сравнения данные от соответствующих групп отдельного эксперимента, описанного на Фиг.7, представлены черными символами. Оба представленных здесь эксперимента проводили при аналогичных условиях за исключением длительности интервалов обработки (3-недельный интервал по сравнению с 2-недельным) и времени имплантации опухолевых клеток (шесть недель по сравнению с двумя неделями после третьей обработки).

Фиг.9А-Е. Терапевтическое подавление роста опухоли у мышей, обработанных MVA-BN-PRO. Мышей BALB/c (10 животных в каждой группе) заражали клетками Е6 (1×105 клеток, инъецированных внутрикожно) в сутки 1 и обрабатывали подкожно в сутки 1, 8 и 15 одним из TBS (Д), MVA-BN® (5×106 или 5×107 TCID50; А и Б) или MVA-BN-PRO (5×106 или 5×107 TCID50; В и Г). Мышей умерщвляли в сутки 22. Панели А-Д показывают размеры опухолей отдельных мышей. Средние размеры опухолей и стандартные отклонения для каждой группы показаны на панели Е. Рост опухоли измеряли дважды в неделю, используя циркуль. Объем опухоли рассчитывали как: (L×W2)/2. Указанные погрешности представляют стандартные отклонения (SD).

Фиг.10. Подавление РАР-позитивного опухолевого роста у мышей, обработанных MVA-BN-PRO. Мышей BALB/c (10 животных в каждой группе) заражали СТ26-РАР (5×105 клеток, инъецированных внутривенно) в сутки 1 и обрабатывали внутрибрюшинно в сутки 4 одним из TBS, MVA-BN (5×107 TCID50) или MVA-BN-PRO (2×106 и 5×107 TCID50). Мышей умерщвляли в сутки 14 и взвешивали их легкие. Точки на графике представляют массу легкого отдельных мышей. Горизонтальные отрезки показывают среднюю массу легкого для каждой группы.

Фиг.11. Ответы антител против PSA и против РАР, индуцированные у мышей BALB/c или C57BL/6. Самцов мышей BALB/c и C57BL/6 (5 животных в каждой группе) иммунизировали в сутки 1, 15 и 29 5×107 TCID50 MVA-BN-PRO. Пробы крови брали в сутки 42, и последовательные разведения объединенных сывороток анализировали на присутствие IgG против PSA или против РАР посредством ELISA. Титры рассчитывали как обратное значение последнего разведения с ОП по меньшей мере в 2 раза большей, чем фон (определенный как сыворотка в том же самом разведении от животных, обработанных TBS). Точки данных для сыворотки с титрами ниже наименьшего протестированного разведения (<125) были произвольно помещены на оси X, расположенной на одно разведение ниже первого разведения анализа (62,5) для графических целей.

Фиг.12. Ответы Т-клеток у пациентов, обработанных MVA-BN-PRO. РВМС (одноядерные клетки периферической крови) из крови пациента J-D-1001 отбирали до обработки (базовый уровень) или после обработки MVA-BN-PRO (ТС3). Клетки инкубировали в течение 40 часов с одним из белка PSA, пептидной библиотеки, перекрывающей PSA (OPL), белка РАР, РАР OPL, пулами пептидов ГКГ (главный комплекс гистосовместимости) Класса I и Класса II, происходящими из антигенов, ассоциированных с опухолью (ТАА), или MVA-BN в концентрации, указанной на графике. Активацию Т-клеток определяли ELISpot (иммуноферментный спот-анализ), измеряя секретируемый IFN-γ. Для каждого условия стимуляции результаты выражены как среднее число клеток, образующих пятна IFN-γ (SFC), на 2×105 РВМС. Значения SFC получали из среднего значения (сигнала) от черырех лунок за вычетом фона.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Рекомбинантный MVA, экспрессирующий человеческие антигены PSA и РАР (MVA-BN-PRO), тестировали в ряде анализов in vitro и in vivo. Экспрессию обоих простато-специфичных антигенов, кодируемых MVA-BN-PRO (PSA и РАР), в эукариотических клетках, инкубируемых с MVA-BN-PRO, оценивали с использованием набора для определения PSA и функционального анализа для фосфатазной активности, соответственно. Анализы ELISA и ELISpot использовали для мониторинга индукции антител против PSA и против РАР и Т-клеточных иммунных ответов у мышей, обработанных MVA-BN-PRO. Противоопухолевую активность MVA-BN-PRO оценивали в PSA-моделях опухоли как в профилактической постановке, так и в терапевтической постановке.

Эти исследования продемонстрировали, что (1) захват MVA-BN-PRO клетками in vitro приводит к экспрессии и РАР, и PSA в сходных количествах; (2) обработка мышей MVA-BN-PRO имеет результатом гуморальные анти-PSA и анти-РАР и Тh1 клеточные иммунные ответы, (3) обработка мышей MVA-BN-PRO ингибирует рост PSA (+) опухолей как в профилактических, так и в терапевтических постановках, (4) обработка мышей MVA-BN-PRO ингибирует рост РАР (+) опухолей в терапевтической постановке, (5) у человека обработка MVA-BN-PRO увеличивала уровни как анти-PSA Т-клеток, так и анти-РАР Т-клеток, и (6) обработка MVA-BN-PRO у человека приводила к распространению Т-клеточных ответов на другие опухолевые антигены. Таким образом, MVA-BN-PRO активирует иммунную систему путем запуска антигенспецифичных гуморальных и клеточных ответов ТМ-типа, что приводит к значительной терапевтической активности in vivo против опухолей, экспрессирующих PSA и РАР. Следовательно, MVA-BN-PRO является привлекательной вакциной-кандидатом для иммунотерапии рака простаты у людей.

MVA-BN-PRO является мощным иммуногеном, способным индуцировать защитный противоопухолевый иммунитет, который предотвращает рост опухоли в профилактической постановке и который также подавляет рост сформировавшихся опухолей. Профилактические и терапевтические противоопухолевые активности MVA-BN-PRO были опосредованы анти-PSA-специфичными адаптивными иммунными ответами. Однако адаптивные иммунные ответы были индуцированы против обоих простато-специфичных антигенов, PSA и РАР, кодируемых MVA-BN-PRO. Сопутствующая активация адаптивных ответов против многих опухолевых антигенов позволяет MVA-BN-PRO более эффективно бороться с опухолями и увеличивает потенциал успешного лечения раковых пациентов.

В одном воплощении данное изобретение охватывает применение рекомбинантных вирусов MVA для терапии рака простаты. Рекомбинантные MVA генерируют вставкой гетерологичных последовательностей в вирус MVA. Примерами штаммов вируса MVA, которые являются полезными в воплощении настоящего изобретение на практике, и которые были депонированы согласно требованиям Будапештского соглашения, являются штаммы MVA 572, депонированные в Европейской коллекции культур клеток животных (ЕСАСС), Salisbury (Великобритания) с депозитарным номером ЕСАСС 9401270727 января 1994, и MVA 575, депонированный с номером ЕСАСС 001207077 декабря 2000. MVA-BN®, депонированный 30 августа 2000 в Европейской коллекции культур клеток (ЕСАСС) под номером V00083008 и его производные, являются дополнительными показательными штаммами.

Несмотря на то, что MVA-BN® является предпочтительным из-за его большей безопасности (меньшей компетентности по репликации), все MVA являются подходящими для этого изобретения. Согласно одному воплощению настоящего изобретения штаммом MVA является MVA-BN® и его производные. Смотрите РСТ/ЕР01/13628, который, тем самым, является включенным посредством ссылки.

В определенных воплощениях рекомбинантный MVA экспрессирует антиген, ассоциированный с опухолью. В одном воплощении антигеном, ассоциированным с опухолью, является PSA. В одном воплощении антигеном, ассоциированным с опухолью, является РАР. В предпочтительном воплощении MVA экспрессирует два антигена, ассоциированных с опухолью, предпочтительно антиген PSA и РАР. В одном воплощении два данных антигена, ассоциированных с опухолью, содержат нуклеотидные последовательности SEQ ID NO:1 и SEQ ID NO:2. В одном воплощении два данных антигена, ассоциированных с опухолью, экспрессируются из кассеты, содержащей нуклеотидную последовательность SEQ ID NO:3.

В других воплощениях антиген, ассоциированный с опухолью, модифицирован таким образом, чтобы он включал один или более чужеродных эпитопов ТН. Как здесь описано, такие противораковые иммунотерапевтические агенты являются полезными для профилактики и/или лечения рака, включая метастазы рака. Данное изобретение обеспечивает применение таких агентов в схемах первичной/бустерной вакцинации людей и других млекопитающих с иммунизацией, включая пациентов с ослабленным иммунитетом; и в индукции как гуморальных, так и клеточных иммунных ответов, такой как индукция Th1 иммунного ответа в предсуществующем Th2 окружении.

Термин «полипептид» относится к полимеру из двух или более аминокислот, связанных друг с другом пептидными или модифицированными пептидными связями. Данные аминокислоты могут быть встречающимися в природе, а также не встречающимися в природе или химическим аналогом встречающейся в природе аминокислоты. Данный термин также относится к белкам, т.е. к функциональным биомолекулам, содержащим по меньшей мере один полипептид; если они содержат по меньшей мере два полипептида, они могут образовывать комплексы, быть ковалентно связанными или могут быть нековалентно связанными. Полипептид(ы) в белке могут быть гликозилированными и/или липидированными, и/или могут содержать простетические группы.

Термин «неспособный к репродуктивной репликации» в линиях человеческих клеток, таких как линии клеток НаСАТ (Boukamp et al. 1988, J Cell Biol 106(3): 761-71) или HeLa, используется в настоящей заявке, как определено в WO 02/42480. Таким образом, вирус, который «не способен к репродуктивной репликации» в линии клеток, представляет собой вирус, который показывает степень амплификации меньше 1 в этой линии клеток. «Степень амплификации» вируса представляет собой отношение вируса, продуцированного из инфицированной клетки (выход), к количеству, исходно используемому для инфицирования клеток в первом месте (вход). Отношение «1» между выходом и входом определяет амплификационный статус, где количество вируса, продуцированного из инфицированных клеток, является таким же, что и количество, исходно используемое для инфицирования клеток. Согласно одному воплощению настоящего изобретения вирусы, которые «не способны к репродуктивной репликации» в человеческих клеточных линиях, могут иметь степень амплификации 1,0 (среднее значение) или менее, или даже 0,8 (среднее значение) или менее в любой из вышеуказанных человеческих клеточных линий HeLa, HaCat и 143В.

В определенных воплощениях MVA представляет собой MVA-BN®, депонированный 30 августа 2000 года в Европейской коллекции культур клеток (ЕСАСС) под номером V00083008, и описанный в патентах США №6761893 и 6193752. Как описано в этих публикациях патентов, MVA-BN® не подвергается репродуктивной репликации в линиях клеток 293, 143В, HeLa и HaCat. В частности MVA-BN® демонстрирует степень амплификации от 0,05 до 0,2 в линии клеток почки человеческого эмбриона 293. В линии клеток человеческой остеосаркомы кости 143В MVA-BN® демонстрирует степень амплификации от 0,0 до 0,6. MVA-BN® демонстрирует степень амплификации от 0,04 до 0,8 в линии клеток человеческой аденокарциномы шейки матки HeLa, и от 0,02 до 0,8 в линии клеток человеческих кератиноцитов HaCat. MVA-BN® имеет степень амплификации от 0,01 до 0,06 в клетках почки африканской зеленой мартышки (CV1: ATCC No.CCL-70).

Степень амплификации MVA-BN® составляет более 1 в фибробластах куриных эмбрионов (CEF: первичные культуры), как описано в патентах США №6761893 и 6193752. Данный вирус можно легко размножать и амплифицировать в первичных культурах CEF со степенью более 500.

В определенных воплощениях рекомбинантный MVA предсталяет собой производное MVA-BN®. Такие «производные» включают вирусы, демонстрирующие по существу те же самые характеристики репликации, что и депонированный штамм (ЕСАСС No. V00083008), но имеющие отличия в одной или в более чем одной частях его генома. Данные «производные» не обязательно происходят от MVA-BN®. Вирусы, имеющие те же самые «характеристики репликации», что и депонированный вирус, представляют собой вирусы, которые реплицируются с такими же степенями амплификации, что и депонированный штамм, в клетках CEF и в линиях клеток HeLa, HaCat и 143В; и которые показывают аналогичные характеристики репликации in vivo, определенные, например, в трансгенной мышиной модели AGR129.

Данное изобретение охватывает вирусы MVA, которые имеют одно или оба из следующих свойств MVA-BN:

- способность к репродуктивной репликации в фибробластах куриных эмбриона (CEF), но отсутствие способности к репродуктивной репликации в линии клеток человеческих кератиноцитов (НаСаТ), линии клеток почки человеческого эмбриона (293), линии клеток человеческой остеосаркомы кости (143В) и в линии клеток человеческой аденокарциномы шейки матки (HeLa); и

- неспособность реплицироваться в мышиной модели, которая способна продуцировать зрелые В- и Т-клетки, и, как таковая, имеет сильно ослабленный иммунитет и является высокочувствительной к реплицирующемуся вирусу.

В определенных воплощениях MVA представляет собой рекомбинантный вирус коровьей оспы, который содержит дополнительные нуклеотидные последовательности, которые являются гетерологичными по отношению к вирусу коровьей оспы. В некоторых таких воплощениях гетерологичные последовательности кодируют эпитопы, которые индуцируют ответ иммунной системы. Таким образом, в определенных воплощениях рекомбинантный MVA используют для вакцинации против белков или агентов, содержащих данный эпитоп. В предпочтительном воплощении данный эпитоп представляет собой антиген, ассоциированный с опухолью, предпочтительно PSA или РАР. В одном воплощении антиген PSA содержит последовательность SEQ ID NO:1. В одном воплощении антиген РАР содержит последовательность SEQ ID NO:2.

В определенных воплощениях гетерологичная последовательность нуклеиновой кислоты вставлена в несущественную область вирусного генома. В некоторых из этих воплощений гетерологичная последовательность нуклеиновой кислоты вставлена в природный сайт делеции генома MVA, как описано в РСТ/ЕР96/02926. Способы вставки гетерологичных последовательностей в геном вируса оспы известны квалифицированному специалисту в данной области. В определенных воплощениях гетерологичная последовательность нуклеиновой кислоты вставлена в межгенную область генома MVA, как описано в опубликованной заявке на патент США 20050244428. В одном воплощении данной межгенной областью является IGR 014L/015L.

В определенных воплощениях фармацевтические композиции содержат один или более чем один фармацевтически приемлемый и/или одобренный носитель, добавку, антибиотик, консервант, адъювант, разбавитель и/или стабилизатор. Такие добавки, например, включают, но не ограничиваются ими, воду, физиологический раствор, глицерин, этанол, увлажнители или эмульгаторы и забуферивающие рН вещества. Типичными носителями обычно являются большие, медленно метаболизируемые молекулы, такие как белки, полисахариды, полимолочные кислоты, полигликолевые кислоты, полимерные аминокислоты, сополимеры аминокислот, липидные агрегаты или тому подобное.

Для получения вакцин MVA может быть превращен в физиологически приемлемую форму. В определенных воплощениях такое получение основано на опыте в получении вакцин на основе поксвирусов, используемых для вакцинации против натуральной оспы, как описано, например, в Stickl, H. et al., Dtsch. med. Wschr. 99:2386-2392 (1974).

Типичное получение описано ниже. Очищенный вирус с титром 5×108 TCID50/мл, приготовленный в виде препарата в 10 мМ Tris, 140 мМ NaCl, pH 7,4, хранят при -80°С. Для получения доз вакцины, например, 102-108 частиц вируса можно лиофилизировать в забуференном фосфатом физиологическом растворе (PBS) в присутствии 2% пептона и 1% человеческого альбумина в ампуле, предпочтительно в стеклянной ампуле. В качестве альтернативы, дозы вакцины можно получать путем ступенчатой сушки замораживанием вируса в препарате. В определенных воплощениях данный препарат содержит дополнительные добавки, такие как маннит, декстран, сахар, глицин, лактоза, поливинилпирролидон или другие добавки, такие как, например, без ограничения ими, антиоксиданты или инертный газ, стабилизаторы или рекомбинантные белки (например человеческий сывороточный альбумин), подходящими для введения in vivo. Ампулу затем запаивают, и ее можно хранить при подходящей температуре, например, от 4°С до комнатной температуры, в течение нескольких месяцев. Однако при отсутствии такой необходимости ампулу предпочтительно хранят при температурах ниже -20°С.

В разных воплощениях, включающих вакцинацию или терапию, лиофилизат растворяют в 0,1-0,5 мл водного раствора, предпочтительно физиологического раствора или Tris буфера, и вводят либо системно, либо местно, т.е. парентеральным, подкожным, внутривенным, внутримышечным, интраназальным, внутрикожным или любым другим путем введения, известным квалифицированному практику. Оптимизация способа введения, дозы и числа введений находится в пределах квалификации и знаний квалифицированного специалиста в данной области.

В определенных воплощениях штаммы ослабленного вируса коровьей оспы являются полезными для индукции иммунных ответов у животных с ослабленным иммунитетом, например, у обезьян (CD4<400/мкл крови), инфицированных SIV (вирус иммунодефицита обезьян), или у людей с ослабленным иммунитетом. Термин «с ослабленным иммунитетом» описывает статус иммунной системы индивидуума, которая демонстрирует лишь неполные иммунные ответы или имеет пониженную эффективность защиты против инфекционных агентов.

Некоторые типичные антигены, ассоциированные с опухолью

В определенных воплощениях у субъекта продуцируется иммунный ответ против полипептидного антигена, ассоциированного с клеткой. В некоторых таких воплощениях полипептидный антиген, ассоциированный с клеткой, представляет собой антиген, ассоциированный с опухолью.

В определенных воплощениях полипептидный антиген, ассоциированный с клеткой, представляет собой антиген на основе собственного белка, отличный от антигена, ассоциированного с опухолью, который относится к другим патологическим процессам, или вирусный антиген, или антигены, происходящие из внутриклеточного паразита или бактерии. В определенных случаях такие антигены, ассоциированные с патогенами, часто являются относительно слабыми иммуногенами (например антигены из микобактерий, таких как Mycobacterium tuberculosis и Mycobacterium leprae, а также из простейших, таких как Plasmodium spp.).

В данной области известны многочисленные антигены, ассоциированные с опухолью. Типичные антигены, ассоциированные с опухолью, включают, без ограничения ими, 5-альфа-редуктазу, альфа-фетопротеин, АМ-1, АРС, April, BAGE, бета-катенин, Всl12, bcr-abl, CA-125, CASP-8/FLICE, катепсины, CD19, CD20, CD21, CD23, CD22, CD33, CD35, CD44, CD45, CD46, CD5, CD52, CD55, CD59, CDC27, CDK4, СЕА, c-myc, Cox-2, DCC, DcR3, E6/E7, CGFR, ЕМВР, Dna78, фарнезилтрансферазу, FGF8b (фактор роста фибробластов 8b), FGF8a, FLK-1/KDR, рецептор фолиевой кислоты, G250, семейство GAGE, гастрин 17, гастрин-рилизинг гормон, GD2/GD3/GM2, GnRH, GnTV, GP1, gp100/Pmel17, gp-100-in4, gp15, gp75ЛРР-1, hCG, гепараназу, Her2/neu, HMTV, Hsp70 (белок теплового шока 70), hTERT, IGFR1, IL-13R (интерлейкин-13Р), iNOS, Ki67, KIAA0205, K-ras, H-ras, N-ras, KSA, LKLR-FUT, семейство MAGE, маммаглобин, MAP17, мелан-A/MART-1, мезотелин, MIC А/В, МТ-ММР, муцин, NY-ESO-1, остеонектин, р15, P170/MDR1, р53, р97/меланотрансферрин, PAI-1, PDGF (фактор роста тромбоцитов), uPA, PRAME, пробазин, прогенипоиентин, PSA, PAP, PSM, RAGE-1, Rb, RCAS1, RCAS1, SART-1, семейство SSX, STAT3, STn, TAG-72, TGF-альфа (фактор роста опухоли-альфа), TGF-бета, тимозин-бета-15, TNF-альфа (фактор некроза опухоли-альфа), ТР1, TRP-2, тирозиназу, VEGF (фактор роста эндотелия сосудов), ZAG, p16INK4 и глутатион-8-трансферазу. Конкретные примеры антигенов, ассоциированных с опухолью, при раке простаты включают, но не ограничиваются ими, PSA, простато-специфичный мембранный антиген (PSMA), РАР и антиген стволовых клеток простаты (PSCA).

Антигены PSA и РАР

Данное изобретение охватывает антигены PSA и РАР, которые являются полноразмерными или фрагментами PSA и РАР. Предпочтительно антигены PSA и РАР являются человеческими. В другом воплощении PSA и/или РАР является крысиным или мышиным. В предпочтительном воплощении антигены PSA и РАР кодируются, соответственно, нуклеотидными последовательностями SEQIDNO:1 и SEQIDNO:2.

В одном воплощении антиген РАР является фрагментом РАР. Предпочтительные фрагменты содержат аминокислоты 181-95, 112-120, 133-152, 155-163, 173-192, 199-213, 228-242, 248-257, 299-307 или 308-322 человеческого РАР. Смотрите Waeckerle-Men et al., Cancer Immunol. Immunother. 55:1524-1533 (2006); Klyushnenkova et al., Prostate 67(10):1019-28 (2007); Matsueda et al., Clin Cancer Res. 11(19 Pt 1):6933-43 (2005); Harada et al., Oncol Rep.12(3):601-7 (2004); Machlenkin et al., Cancer Res. 65(14):6435-6442 (2005); и McNeel et al., Cancer Res. 61(13):5161-7 (2001), которые тем самым являются включенными посредством ссылки. В одном воплощении полипептид содержит один из этих эпитопов. В других воплощениях полипептид содержит 2, 3, 4, 5, 6, 7, 8, 9 или 10 этих эпитопов. Каждая из возможных комбинаций этих эпитопов специфически включена.

В определенных воплощениях фрагмент РАР содержит 25, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325 или 375 последовательных аминокислот человеческого РАР. Фрагменты РАР можно анализировать на сохранение эпитопов с использованием хорошо известных в данной области анализов. Смотрите, например, Klyushnenkova et al., Prostate 67(10):1019-28 (2007); Matsueda et al., Clin Cancer Res. 11(19 Pt 1):6933-43 (2005), которые тем самым являются включенными посредством ссылки.

ДНК, кодирующие эти фрагменты, можно генерировать посредством ПЦР (полимеразная цепная реакция) или другими обычными методиками молекулярной биологии.

В одном воплощении антиген PSA является фрагментом PSA. Предпочтительные фрагменты включают аминокислоты 16-24 или 154-163 человеческого PSA. Смотрите Waeckerle-Men et al., Cancer Immunol. Immunother. 55:1524-1533 (2006); Matsueda et al., Clin Cancer Res. 11(19 Pt 1):6933-43 (2005), которые тем самым являются включенными посредством ссылки. В одном воплощении полипептид содержит один из этих эпитопов. В других воплощениях полипептид содержит оба этих эпитопа.

Фрагменты PSA можно анализировать на сохранение эпитопов с использованием хорошо известных в данной области анализов, таких как сканирование эпитопов. В определенном воплощении фрагмент PSA содержит 25, 50, 75, 100, 125, 150, 175, 200, 225 или 250 последовательных аминокислот человеческого PSA.

ДНК, кодирующие эти фрагменты, можно генерировать посредством ПЦР или другими обычными методиками молекулярной биологии.

Разные модифицированные полипептидные антигены РАР и PSA и способы можно получить способами, хорошо известными в данной области. Например, можно использовать способы, описанные в патенте США №7005498 и в публикациях заявок на патенты США №2004/0141958 и 2006/0008465, которые тем самым включены посредством ссылки.

Следует рассматривать следующие параметры:

1. Известные и предсказанные эпитопы CTL;

2. Гомологию с родственными белками;

3. Сохранение остатков цистеина;

4. Предсказанные структуры петель, α-спиралей и β-складчатых структур;

5. Потенциальные сайты N-гликозилирования;

6. Предсказание экспонированных и внутренних аминокислотных остатков;

7. Доменная организация.

Области с высокой степенью гомологии с другими родственными белками вероятно являются структурно важными для «общей» третичной структуры и, следовательно, для узнавания антителами, тогда как области с низкой гомологией возможно можно заменить лишь с местными изменениями структуры в качестве последствия.

Остатки цистеина часто участвуют в образовании внутримолекулярных дисульфидных мостиков и, таким образом, участвуют в третичной структуре и не должны заменяться. Областей, для которых предсказано образование альфа-спиральных или бета-складчатых структур, следует избегать в качестве точек вставки чужеродных эпитопов, так как считается, что эти области участвуют в сворачивании белка.

Потенциальные сайты N-гликозилирования следует сохранять, если маннозилирование белка является желательным.

Области, предсказанные (по их гидрофобным свойствам) как внутренние в молекуле, предпочтительно следует сохранять, так как они могли бы участвовать в сворачивании. Напротив, области, экспонированные в раствор, могли бы служить как положения-кандидаты для вставки модельных ТН эпитопов Р2 и Р30.

Наконец, следует принимать во внимание доменную организацию белка из-за ее релевантности для структуры и функции белка.

Эффект модификаций PSA и РАР можно анализировать иммунизациями животных, таких как мыши, для определения эффекта модификаций на гуморальный и клеточный иммунные ответы.

Модифицированные антигены, ассоциированные с опухолью

В определенных воплощениях полипептидный антиген, ассоциированный с клеткой, модифицируют так, что индуцируется ответ CTL (цитотоксический Т-лимфоцит) против клетки, которая презентирует эпитопы, происходящие из полипептидного антигена, на ее поверхности, при презентации в ассоциации с молекулой МНС I класса (главный комплекс гистосовметимости) на поверхности АРС (антигенпрезентирующая клетка). В некоторых таких воплощениях по меньшей мере один первый чужеродный ТН эпитоп при презентации ассоциирован с молекулой МНС II класса на поверхности АРС. В некоторых таких воплощениях антиген, ассоциированный с клеткой, представляет собой антиген, ассоциированный с опухолью.

Типичные АРС, способные к презентации эпитопов, включают дендритные клетки и макрофаги. Дополнительные типичные АРС включают пино- или фагоцитирующие АРС, которые способны одновременно представлять 1) эпитопы CTL, связанные с молекулами МНС I класса, и 2) ТН эпитопы, связанные с молекулами МНС II класса.

В определенных воплощениях модификации PSA и/или РАР осуществляют таким образом, что после введения субъекту индуцируются поликлональные антитела, которые предпочтительно реагируют с PSA и/или с PAP. Такие антитела могли бы атаковать и устранять опухолевые клетки, а также предупреждать развитие метастазов из метастатических клеток. Эффекторный механизм этого противоопухолевого эффекта был бы опосредован комплементом и зависимой от антител клеточной цитотоксичностью. Кроме того, индуцированные антитела также могли бы ингибировать рост раковых клеток посредством ингибирования зависимой от факторов роста олиго-димеризации и интернализации рецепторов. В определенных воплощениях такие модифицированные полипептидные антигены PSA и/или РАР могут индуцировать ответы CTL, направленные против известных и/или предсказанных эпитопов PSA и/или РАР, воспроизводимых опухолевыми клетками. В предпочтительном воплощении антигены PSA и РАР индуцируют В-клеточный и T-клеточный ответ против этих антигенов.

В определенных воплощениях модифицированный полипептидный антиген PSA и/или РАР содержит эпитоп CTL полипептидного антигена, ассоциированного с клеткой, и вариацию, где данная вариация содержит по меньшей мере один эпитоп CTL чужеродного ТН эпитопа. Такие отдельные модифицированные полипептидные антигены PSA и/или РАР, содержащие по меньшей мере один эпитоп CTL и вариацию, содержащую по меньшей мере один эпитоп CTL чужеродного ТН эпитопа, и способы их получения описаны в патенте США №7005498 и в публикациях заявок на патенты США №2004/0141958 и 2006/0008465.

В определенных воплощениях чужеродный ТН эпитоп представляет собой встречающийся в природе «случайный» Т-клеточный эпитоп. Такие случайные Т-клеточные эпитопы являются активными у большой доли индивидуумов видов животных или человеческого населения. В определенных воплощениях вакцина содержит такие случайные Т-клеточные эпитопы. В некоторых таких воплощениях применение случайных Т-клеточных эпитопов уменьшает потребность в очень большом числе разных эпитопов CTL в той же самой вакцине. Типичные случайные эпитопы Т-клеток включают, но не ограничиваются, эпитопами из столбнячного токсина, включая, но не ограничиваясь, эпитопами Р2 и Р30 (Panina-Bordignon et al., 1989), дифтерийного токсина, гемагглютинина (НА) вируса гриппа и антигена CS Р.falciparum.

Дополнительные случайные эпитопы Т-клеток включают пептиды, способные к связыванию большой доли молекул HLA-DR, кодируемых разными HLA-DR. Смотрите, например, WO 98/23635 (Frazer IH et al., assigned to The University of Queensland); Southwood S et al., J. Immunol. 160:3363-3373 (1998); Sinigaglia F et al., Nature 336:778 780 (1988); Rammensee HG et al., Immunogenetics 41(4):178-228 (1995); Chicz RM et al., J. Exp. Med 178:27-47 (1993); Hammer J et al., Cell 74:197-203 (1993); и Falk К et al., Immunogenetics 39:230-242 (1994). Последняя ссылка также касается лигандов HLA-DQ и -DP. Все эпитопы, перечисленные в этих ссылках, являются релевантными в качестве природных эпитопов-кандидатов, как здесь описано, как и эпитопы, которые имеют общие с ними мотивы.

В некоторых других воплощениях случайный эпитоп Т-клетки представляет собой искусственный эпитоп Т-клетки, который способен связываться с большей долей гаплотипов. В некоторых таких воплощениях искусственный эпитоп Т-клетки представляет собой общий эпитоп DR пептида ("PADRE"), как описано в WO 95/07707 и в соответствующей статье Alexander J etal., Immunity 1:751-761 (1994).

Рекомбинантный MVA

Данное изобретение охватывает рекомбинантный вирус MVA, экспрессирующий полипептид, содержащий антиген РАР. Предпочтительно вирус MVA экспрессирует человеческий антиген РАР. В одном воплощении вирус MVA экспрессирует крысиный или мышиный - антиген РАР. В одном воплощении вирус MVA кодирует полноразмерный антиген РАР. В предпочтительном воплощении данный MVA содержит нуклеотидную последовательность SEQ ID NO:2.

В другом воплощении MVA кодирует фрагмент РАР. Фрагменты РАР можно анализировать на сохранение эпитопов, используя хорошо известные в данной области анализы. Смотрите, например, Klyushnenkova et al., Prostate 67(10):1019-28 (2007); Matsueda et at., Clin Cancer Res. 11(19 Pt 1):6933-43 (2005); Machlenkin et al., Cancer Res. 65(14):6435-6442 (2005), которые тем самым являются включенными посредством ссылки. В определенном воплощении фрагмент РАР содержит 25, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325 или 375 последовательных аминокислот человеческого РАР.

В предпочтительных воплощениях MVA кодирует полипептид, содержащий аминокислоты 81-95, 112-120, 133-152, 155-163, 173-192, 199-213, 228-242, 248-257, 299-307 или 308-322 человеческого РАР. Смотрите Waeckerle-Men et al., Cancer Immunol. Immunother. 55:1524-1533 (2006); Klyushnenkova et al., Prostate 67(10): 1019-28 (2007); Matsueda et al., Clin Cancer Res. 11(19 Pt 1): 6933-43 (2005); Harada et al., Oncol Rep.12(3): 601-7 (2004); Machlenkin et al., Cancer Res. 65(14): 6435-6442 (2005); и McNeel et al., Cancer Res. 61(13): 5161-7 (2001), которые тем самым являются включенными посредством ссылки. В одном воплощении данный полипептид содержит один из этих эпитопов. В других воплощениях данный полипептид содержит 2, 3, 4, 5, 6, 7, 8, 9 или 10 из этих эпитопов. Конкретно рассматривается каждая из возможных комбинаций этих эпитопов.

Данное изобретение охватывает рекомбинантный вирус MVA, экспрессирующий полипептид, содержащий антиген PSA, рекомбинантный вирус MVA, экспрессирующий полипептид, содержащий антиген PSA, и полипептид, содержащий антиген РАР. Предпочтительно вирус MVA экспрессирует человеческий антиген PSA. В одном воплощении вирус MVA экспрессирует крысиный или мышиный антиген PSA. В одном воплощении вирус MVA кодирует полноразмерный антиген PSA. В предпочтительном воплощении MVA содержит нуклеотидную последовательность SEQ ID NO:1.

В другом воплощении MVA кодирует фрагмент PSA. Фрагменты PSA можно анализировать на сохранение эпитопов с использованием хорошо известных в данной области анализов. В определенном воплощении фрагмент PSA содержит 25, 50, 75, 100, 125, 150, 175, 200, 225 или 250 последовательных аминокислот человеческого PSA.

В предпочтительных воплощениях MVA кодирует полипептид, содержащий аминокислоты 16-24 или 154-163 человеческого PSA. Смотрите Waeckerle-Men et al., Cancer Immunol. Immunother. 55:1524-1533 (2006); Matsueda et al., Clin Cancer Res. 11(19 Pt 1):6933-43 (2005), которые тем самым являются включенными посредством ссылки. В одном воплощении данный полипептид содержит один из этих эпитопов. В других воплощениях данный полипептид содержит оба из этих эпитопов.

Рекомбинантный вирус MVA можно использовать в иммуногенной композиции для индукции В-клеточных и Т-клеточных иммунных ответов против PAP и/или PSA при введении хозяину. В предпочтительном воплощении данная иммуногенная композиция индуцирует антитела против РАР и/или PSA при введении хозяину. Иммуногенная композиция может содержать адъюванты, разбавители и/или стабилизаторы. Такие добавки, например, включают, но не ограничиваются ими, воду, физиологический раствор, глицерин, этанол, увлажнители или эмульгаторы и вещества, забуферивающие рН.

В одном воплощении MVA представляет собой MVA-BN®.

В неограничивающем воплощении рекомбинантный MVA, содержащий антиген, ассоциированный с опухолью, например, MVA-BN-PRO, кодирующий оба антигена PSA и РАР, сконструирован слудующим образом. Исходный маточный раствор вируса генерируют рекомбинацией в культуре клеток с использованием типа клеток, пермиссивного для репликации, например, клеток CEF. Клетки инокулируют ослабленным вирусом коровьей оспы, например MVA-BN®, и трансфицируют плазмидой для рекомбинации (например pBN217), которая кодирует антиген, ассоциированный с опухолью, например PSA или РАР, последовательность и фланкирующие области вирусного генома. В одном неограничивающем воплощении плазмида pBN217 содержит последовательности, которые также присутствуют в MVA-BN® (открытые рамки считывания 014L и 015L). Последовательности кДНК PSA и РАР вставляют между последовательностями MVA-BN® для обеспечения рекомбинации в вирусный геном MVA-BN®. В определенных воплощениях данная плазмида также содержит кассету для селекции, содержащую один или более чем один ген селекции для обеспечения селекции рекомбинантных конструкций в клетках CEF.

Одновременная инфекция и трансфекция культур обеспечивает осуществление гомологичной рекомбинации между вирусным геномом и плазмидой для рекомбинации. Вирус, несущий вставку, затем выделяют, характеризуют и готовят маточный раствор вируса. В определенных воплощениях вирус пассируют в культурах клеток CEF в отсутствие селекции для обеспечения потери участков, кодирующих гены селекции, например gpt и гена красного флуоресцентного белка (RFP).

Способы лечения

Пациентов с раком, опосредованным клетками, сверхэкспрессирующими антигены, ассоциированные с опухолью, такие как PSA и/или РАР, можно лечить рекомбинантным MVA, кодирующим один или более чем один такой антиген. В предпочтительном воплощении MVA представляет собой MVA-BN®. В особо предпочтительном воплощении MVA кодирует полипептид, содержащий нуклеотидную последовательность SEQ ID NO:1, и второй полипептид, содержащий нуклеотидную последовательность SEQ ID NO:2.

Рак предпочтительно представляет собой рак простаты. В одном воплощении рак представляет собой метастатический рак простаты. Раковый пациент может быть любым млекопитающим, включая мышь или крысу. Предпочтительно раковый пациент является приматом, наиболее предпочтительно человеком.

Рекомбинантный MVA, кодирующий один или более чем один антиген, ассоциированный с опухолью (например PSA или РАР), можно вводить либо системно, либо местно, т.е. парентеральным, подкожным, внутривенным, внутримышечным, интраназальным, внутрикожным или любым другим путем введения, известным квалифицированному практику.

В одном воплощении пациенту вводят 105-1010 TCID50 рекомбинантного MVA. Предпочтительно пациенту вводят 107-1010 TCID50 рекомбинантного MVA. Более предпочтительно пациенту вводят 108-1010 TCID50 рекомбинантного MVA. Наиболее предпочтительно пациенту вводят 108-109 или 109-1010 TCID50 рекомбинантного MVA. Предпочтительно рекомбинантный MVA вводят пациенту в дозе 1×108, 2×108 или 4×108 TCID50.

Рекомбинантный MVA можно вводить один раз или многократно. В определенных воплощениях рекомбинантный MVA вводят два, три, четыре или пять раз. Предпочтительно рекомбинантный MVA дают три раза. Наиболее предпочтительно дают три раза с четырехнедельными интервалами. Интервал между введениями предпочтительно составляет 1-4 недели, 1-8 недель, 1-16 недель и 1-52 недели. В одном воплощении рекомбинантный MVA вводят в сутки 0 и вновь в сутки 8 и 15. В предпочтительном воплощении дозировку увеличивают для последующих введений.

В особенно предпочтительном воплощении 1×108, 2×108 и 4×108 TCID50 дают три раза с четырехнедельными интервалами. Объяснение многократного введенияз рекомбинантного MVA основано на доклинических данных по иммуногенности у мышей, показывающих, что бустерные обработки значительно увеличивали иммунные ответы против PSA и против РАР.

Принимая во внимание огромный иммунологический полиморфизм у людей, введение трех или более доз может обеспечить достижение максимального иммунного ответа каждыминдивидуумом.

В одном воплощении обработка рекомбинантным MVA индуцирует антительные ответы против PSA и/или против РАР.В одном воплощении обработка рекомбинантным MVA индуцирует анти-PSA и/или анти-РАР Т-клеточные иммунные ответы. В одном воплощении обработка рекомбинантным MVA индуцирует анти-PSA и/или анти-РАР антительные и Т-клеточные иммунные ответы.

В одном воплощении обработка рекомбинантным MVA индуцирует распространение Т-клеточных ответов на другие опухолевые антигены.

В одном воплощении обработка рекомбинантным MVA ингибирует рост PSA (+) опухолей в профилактической и/или терапевтической постановке. В одном воплощении обработка рекомбинантным MVA ингибирует рост РАР (+) опухолей в профилактической и/или терапевтической постановке. В одном воплощении обработка рекомбинантным MVA ингибирует рост PSA (+) и РАР (+) опухолей в профилактической и/или терапевтической постановке.

Комбинированная терапия с цитотоксическими агентами

Пациентов с раком, опосредованным клетками, сверхэкспрессирующими антигены, ассоциированные с опухолью, такие как PSA и/или РАР, можно лечить комбинацией рекомбинантного MVA, кодирующего один или более чем один такой антиген, с таксаном. Цитотоксические агенты демонстрируют иммуномодулирующие активности в дозах, близких к дозам, уничтожающим раковые клетки, которые могли бы быть полезными для эффективности вакцины. В дозах, уничтожающих раковые клетки (в высоких дозах), применение этих агентов одновременно, до или после обработки рекомбинантным MVA может иметь преимущества относительно любой обработки по отдельности.

В одном воплощении таксаном является доцетаксел. В другом воплощении таксаном является паклитаксел. Таксан предпочтительно вводят в дозе, уничтожающей раковые клетки. Доза доцетаксела, «уничтожающая раковые клетки», составляет по меньшей мере 50 мг/м2. Предпочтительно доза доцетаксела, уничтожающая раковые клетки, составляет 75-100 мг/м2, что соответствует дозировке приблизительно 25-33 мг/кг. Доза паклитаксела, «уничтожающая раковые клетки», составляет по меньшей мере 90 мг/м2. Предпочтительно доза паклитаксела, уничтожающая раковые клетки, составляет 135-175 мг/м2. «Доза таксана, близкая к дозе, уничтожающей раковые клетки», представляет собой дозировку, меньшую, чем дозировка, уничтожающая раковые клетки. Таксан можно вводить любыми способами, известными квалифицированному специалисту, например, внутривенно.

В одном воплощении таксан и MVA, кодирующий полипептид, содержащий антиген, специфичный для опухоли простаты, вводят в одно и то же самое время.

В одном воплощении таксан вводят до введения рекомбинантного MVA. В одном воплощении рекомбинантный MVA вводят в пределах 6 месяцев относительно введения таксана. В определенных воплощениях рекомбинантный MVA вводят в пределах 3 месяцев, в пределах 2 месяцев или в пределах 1 месяца после введения таксана. В одном воплощении рекомбинантный MVA вводят в пределах 21 суток после введения таксана. В одном воплощении рекомбинантный MVA вводят в пределах 14 суток после введения таксана. В одном воплощении рекомбинантный MVA вводят в пределах 7 суток после введения таксана. Обычно рекомбинантный MVA вводят по меньшей мере через 2 суток после лечения таксаном.

В одном воплощении таксан вводят после рекомбинантного MVA. Обычно рекомбинантный MVA вводят по меньшей мере за 1 неделю до лечения таксаном. В одном воплощении рекомбинантный MVA вводят менее чем за 2 года до таксана. В определенных воплощениях рекомбинантный MVA вводят менее чем за 1 год, менее чем за 6 месяцев или менее чем за 3 месяца до введения таксана. В одном воплощении рекомбинантный MVA вводят за 1-26 недель до введения таксана. В одном воплощении рекомбинантный MVA вводят за 1-9 недель до введения таксана. В одном воплощении рекомбинантный MVA вводят за 1-3 недели до введения таксана.

В определенных воплощениях таксан вводят как до, так и после введения рекомбинантного MVA. В других воплощениях рекомбинантный MVA вводят как до, так и после введения таксана. Введение рекомбинантного MVA и таксана может быть однократным введением или многократными введениями. Например, данные введения могут следоватеть с интервалами времени 1, 2, 3, 4, 5 или 6 недель.

Наборы

Данное изобретение охватывает наборы, содержащие рекомбинантный MVA. Рекомбинантный MVA может содержаться в сосуде или в контейнере. В одном воплощении рекомбинантный MVA кодирует антиген РАР. В одном воплощении рекомбинантный MVA кодирует полипептид, содержащий антиген PSA. В одном воплощении рекомбинантный MVA кодирует полипептид, содержащий антиген PSA и полипептид, содержащий антиген РАР. В разных воплощениях наборы для вакцинации содержат рекомбинантный MVA для первой вакцинации («примирования») в первом сосуде или контейнере и для второй или третьей вакцинации («бустер-иммунизации») - во втором или в третьем сосуде или контейнере.

В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для профилактики рака простаты. В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для профилактики рака простаты после определения увеличения уровня одного или более чем одного маркера, ассоциированного с опухолью простаты. В предпочтительном воплощении данные инструкции могут уведомлять о том, что MVA подлежит введению для профилактики рака простаты после определения увеличения уровней циркулирующего PSA. В одном воплощении данные инструкции могут уведомлять о том, что MVA подлежит введению для профилактики рака простаты пациенту-мужчине в возрасте старше 30 лет. В одном воплощении данные инструкции могут уведомлять о том, что MVA подлежит введению для профилактики рака простаты пациенту-мужчине в возрасте старше 30 лет и младше 40 лет. В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для профилактики рака простаты в возрасте старше 40 лет.

В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для профилактики метастазов рака простаты. В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для профилактики метастазов рака простаты после определения увеличения уровня маркера, ассоциированного с клетками опухоли простаты. В предпочтительном воплощении данные инструкции могут предписывать, что MVA подлежит введению для профилактики метастазов рака простаты после определения того, что возросли уровни циркулирующего PSA, и несмотря на отсутствие определимой первичной опухоли. В одном воплощении данные инструкции могут предписывать, что MVA подлежит введению для профилактики метастазов рака простаты пациенту-мужчине в возрасте старше 30 лет. В одном воплощении данные инструкции могут уведомлять о том, что MVA подлежит введению для профилактики метастазов рака простаты пациенту-мужчине в возрасте старше 30 лет и младше 40 лет. В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для профилактики метастазов рака простаты в возрасте старше 40 лет.

В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для лечения рака простаты. В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для лечения рака простаты после определения увеличения уровня одного или более чем одного маркера, ассоциированного с опухолью простаты. В предпочтительном воплощении данные инструкции могут предписывать, что MVA подлежит введению для лечения рака простаты после определения того, что возросли уровни циркулирующего PSA. В одном воплощении данные инструкции могут предписывать, что MVA подлежит введению для лечения рака простаты пациенту-мужчине в возрасте старше 30 лет. В одном воплощении данные инструкции могут уведомлять о том, что MVA подлежит введению для лечения рака простаты пациенту-мужчине в возрасте старше 30 лет и младше 40 лет. В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA для лечения рака простаты в возрасте старше 40 лет.

В одном воплощении данный набор может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA перед введением дозы таксана, уничтожающей опухолевые клетки. Данные инструкции могут предписывать, что MVA подлежит введению в любой момент времени от 6 месяцев до 1 недели перед введением таксана. В предпочтительных воплощениях данные инструкции предписывают, что MVA подлежит введению в любой момент времени от 3 месяцев до 1 недели, от шести недель до 1 недели, от 1 месяца до 1 недели, от 3 недель до 1 недели и от 2 недель до 1 недели до введения таксана. В одном воплощении данные инструкции могут предписывать то, что MVA подлежит введению в любой момент времени от 1 недели до 0 суток до введения таксана.

Данный набор также может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA в то же самое время, что и введение дозы таксана, уничтожающей опухолевые клетки.

Данный набор также может содержать рекомбинантный MVA и инструкции для введения рекомбинантного MVA после введение дозы таксана, уничтожающей опухолевые клетки. Данные инструкции могут предписывать, что MVA подлежит введению в любой момент времени от 1 суток до 6 месяцев после введения таксана. В предпочтительных воплощениях данные инструкции предписывают, что MVA подлежит введению в любой момент времени от 2 суток до 1 недели, от 2 суток до 2 недель, от 2 суток до 3 недель, от 2 суток до 1 месяца, от 2 суток до 2 месяцев, и от 2 суток до 3 месяцев, и от 2 суток до 6 месяцев после введения таксана. В одном воплощении данные инструкции могут предписывать, что MVA подлежит введению в любой момент времени от 0 суток до 2 суток после введения таксана.

Ниже приведены примеры и ссылки для иллюстрации настоящего изобретения с дополнительными подробностями, но объем настоящего изобретения не ограничивается этими примерами. Подразумевается, что любые изменения в деталях, приведенных в качестве примеров, которые приходят в голову квалифицированному специалисту, попадают в пределы объема настоящего изобретения. Кроме того, данное описание изобретения лучше всего понятно в свете процитированных ссылок, которые все тем самым включены посредством ссылки во всей их полноте.

ПРИМЕРЫ

Пример 1

Конструкция MVA-BN-PRO и анализ экспрессии белка в инфицированных клетках

Для разработки вакцины против рака простаты генерировали рекомбинантный вектор на основе вируса коровьей оспы, MVA-BN-PRO, который кодирует человеческий простато-специфический антиген (PSA) и простатическую кислую фосфатазу (PAP). Рекомбинантный вектор на основе вируса коровьей оспы MVA-BN-PRO был получен из высокоослабленного штамма вируса коровьей оспы MVA-BN® (модифицированный вирус коровьей оспы Анкара - Северо-Баварский). MVA-BN® высокоадаптирован для клеток первичных фибробластов куриных эмбрионов (CEF) и не подвергается репродуктивной репликации в человеческих клетках. В человеческих клетках вирусные гены экспрессируются, но не продуцируется инфекционный вирус.

Происхождение генов

кДНК генов PSA и РАР транскрибировали (обратная транскрипция) из общей РНК человеческой простаты, приобретенной у Clontech (каталожный №6410801), с использованием традиционных методик молекулярной биологии. PSA представляет собой простато-специфический антиген, продуцируемый простатой, и он обнаруживается в повышенном количестве в крови мужчин, которые имеют рак простаты, доброкачественную гиперплазию простаты либо инфекцию или воспаление простаты. PSA был идентифицирован как мишень для подходов клеточно-опосредованной иммунотерапии. РАР (простатическая кислая фосфатаза) является ферментом, измеряемым в крови, уровни которого могут быть повышенными у пациентов с раком простаты, который распространился или метастазировал еще где-либо. РАР не увеличивается, если опухоль не распространилась вовне анатомической капсулы простаты. Следовательно, этот простатичекий опухолевый антиген в настоящее время исследуется как антиген-мишень в нескольких испытаниях человеческой вакцины, причем некоторые из них имеют доказательство клинической пользы.

Подтвердили, что последовательности образующихся амплифицированных кДНК PSA и РАР соответствуют опубликованным последовательностям. Таким образом, кДНК PSA (например среди прочих GenBank M26663.1 GL618463; синонимы: калликреин 3; KLK3; 786 п.о.) и последовательность кДНК гена РАР (GenBank M34840.1 GI:189620; синонимы: РАР; АСР3; АСР-3; АСРР; 1161 п.о.) показаны ниже.

Человеческая последовательность кДНК PSA (99% идентичности с последовательностью GenBank M26663.1; жирный шрифт: три молчащие замены нуклеотидов в положениях 48, 54 и 237, которые не изменяют аминокислотную последовательность):

ATGTGGGTCCCGGTTGTCTTCCTCACCCTGTCCGTGACGTGGATTGGCGCTGCGCCCCTCAT CCTGTCTCGGATTGTGGGAGGCTGGGAGTGCGAGAAGCATTCCCAACCCTGGCAGGTGCTTG TGGCCTCTCGTGGCAGGGCAGTCTGCGGCGGTGTTCTGGTGCACCCCCAGTGGGTCCTCACA GCTGCCCACTGCATCAGGAACAAAAGCGTGATCTTGCTGGGTCGGCACAGTCTGTTTCATCC TGAAGACACAGGCCAGGTATTTCAGGTCAGCCACAGCTTCCCACACCCGCTCTACGATATGA GCCTCCTGAAGAATCGATTCCTCAGGCCAGGTGATGACTCCAGCCACGACCTCATGCTGCTC CGCCTGTCAGAGCCTGCCGAGCTCACGGATGCTGTGAAGGTCATGGACCTGCCCACCCAGGA GCCAGCACTGGGGACCACCTGCTACGCCTCAGGCTGGGGCAGCATTGAACCAGAGGAGTTCT TGACCCCAAAGAAACTTCAGTGTGTGGACCTCCATGTTATTTCCAATGACGTGTGTGCGCAA GTTCACCCTCAGAAGGTGACCAAGTTCATGCTGTGTGCTGGACGCTGGACAGGGGGCAAAAG CACCTGCTCGGGTGATTCTGGGGGCCCACTTGTCTGTAATGGTGTGCTTCAAGGTATCACGT CATGGGGCAGTGAACCATGTGCCCTGCCCGAAAGGCCTTCCCTGTACACCAAGGTGGTGCAT TACCGGAAGTGGATCAAGGACACCATCGTGGCCAACCCCTGA (SEQ ID NO:1)

Аминокислотная последовательность человеческого PSA является следующей:

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVAS RGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYD MSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI EPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLV CNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP (SEQ ID N0:3).

Последовательность кДНК человеческой РАР (100% идентичности с последовательностью GenBank M34840.1): ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCT GCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGT TTCGGCATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAATCCTCA TGGCCACAAGGATTTGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGA GTATATAAGAAAGAGATATAGAAAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATA TTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTGGCAGCCCTGTTT CCCCCAGAAGGTGTCAGCATCTGGAATCCTATCCTACTCTGGCAGCCCATCCCGGTGCACAC AGTTCCTCTTTCTGAAGATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAG AACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGGCTGCACCCTTATAAGGAT TTTATAGCTACCTTGGGAAAACTTTCAGGATTACATGGCCAGGACCTTTTTGGAATTTGGAG TAAAGTCTACGACCCTTTATATTGTGAGAGTGTTCACAATTTCACTTTACCCTCCTGGGCCA CTGAGGACACCATGACTAAGTTGAGAGAATTGTCAGAATTGTCCCTCCTGTCCCTCTATGGA ATTCACAAGCAGAAAGAGAAATCTAGGCTCCAAGGGGGTGTCCTGGTCAATGAAATCCTCAA TCACATGAAGAGAGCAACTCAGATACCAAGCTACAAAAAACTTATCATGTATTCTGCGCATG ACACTACTGTGAGTGGCCTACAGATGGCGCTAGATGTTTACAACGGACTCCTTCCTCCCTAT GCTTCTTGCCACTTGACGGAATTGTACTTTGAGAAGGGGGAGTACTTTGTGGAGATGTACTA TCGGAATGAGACGCAGCACGAGCCGTATCCCCTCATGCTACCTGGCTGCAGCCCTAGCTGTC CTCTGGAGAGGTTTGCTGAGCTGGTTGGCCCTGTGATCCCTCAAGACTGGTCCACGGAGTGT ATGACCACAAACAGCCATCAAGGTACTGAGGACAGTACAGATTAG (SEQ ID NO:2)

Аминокислотная последовательность человеческой РАР является следующей:

MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRH

GDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQV

YIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRN

CPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESV HNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQ IPSYKKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNE TQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTD (SEQ ID NO:4).

Происхождение промотора

Промотор включения А-типа вируса коровьей оспы (ATI), поздний промотор (показан ниже), генерировали синтетически в плазмиде pBluescript KS+ (Stratagene), вырезали и вставляли как перед последовательностью РАР, так и перед последовательностью PSA. Соответственно, белки PSA и РАР должны экспрессироваться с другими поздними генами после репликации ДНК.

Последовательность промотора ATI:

5'-GTTTTGAATAAAATTTTTTTATAATAAATC (SEQ ID NO:5)

Конструкция плазмиды для рекомбинации PSA/PAP-MVA-BN

Для вставки чужеродных генов в геном MVA-BN® можно использовать промежуточную плазмиду для рекомбинации, которая имеет в качестве мишени специфическую область генома MVA-BN®, а именно сайт делеции или межгенную (некодирующую область).

Промежуточная плазмида pBNX128 содержит последовательности ДНК MVA из областей, которые фланкируют межгенную (некодирующую) область (IGR) между открытыми рамками считывания (ORF) 014L и 015L. Последовательности, например кДНК PSA и РАР, можно вставить между этими фланкирующими последовательностями. Затем, когда и плазмида, и MVA-BN® присутствуют в той же самой клетке CEF, фланкирующие последовательности 014L/015L опосредуют гомологичную рекомбинацию, опосредующую вставку данных плазмидных последовательностей в межгенную область 014L/015L генома MVA-BN® (Фиг.1А-Б). Присутствие кассеты селекции во вставленных последовательностях обеспечивает позитивную селекцию рекомбинантных вирусов MVA-BN®.

Генерация MVA-BN-PRO

Одновременная инфекция и трансфекция культур обеспечивала прохождение гомологичной рекомбинации между вирусным геномом и плазмидой для рекомбинации. Образующийся рекомбинантный вектор на основе вируса коровьей оспы, обозначенный MVA-mBN106A, содержащий кодирующую область PSA и РАР и кассету селекции, получали после многократных очисток бляшек при селективных условиях. После амплификации и дополнительной очистки бляшек при неселективных условиях выделяли рекомбинантный вирус коровьей оспы MVA-BN-PRO, лишенный кассеты селекции.

Получали очищенный из бляшек вирус MVA-BN-PRO, лишенный кассеты селекции. Такое получение включало двенадцать (12) пассажей, включая четыре (4) очистки бляшек.

Присутствие последовательности промотор-PSA-промотор-РАР и отсутствие родительского вируса MVA-BN® в маточных растворах MVA-BN-PRO подтверждали секвенированием ДНК и ПЦР анализом, вложенную ПЦР использовали для подтверждения отсутствия кассеты селекции (гены gpt и RFP). Упрощенная схема генома MVA-BN-PRO показана на Фиг.2.

Пример 2

Соэкспрессия PSA и РАР в клетках, обработанных MVA-BN-PRO Одновременную экспрессию двух простато-специфичных антигенов, кодируемых MVA-BN-PRO, а именно человеческого PSA и человеческой РАР, продемонстрировали в клетках, инкубируемых с MVA-BN-PRO in vitro. Культуры СТ26, химически индуцированной колоректальной карциномы мышей BALB/c (Brattain et al., Cancer Research 40, 2142-2146 (1980)), инкубировали с MVA-BN-PRO, и супернатанты анализировали на присутствие рекомбинантных PSA и РАР. PSA измеряли с использованием диагоностического набора для PSA на основе ELISA, который обычно используется для скрининга образцов человеческой сыворотки (Human PSA ELISA Kit, Anogen, Ontario, Канада; диапазон детекции PSA: 2-80 нг/мл). РАР измеряли косвенно через ее ферментативные свойства, используя колориметрический анализ фосфатных активностей (анализ кислой фосфатазы; диапазон детекции РАР: 4-40 нг/мл). PSA и РАР анализировали в аликвотах тех же самых супернатантов культуры, собранных через 24 ч после добавления MVA-BN-PRO при множественности инфекции (MOI), варьирующей от 1 до 100.

Как показано на Фиг.3, оба антигена могли быть детектированы в супернатантах клеток, инкубируемых с MVA-BN-PRO. Количество рекомбинантных PSA и РАР, продуцируемых в культуре, зависело от количества MVA-BN-PRO (MOI) и числа клеток, используемых в данном эксперименте. Напротив, ни PSA, ни фосфатазная активность, указывающая на РАР, не могли быть детектированы в супернатантах контрольных культур, инкубируемых либо в одной среде, либо с соответствующей MOI MVA-BN®.

Титрование PSA и РАР при расчете с использованием графиков с эталонными стандартами выявило для каждого анализа, что клетками, инкубируемыми с MVA-BN-PRO, продуцировались сходные количества обоих антигенов. В самом деле, в культуральных супернатантах измерили 1043 нг/мл PSA и 209 нг/мл РАР при посеве 1×105 клеток СТ26 на лунку и инкубации с MVA-BN-PRO при MOI 10 в течение 48 ч. Последовательности PSA и РАР вставляли в одну и ту же область генома MVA-BN®, и их экспрессия независимо контролировалась промотором ATI, расположенным выше по течению от каждой последовательности. Эта конфигурация вставки, по-видимому, создает правильное окружение для оптимальной экспрессии обоих рекомбинантных антигенов. В целом, эти данные показывают, что MVA-BN® представляет собой адекватный носитель для хорошо сбалансированной и сопутствующей экспрессии многих трансгенных антигенов, подобных PSA и РАР.

Пример 3

Индукция иммунного ответа против РАР и против PSA у мышей, обработанных MVA-BN-PRO

Индукцию иммунных ответов против PSA и против РАР при обработке MVA-BN-PRO оценивали у мышей BALB/c. В этих исследованиях оценивали разные дозы MVA-BN-PRO, варьирующие от 2×106 до 5×107 TCID50. Образцы крови отбирали за одни сутки до каждой обработки и через две недели после конечной обработки и гуморальные ответы анализировали посредством ELISA. Спленоциты отбирали после конечной обработки и клеточные ответы анализировали посредством ELISpot (иммуноферментный спот-анализ).

Индукция антительных ответов против PSA и против РАР

Мышей BALB/c (5 животных в каждой группе) подкожно обрабатывали 5×107 TCID50 MVA-BN-PRO в сутки 1, 15 и 29 (обработки с интервалов 2 недели × 3). Контрольных животных обрабатывали MVA-BN® или буфером для препарата (TBS). Образцы крови забирали до обработки и в сутки 14, 28 и 42. Сыворотку от мышей из каждой тестируемой группы затем объединяли и анализировали посредством ELISA. Индукцию антительных ответов против PSA и против РАР оценивали с использованием имеющихся в продаже очищенных белков (Meridian Life Sciences, Inc., Saco, ME) в качестве антигенов-мишеней, которыми были покрыты лунки планшета для микротитрования. Как показано на Фиг.4А и 4В, антительные ответы против PSA и против РАР детектировали у мышей, обработанных MVA-BN-PRO. Определение титров антитела против PSA требовало по меньшей мере двух введений, и титры возрастали после третьей обработки MVA-BN-PRO. В общем, антительный ответ против РАР был более умеренным, так как титры всегда были ниже, чем титры, индуцированные против PSA. Слабый антительный ответ, наблюдающийся против РАР, верояно обусловлен слабыми антигенными свойствами этого белка для В-клеток.

Индукция Т-клеточных ответов против PSA и против РАР

Мышей BALB/c (5 животных в каждой группе) подкожно обрабатывали контролем (TBS), 2×106 или 5×107 TCID50 MVA-BN-PRO в сутки 1, 15, 31 (обработки с интервалом 2 недели × 3). Селезенки отбирали через 5 суток после последней иммунизации и суспензии клеток из каждой тестируемой группы объединяли для анализа. Индукцию Т-клеточных ответов оценивали посредством ELISpot, который измерял продукцию IFNγ после повторной антигенспецифичной стимуляции in vitro. Для повторной стимуляции использовали раздельно библиотеки 15-мерных пептидов с 11-мерными перекрываниями (OPL) и аминокислотные последовательности, покрывающие полноразмерное PSA или РАР. Как показано на Фиг.5, антигенспецифичные Т-клеточные ответы детектировали в клетках селезенки из группы, обработанной MVA-BN-PRO, при повторной стимуляции OPL как РАР, так и PSA, тогда как контрольная OPL, происходящая из человеческой последовательности HER-2 ecd, не имела эффекта (Фиг.5А). Т-клеточные ответы не детектировали у мышей в группах, обработанных MVA-BN® (данные не показаны) или TBS (Фиг.5), когда клетки повторно стимулировали OPL PSA, РАР или HER-2. Эти данные показывают, что MVA-BN-PRO является мощным индуктором Т-клеток, поскольку большие количества антигенспецифичных Т-клеток могли быть детектированы непосредственно в спленоцитах без роста ex vivo.

Содействие CD4 хелперных и CD8 цитотоксических Т-клеток Т-клеточным ответам против РАР и PSA, индуцированным у мышей при обработке MVA-BN-PRO, исследовали после обеднения подклассов популяций Т-клеток до повторной стимуляции клеток селезенки in vitro. Как показано на Фиг.6, ответы Т-клеток детектировали в подклассах Т-клеток, обедненных как CD4, так и CD8 при повторной стимуляции каждой из OPL PSA или РАР.

В целом эти исследования показывают, что неоднократная обработка мышей MVA-BN-PRO индуцирует широкий антигенспецифичный адаптивный иммунный ответ на два ТАА, который включает антитело и оба подтипа клеток-эффекторов, CD4 и CD8. Как и ожидалось, антительный ответ был направлен главным образом на PSA, тогда как РАР, известный слабый иммуноген В-клеток, запускал только умеренный антительный ответ. Поскольку PSA и РАР по существу представлены на поверхности опухолевых клеток как мишени Т-клеток в форме комплексов антигенпрезентирующая молекула/пептид, активация клеточных компонентов иммунной системы является критическим требованием для мощности MVA-BN-PRO. Сильные ответы Т-клеток CD4 и CD8 были индуцированы против обоих ТАА у животных, обработанных всеми протестированными дозами MVA-BN-PRO. Следовательно, MVA-BN-PRO имеет потенциал опосредовать устранение опухолевых клеток, презентирующих на их поверхности пептиды PSA и/или РАР.

Пример 4

Противоопухолевая активность у мышей, обработанных MVA-BN-PRO

Способность MVA-BN-PRO влиять на рост PSA-позитивных опухолевых клеток у мышей оценивали в профилактической, а также в терапевтической модели раковой опухоли. Данные показывают, что MVA-BN-PRO может ингибировать рост опухоли в обеих постановках. Также MVA-BN-PRO был способен ингибировать рост РАР-позитивных опухолевых клеток у мышей в терапевтической модели раковой опухоли.

Индукция защитного антигенспецифичного адаптивного иммунитета при обработке MVA-BN-PRO (профилактическая постановка)

Способность MVA-BN-PRO предупреждать рост опухоли оценивали с использованием трансплантированных клеток Е5 в качестве модели рака простаты. Е5 представляет собой субклон RM11, мышиной линии клеток опухоли простаты (Elzey et al., Int. J Cancer 15;94(6):842-9 (2001)), полученный после трансфекции RM11 рекомбинантной ДНК, кодирующей ген человеческого PSA. В этом исследовании эффективности мышей иммунизировали MVA-BN-PRO, как описано выше, т.е. три раза с 3-недельными интервалами TBS, MVA-BN® (5×107 TCID50) или MVA-BN-PRO (2×106, 1×107 или 5×107 TCID50). Затем мышей заражали опухолями путем внутрикожного инъецирования 1×105 клеток Е5 через шесть недель после последней обработки. Затем рост опухоли наблюдали дважды в неделю, и измеряли размер растущих солидных опухолей.

Как показано на Фиг.7В-7Д, у животных, предварительно обработанных всеми дозами MVA-BN-PRO, опухоли росли медленнее, чем опухоли в контрольной группе, обработанной TBS (Фиг.7А), и более 50% мышей оставались лишенными опухолей для всех протестированных доз в конце исследования (Сутки 29). Напротив, измеримые опухоли детектировали у 100% мышей в контрольных группах, обработанных TBS, уже в Сутки 12 после заражения опухолью. В эти сутки измеримые опухоли детектировали только у 20% мышей из всех групп, обработанных MVA-BN-PRO. Различие средних размеров опухолей было статистически значимым между всеми группами, обработанными MVA-BN-PRO, и контрольной группой, обработанной TBS, во все моменты времени с суток 12 и на всем протяжении данного исследования (Фиг.7Е).

Аналогично контрольной группе, обработанной TBS, измеримые опухоли детектировали почти у каждой мыши, обработанной MVA-BN® (90%) уже в Сутки 12 после заражения опухолью (Фиг.7Б). Однако 2 мыши в группе, обработанной MVA-BN® (20%), не имели опухоли в конце исследования (Сутки 29; одна мышь оставалась лишенной опухоли на всем протяжении данного исследования, и у другой мыши происходила регрессия опухоли). Также опухоли в группе, обработанной MVA-BN®, росли медленнее, чем опухоли в контрольной группе, обработанной TBS, до Суток 22, и в два момента времени достигались статистически значимые различия средних размеров опухолей между двумя этими группами (Сутки 19, р=0,034 и Сутки 22, р=0,019). Задержка роста опухоли у мышей, обработанных MVA-BN®, была лишь кратковременной, так как аналогичные средние размеры опухолей наблюдали у мышей, обработанных TBS и MVA-BN®, во все другие моменты времени (Фиг.7Е).

MVA-BN-PRO-опосредованную противоопухолевую активность, описанную выше, подтверждали в повторном эксперименте, где мышей обрабатывали 2×106 TCID50 MVA-BN-PRO с двухнедельными интервалами, затем заражали опухолевыми клетками через две недели после обработки. Данные в Сутки 29 после имплантации опухоли показаны на Фиг.8, наряду с соответствующими данными из Фиг.7 для тех же самых суток после имплантации. В обоих экспериментах наблюдали сопоставимую задержку роста опухоли у мышей, обработанных MVA-BN-PRO. Кроме того, статистически значимые различия средних размеров опухолей достигались между группами, обработанными MVA-BN-PRO и TBS, а также между группами, обработанными MVA-BN-PRO и MVA-BN® (р=0,03 и р=0,021, соответственно). Кратковременный эффект MVA-BN®, наблюдаемый в ранние моменты времени на Фиг.7, не детектировали в повторном эксперименте (данные не показаны). Эти данные показывают, что обработка мышей MVA-BN-PRO индуцирует антигенспецифичный адаптивный иммунный ответ и установление иммунной памяти. Когда мышей впоследствии заражали опухолевыми клетками через две-шесть недель, иммунная память активировалась и ингибировала рост опухолевых клеток.

Подавление опухолей при обработке MVA-BN-PRO (терапевтическая постановка)

Способность MVA-BN-PRO подавлять сформировавшиеся опухоли оценивали с использованием трансплантированных клеток Е6 в качестве модели рака простаты. Е6 представляет собой субклон RM11, мышиной линии клеток опухоли простаты (Elzey et al., 2001), полученный после трансфекции RM11 рекомбинантной ДНК, кодирующей человеческий ген PSA. Е6 является более слабым продуцентом PSA, чем Е5, который использовали в профилактической постановке, описанной выше. Мышей заражали опухолями путем внутрикожного инъецирования 1×105 клеток Е6 и обрабатывали в те же самые сутки, затем в сутки 8 и 15 TBS, MVA-BN® или MVA-BN-PRO (5×106 или 5×107 TCID50). Затем рост опухоли наблюдали дважды в неделю, и измеряли размер солидных опухолей под кожей.

Как показано на Фиг.9, опухоли у животных, обработанных MVA-BN-PRO (Фиг.9В и 9Г), росли значительно медленнее, чем опухоли у животных, обработанных MVA-BN® - (Фиг.9А и 9Б) или TBS (Фиг.9Д). В обеих группах, обработанных MVA-BN-PRO, наблюдали стабилизацию размера или регрессию опухоли у 50% животных. Фиг.9Е показывает различие среднего размера опухоли между группами. Средний объем опухоли статистически значимо различался между животными, обработанными 5х106 TCID50 MVA-BN-PRO и контрольными группами, обработанными TBS или MVA-BN® (р=0,014 и р=0,032, соответственно), тогда как статистическая значимость не достигалась между группой, обработанной 5х107 TCID50 MVA-BN-PRO, и контрольной группой, обработанной TBS (р=0,07). Эти данные показывают, что обработка мышей MVA-BN-PRO ингибирует рост опухолей простаты у мышей в терапевтической постановке.

Способность MVA-BN-PRO также, подавлять сформировавшиеся опухоли, экспрессирующие РАР, оценивали в экспериментальной модели метастазов в легком, используя клетки СТ26, стабильно экспрессирующие человеческую PAP. CT26 представляют собой клетки химически индуцированной колоректальной карциномы мышей BALB/c (Brattain et al., 1980). В этой модели клетки СТ26-РАР внутривенно инъецируют мышам BALB/c и опухолевую массу оценивают в легких, где растут узелки опухоли. Мышей заражали клетками СТ26-РАР (5×105), внутривенно инъецированными в Сутки 1, и внутрибрюшинно обрабатывали в Сутки 4 одной инъекцией TBS, MVA-BN (5×107 TCID50) или MVA-BN-PRO (2×106 или 5×107 TCID50). Мышей затем умерщвляли в Сутки 14, и их легкие взвешивали. Как показано на Фиг.10, опухолевая масса у мышей, обработанных 5×107 TCID50 MVA-BN-PRO, была значительно меньше, чем у контрольных мышей (р<0,024). Эта противоопухолевая активность зависела от дозы, так как меньшая доза MVA-BN-PRO не имела эффекта. Кроме того, эта противоопухолевая активность с наибольшей вероятностью была опосредована РАР-специфичным иммунным ответом, так как опухолевая масса у мышей контрольной и обработанной MVA-BN групп была неизменной.

Эти данные демонстрируют, что обработка мышей MVA-BN-PRO ингибирует рост сформировавшихся РАР-позитивных опухолей у мышей. Таким образом, как антигены простаты PSA, так и РАР, кодируемые MVA-BN-PRO, способствуют индукции защитного иммунного ответа, способного подавлять рост как PSA-, так и РАР-позитивных опухолей.

Пример 5

Иммуногенность MVA-BN-PRO при ограничении гаплотипа

Иммунные ответы происходят в результате взаимодействия эпитопов, происходящих из антигена, с полиморфными антигенпрезентирующими молекулами на иммунокомпетентных клетках. Польза двух опухолевых антигенов в MVA-BN-PRO состоит в том, что они потенциально увеличивают число эпитопов, происходящих из опухолевого антигена, которые взаимодействуют с антигенпрезентирующими молекулами разных гаплотипов. Следовательно, предполагается, что MVA-BN-PRO будет иммуногенным у индивидуумов с более широким диапазоном гаплотипов, чем вакцины, содержащие один антиген. Эту возможность оценили в доклинических моделях с использованием животных с разными гаплотипами. В этом примере вектор, описанный в Примере 1, модифицировали с заменой промотора ATI ранним/поздним синтетическим промотором (Ps; Chakrabarti S, Sisler JR, and Moss B, BioTechniques 23: 1094-1097 (December 1997)). Соответственно, белки PSA и PAP должны экспрессироваться с другими ранними и поздними генами на всем протяжении полной инфекционной фазы MVA.

Последовательность промотора Ps:

5'-AAAAAATTGAAATTTTATTTTTTTTTTTTGGAATATAAATAAT (SEQ ID NO:6).

Самцов мышей BALB/c и C57BL/6 (5 животных в каждой группе) иммунизировали в сутки 1, 15 и 29 5×107 TCID50 MVA-BN-PRO. Пробы крови брали в сутки 42, и последовательные разведения объединенных сывороток анализировали на присутствие IgG против PSA или против РАР посредством ELISA, как описано в Примере 3. Как показано на Фиг.11, высокие титры антител против PSA детектировали только в сыворотке от мышей BALB/c. Напротив, несмотря на то, что титры антител против РАР измеряли в сыворотках от обеих мышиных линиях, более высокие титры антител против РАР детектировали в сыворотке от мышей C57BL/6. Эти данные подчеркивают связь с гаплотипом иммунного ответа в отношении конкретных антигенов и поддерживают идею о том, что множество опухолевых антигенов в MVA-BN-PRO должно обеспечивать эффективный иммунитет у большего числа индивидов с разными гаплотипами.

Пример 6 Безопасность и иммуногенность MVA-BN-PRO у людей

MVA-BN-PRO в настоящее время исследуется для лечения пациентов с раком простаты. Ко времени подачи этой заявки 4 пациента получили от 1 до 3 обработок 1×108 TCID50 MVA-BN-PRO без сообщения о вредных эффектах. Иммуногенность MVA-BN-PRO у одного из этих пациентов оценивали сравнением ответов Т-клеток на PSA и РАР до и после обработки. Присутствие антигенспецифичных Т-клеток, секретирующих гамма-интерферон (IFN-γ), в одноядерных клетках периферической крови (РВМС) пациента определяли с использованием анализа ELISpot. Ответы определяли до обработки (базовый уровень) и через 2 недели после третьей подкожной вакцинации 108 TCID50 MVA-BN-PRO (ТС3). РВМС пациента (2×105) в 10% средах MATIS (RPMI, среда Клика, 10% человеческая АВ сыворотка, 0,5 М 2-β-меркаптоэтанол и 2% пенициллин/стрептомицин) переносили в гидратированные лунки 96-луночных PVDF планшетов Multiscreen (Millipore, Кат. № MSIPS4510), предварительно покрытые захватывающим антителом против человеческого IFN-γ (Mabtech, клон MAb 1D1K, Кат. №3420-3) в концентрации 10 мкг/мл. Затем РВМС стимулировали PSA в концентрации 5 мкг/мл (Biodesign Кат. № А86878Н), 11-мерной перекрывающейся библиотекой из 63 15-мерных пептидов (OPL), происходящих из полноразмерной последовательности PSA, в концентрации 63 мкМ (1 мкМ на пептид), РАР в концентрации 1 мкг/мл (Biodesign Кат. № А81277Н), 11-мерной OPL из 94 15-мерных пептидов, происходящих из полноразмерной последовательности РАР, в концентрации 94 мкМ (1 мкМ на пептид), пулом из 44 пептидов ГКГ класса I, происходящих из 10 антигенов, ассоциированных с опухолью рака простаты (ТАА), в концентрации 44 мкМ (1 мкМ на пептид), пулом из 15 пептидов ГКГ класса II, происходящих из 5 ТАА рака простаты, в концентрации 15 мкМ (1 мкМ на пептид) или MVA (Баварский Северный, MVA-BN-PROD05A06-C) при множественности инфекции (MOI) 10.

Последовательности 63 пептидов OPL PSA:

MWVPVVFLTLSVTWI (а.к. 1-15 SEQ ID NO:3)

VVFLTLSVTWIGAAP (а.к. 5-19 SEQ ID NO:3)

TLSVTWIGAAPLILS (а.к. 9-23 SEQ ID NO:3)

TWIGAAPLILSRIVG (а.к. 13-27 SEQ ID NO:3)

AAPLILSRIVGGWEC (a.к 17-31 SEQ ID NO:3)

ILSRIVGGWECEKHS (a.к. 21-35 SEQ ID NO:3)

IVGGWECEKHSQPWQ (а.к. 25-39 SEQ ID NO:3)

WECEKHSQPWQVLVA (а.к. 29-43 SEQ ID NO:3)

KHSQPWQVLVASRGR (a.к. 33-47 SEQ ID NO:3)

PWQVLVASRGRAVCG (a.к. 37-51 SEQ ID NO:3)

LVASRGRAVCGGVLV (a.к. 41-55 SEQ ID NO:3)

RGRAVCGGVLVHPQW (а.к. 45-59 SEQ ID NO:3)

VCGGVLHPOWVLTA (а.к. 49-63 SEQ ID NO:3)

VLVHPQWVLTAAHCI (а.к. 53-67 SEQ ID NO:3)

PQWVLTAAHCIRNKS (а.к. 57-71 SEQ ID NO:3)

LTAAHCIRNKSVILL (a.к. 61-75 SEQ ID NO:3)

HCIRNKSVILLGRHS (a.к. 65-79 SEQ ID NO:3)

NKSVILLGRHSLFHP (a.к. 69-83 SEQ ID NO:3)

ILLGRHSLFHPEDTG (a.к. 73-87 SEQ ID NO:3)

RHSLFHPEDTGQVFQ (a.к. 77-91 SEQ ID NO:3)

FHPEDTGQVFQVSHS (a.к. 81-95 SEQ ID NO:3)

DTGQVFQVSHSFPHP (а.к. 85-99 SEQ ID NO:3)

VFQVSHSFPHPLYDM (а.к. 89-103 SEQ ID NO:3)

SHSFPHPLYDMSLLK (а.к. 93-107 SEQ ID NO:3)

PHPLYDMSLLKNRFL (а.к. 97-111 SEQ ID NO:3)

YDMSLLKNRFLRPGD (а.к. 101-115 SEQ ID NO:3)

LLKNRFLRPGDDSSH (а.к. 105-119 SEQ ID NO:3)

RFLRPGDDSSHDLML (а.к. 109-123 SEQ ID NO:3)

PGDDSSHDLMLLRLS (а.к. 113-127 SEQ ID NO:3)

SSHDLMLLRLSEPAE (а.к. 117-131 SEQ ID NO:3)

LMLLRLSEPAELTDA (а.к. 121-135 SEQ ID NO:3)

RLSEPAELTDAVKVM (а.к. 125-139 SEQ ID NO:3)

PAELTDAVKVMDLPT (a.к. 129-143 SEQ ID NO:3)

TDAVKVMDLPTQEPA (a.к. 133-147 SEQ ID NO:3)

KVMDLPTQEPALGTT (а.к. 137-151 SEQ ID NO:3)

LPTQEPALGTTCYAS (а.к. 141-155 SEQ ID NO:3)

EPALGTTCYASGWGS (а.к. 145-159 SEQ ID NO:3)

GTTCYASGWGSIEPE (а.к. 149-163 SEQ ID NO:3)

YASGWGSIEPEEFLT (a.к. 153-167 SEQ ID NO:3)

WGSIEPEEFLTPKKL (а.к. 157-171 SEQ ID NO:3)

EPEEFLTPKKLQCVD (а.к. 161-175 SEQ ID NO:3)

FLTPKKLQCVDLHVI (а.к. 165-179 SEQ ID NO:3)

KKLQCVDLHVISNDV (а.к. 169-183 SEQ ID NO:3)

CVDLHVISNDVCAQV (а.к. 173-187 SEQ ID NO:3)

HVISNDVCAQVHPQK (а.к. 177-191 SEQ ID NO:3)

NDVCAQVHPQKVTKF (а.к. 181-195 SEQ ID NO:3)

AQVHPQKVTKFMLCA (а.к. 185-199 SEQ ID NO:3)

PQKVTKFMLCAGRWT (а.к. 189-203 SEQ ID NO:3)

TKFMLCAGRWTGGKS (а.к. 193-207 SEQ ID NO:3)

LCAGRWTGGKSTCSG (а.к. 197-211 SEQ ID NO:3)

RWTGGKSTCSGDSGG (а.к. 201-215 SEQ ID NO:3)

GKSTCSGDSGGPLVC (а.к. 205-219 SEQ ID NO:3)

CSGDSGGPLVCNGVL (а.к. 209-223 SEQ ID NO:3)

SGGPLVCNGVLQGIT (а.к. 213-227 SEQ ID NO:3)

LVCNGVLQGTTSWGS (а.к. 217-231 SEQ ID NO:3)

GVLQGITSWGSEPCA (а.к. 211-235 SEQ ID NO:3)

GITSWGSEPCALPER (а.к. 225-239 SEQ ID NO:3)

WGSEPCALPERPSLY (а.к. 229-243 SEQ ID NO:3)

PCALPERPSLYTKW (а.к. 233-247 SEQ ID NO:3)

PERPSLYTKWHYRK (а.к. 237-251 SEQ ID NO:3)

SLYTKVVHYRKWIKD (а.к. 241-255 SEQ ID NO:3)

KVVHYRKWIKDTIVA (а.к. 245-259 SEQ ID NO:3)

YRKWIKDTIVANP (а.к. 249-261 SEQ ID NO:3)

Последовательность из 94 пептидов OPL PAP:

MRAAPLLLARAASLS (а.к. 1-15 SEQ ID NO:4)

PLLLARAASLSLGFL (а.к. 5-19 SEQ ID NO:4)

ARAASLSLGFLFLLF (а.к. 9-23 SEQ ID NO:4)

SLSLGFLFLLFFWLD (а.к. 13-27 SEQ ID NO:4)

GFLFLLFFWLDRSVL (а.к. 17-31 SEQ ID NO:4)

LLFFWLDRSVLAKEL (а.к. 21-35 SEQ ID NO:4)

WLDRSVLAKELKFVT (а.к. 25-39 SEQ ID NO:4)

SVLAKELKFVTLVFR (а.к. 29-43 SEQ ID NO:4)

KELKFVTLVFRHGDR (а.к. 33-47 SEQ ID NO:4)

FVTLVFRHGDRSPID (а.к. 37-51 SEQ ID NO:4)

VFRHGDRSPIDTFPT (а.к. 41-55 SEQ ID NO:4)

GDRSPIDTFPTDPIK (а.к. 45-59 SEQ ID NO:4)

PIDTFPTDPIKESSW (а.к. 49-63 SEQ ID NO:4)

FPTDPIKESSWPQGF (а.к. 53-67 SEQ ID NO:4)

PIKESSWPQGFGQLT (а.к. 57-71 SEQ ID NO:4)

SSWPQGFGQLTQLGM (а.к. 61-75 SEQ ID NO:4)

QGFGQLTQLGMEQHY (а.к. 65-79 SEQ ID NO:4)

QLTQLGMEQHYELGE (а.к. 69-83 SEQ ID NO:4)

LGMEQHYELGEYIRK (а.к. 74-87 SEQ ID NO:4)

QHYELGEYIRKRYRK (а.к. 77-91 SEQ ID NO:4)

LGEYIRKRYRKFLNE (а.к. 81-95 SEQ ID NO:4)

IRKRYRKFLNESYKH (а.к. 85-99 SEQ ID NO:4)

YRKFLNESYKHEQVY (а.к. 89-103 SEQ ID NO:4)

LNESYKHEQVYIRST (а.к. 93-107 SEQ ID NO:4)

YKRHEQWTRSTOVDR (а.к. 97-111 SEQ ID NO:4)

QVYIRSTDVDRTLMS (а.к. 101-115 SEQ ID NO:4)

RSTDVDRTLMSAMTN (а.к. 105-119 SEQ ID NO:4)

VDRTLMSAMTNLAAL (а.к. 109-123 SEQ ID NO:4)

LMSAMTNLAALFPPE (а.к. 113-127 SEQ ID NO:4)

MTNLAALFPPEGVSI (а.к. 117-131 SEQ ID NO:4)

AALFPPEGVSIWNPI (а.к. 121-135 SEQ ID NO:4)

PPEGVSIWNPILLWQ (а.к. 125-139 SEQ ID NO:4)

VSIWNPILLWQPIPV (а.к. 129-143 SEQ ID NO:4)

NPILLWQPIPVHTVP (а.к. 133-147 SEQ ID NO:4)

LWQPIPVHTVPLSED (а.к. 137-151 SEQ ID NO:4)

IPVHTVPLSEDQLLY (а.к. 141-155 SEQ ID NO:4)

TVPLSEDQLLYLPFR (а.к. 145-159 SEQ ID NO:4)

SEDQLLYLPFRNCPR (а.к. 149-163 SEQ ID NO:4)

LLYLPFRNCPRFQEL (а.к. 153-167 SEQ ID NO:4)

PFRNCPRFQELESET (а.к. 157-171 SEQ ID NO:4)

CPRFQELESETLKSE (а.к. 161-175 SEQ ID NO:4)

QELESETLKSEEFQK (а.к. 165-179 SEQ ID NO:4)

SETLKSEEFQKRLHP (а.к. 169-183 SEQ ID NO:4)

KSEEFQKRLHPYKDF (а.к. 173-187 SEQ ID NO:4)

FQKRLHPYKDFIATL (а.к. 177-191 SEQ ID NO:4)

LHPYKDFIATLGKLS (а.к. 181-195 SEQ ID NO:4)

KDFIATLGKLSGLHG (а.к. 185-199 SEQ ID NO:4)

ATLGKLSGLHGQDLF (а.к. 189-203 SEQ ID NO:4)

KLSGLHGQDLFGIWS (а.к. 193-207 SEQ ID NO:4)

LHGQDLFGIWSKVYD (а.к. 197-211 SEQ ID NO:4)

DLFGIWSKVYDPLYC (а.к. 201-215 SEQ ID NO:4)

IWSKVYDPLYCESVH (а.к. 205-219 SEQ ID NO:4)

VYDPLYCESVHNFTL (а.к. 209-223 SEQ ID NO:4)

LYCESVHNFTLPSWA (а.к. 213-227 SEQ ID NO:4)

SVHNFTLPSWATEDT (а.к. 217-231 SEQ ID NO:4)

FTLPSWATEDTMTKL (а.к. 221-235 SEQ ID NO:4)

SWATEDTMTKLRELS (а.к. 225-239 SEQ ID NO:4)

EDTMTKLRELSELSL (а.к. 229-243 SEQ ID NO:4)

TKLRELSELSLLSLY. (а.к. 234-247 SEQ ID NO:4)

ELSELSLLSLYGIHK (а.к. 237-251 SEQ ID NO:4)

LSLLSLYGIHKQKEK (а.к. 241-255 SEQ ID NO:4)

SLYGIHKQKEKSRLQ (а.к. 245-259 SEQ ID NO:4)

IHKQKEKSRLQGGVL (а.к. 249-263 SEQ ID NO:4)

KEKSRLQGGVLVNEI (а.к. 253-267 SEQ ID NO:4)

RLQGGVLVNEILNHM (а.к. 257-271 SEQ ID NO:4)

GVLVNEILNHMKRAT (а.к. 261-275 SEQ ID NO:4)

NEILNHMKRATQIPS (а.к. 265-279 SEQ ID NO:4)

NHMKRATQIPSYKKL (а.к. 269-283 SEQ ID NO:4)

RATQIPSYKKLIMYS (а.к. 274-287 SEQ ID NO:4)

IPSYKKLIMYSAHDT (а.к. 277-291 SEQ ID NO:4)

KKLIMYSAHDTTVSG (а.к. 281-295 SEQ ID NO:4)

MYSAHDTTVSGLQMA (а.к. 285-299 SEQ ID NO:4)

HDTTVSGLQMALDVY (а.к. 289-303 SEQ ID NO:4)

VSGLQMALDVYNGLL (а.к. 293-307 SEQ ID NO:4)

QMALDVYNGLLPPYA (а.к. 297-311 SEQ ID NO:4)

DVYNGLLPPYASCHL (а.к. 301-315 SEQ ID NO:4)

GLLPPYASCHLTELY (а.к. 305-319 SEQ ID NO:4)

PYASCHLTELYFEKG (а.к. 309-323 SEQ ID NO:4)

CHLTELYFEKGEYFV (а.к. 313-327 SEQ ID NO:4)

ELYFEKGEYFVEMYY (а.к. 317-331 SEQ ID NO:4)

EKGEYFVEMYYRNET (а.к. 321-335 SEQ ID NO:4)

YFVEMYYRNETQHEP (а.к. 325-339 SEQ ID NO:4)

MYYRNETQHEPYPLM (а.к. 329-343 SEQ ID NO:4)

NETQHEPYPLMLPGC (а.к. 333-347 SEQ ID NO:4)

HEPYPLMLPGCSPSC (а.к. 337-351 SEQ ID NO:4)

PLMLPGCSPSCPLER (а.к. 341-355 SEQ ID NO:4)

PGCSPSCPLERFAEL (а.к. 345-359 SEQ ID NO:4)

PSCPLERFAELVGPV (а.к. 349-363 SEQ ID NO:4)

LERFAELVGPVIPQD (а.к. 353-367 SEQ ID NO:4)

AELVGPVIPQDWSTE (а.к. 357-371 SEQ ID NO:4)

GPVIPQDWSTECMTT (а.к. 361-375 SEQ ID NO:4)

PQDWSTECMTTNSHQ (а.к. 365-379 SEQ ID NO:4)

STECMTTNSHQGTED (а.к. 369-383 SEQ ID NO:4)

MTTNSHQGTEDSTD (а.к. 373-386 SEQ ID NO:4)

Последовательность 44 пептидов ТАА МНС класса I с соответствующими ТАА и положением в последовательности ТАА:

Пептиды: Последовательность

PSMA

4-12 LLHETDSAV (а.к. 4-12 SEQ ID NO:7)

109-117 ELAHYDVLL (а.к. 109-117 SEQ ID NO:7)

168-176 PSLYTKVVHY (а.к. 168-176 SEQ ID NO:7)

173-181 DLVYVNYAR (а.к. 173-181 SEQ ID NO:7)

178-186 NYARTEDFF (а.к. 178-186 SEQ ID NO:7)

199-207 KIVIARYGK (а.к. 199-207 SEQ ID NO:7)

207-215 KVFRGNKVK (а.к. 207-215 SEQ ID NO:7)

227-235 LYSDPADYF (а.к. 227-235 SEQ ID NO:7)

260-268 NLNGAGDPL (а.к. 260-268 SEQ ID NO:7)

347-356 HSTNGVTRIY (а.к. 347-356 SEQ ID NO:7)

354-363 RIYNVIGTLR (а.к. 354-363 SEQ ID NO:7)

403-411 GTLKKEGWR (а.к. 403-411 SEQ ID NO:7)

431-440 STEWAEENSR (а.к. 431-440 SEQ ID NO:7)

441-450 LLQERGVAYI (а.к. 441-450 SEQ ID NO:7)

461-469 TLRVDCTPL (а.к. 461-469 SEQ ID NO:7)

557-566 ETYELVEKFY (а.к. 557-566 SEQ ID NO:7)

641-649 EIASKFSER (а.к. 641-649 SEQ ID NO:7)

663-671 MMNDQLMFL (а.к. 663-671 SEQ ID NO:7)

680-688 GLPDRPFYR (а.к. 680-688 SEQ ID NO:7)

711-719 ALFDIESKV (а.к. 711-719 SEQ ID NO:7)

PSCA

7-15 ALLMAGLAL (а.к. 7-15 SEQ ID NO:8)

14-22 ALQPGTALL (а.к. 14-22 SEQ ID NO:8)

21-30 LLCYSCKAQV (а.к. 21-30 SEQ ID NO:8)

76-84 DYYVGKKNI (а.к. 76-84 SEQ ID NO:8)

108-116 ALLPALGLL (а.к. 108-116 SEQ ID NO:8)

109-117 LLPALGLLL (а.к. 109-117 SEQ ID NO:8)

115-123 LLLWGPGQ (а.к.:115-123 SEQ ID NO:8)

STEAP 1

86-94 FLYTLLREV (а.к. 86-94 SEQ ID NO:9)

HQQYFYKIPILVINK (a.к. 102-116 SEQ ID 102-116 NO:9)

262-270 LLLGTIHAL (а.к. 262-270 SEQ ID NO:9)

292-300 MIAVFLPIV (а.к. 292-300 SEQ ID NO:9)

PTHrp

42-51 QLLHDKGKS (а.к. 42-51 SEQ ID NO:10)

59-68 FLHHLIAEIH (а.к. 59-68 SEQ ID NO:10)

59-65 FLHHLIA (а.к. 59-65 SEQ ID NO:10)

165-173 TSTTSLELD (а.к. 165-173 SEQ ID NO:10)

TARP

4-13 FPPSPLFFFL (а.к. 4-13 SEQ ID NO:11)

27-35 FVFLRNFSL (а.к. 27-35 SEQ ID NO:11)

29-37 FLRNFSLML (а.к. 29-37 SEQ ID NO:11)

Простеин

31-39 CLAAGITYV (SEQ ID NO:12)

Eph

58-66 IMNDMPIYM(SEQ ID NO:13)

550-558 VLAGVGFFI (SEQ ID NO:14)

Сурвивин

96-104 LTLGEFLKL (SEQ ID NO:15)

hTERT

973-981 KLFGVLRLK (SEQ ID NO:16)

HER2

665-673 WLGWFGT-(SEQ ID NO:17)

Последовательность 15 пептидов ТАА МНС класса II с соответствующими ТАА и положением в последовательности ТАА.

Калликреин 4

125-139 SVSESDTIRSISIAS (SEQ ID NO:18)

155-169 LLANGRMPTVLQCVN (SEQ ID NO:19)

160-174 RMPTVLQCVNVSWS (SEQ ID NO:20)

Гистон Н4

GAKRHRKVLRDNIQG (a.K. 14-28 SEQ ID 14-28 NO:21)

KRHRKVLRDNIQGITKPAIRRLAR (а.к. 16-39 16-39 SEQ ID NO:21)

TKPAIRRLARRGGVK (а.к. 31-45 SEQ ID 31-45 NO:21)

LIYEETRGVLKVFLE (а.к. 49-63 SEQ ID 49-63 NO:21)

TYTEHAKRKTVTAMDVVYALKRQG (а.К. 71-94 71-94 SEQ ID NO:21)

TARP

1-14 MQMFPPSPLFFFLQ (SEQ ID NO:11) 14-27 QLLKQSSRRLEHTF (SEQ ID NO:11)

ENAH (hMena)

502-510 TMNGSKSPV(SEQ ID NO:22) PSMA

TGNFSTQKVKMHIHS (а.к. 334-348 SEQ ID

334-348 NO:7)

NYTLRVDCTPLMYSL (а.к. 459-473 SEQ ID

459-473 NO:7)

YRHVIYAPSSHNKYA (а.к. 687-701 SEQ ID

687-701 NO:7)

RQIYVAAFTVQAAAE (a.к. 730-744 SEQ ID

730-744 NO:7)

После 40 часов инкубации при 37°С, 5% CO2, секрецию IFN-γ детектировали с 1 мкг/мл биотинилированного антитела против человеческого IFN-γ (Mabtech, клон MAb 7-B6-1, Кат. №3420-6) с последующим добавлением комплекса стрептавидин-щелочная фосфатаза (BD Pharmingen, Кат. №554065), разведенного 1/5000. Планшеты ELISpot проявляли с Vector Blue Substrate (Vector Lab Inc., Кат. № SK-5300) и пятна подсчитывали автоматическим ридером пятен (Cellular Technology Ltd. ImmunoSpot S3B Analyzer и профессиональное программное обеспечение CTL ImmunoSpot 4.0). Как показано на Фиг.12, предсуществующий ответ Т-клеток на PSA детектировали до обработки MVA-BN-PRO у пациента J-D-1001. (Число) Т-клеток против PSA значительно возрастало после обработки, тогда как Т-клетки против РАР определялись только после обработки. Эти данные показывают, что MVA-BN-PRO является иммуногенным у людей, и что может достигаться одновременная индукция как ответов против PSA, так и против РАР. Обработка MVA-BN-PRO также приводила к сильному Т-клеточному ответу на вектор MVA-BN. Важнее всего то, что обработка MVA-BN-PRO также приводила к распространению Т-клеточных ответов на другие опухолевые антигены, что иллюстрируется продукцией IFN-γ Т-клетками, стимулированными пулами пептидов ТАА ГКГ 1 и II. Это указывает на то, что MVA-BN-PRO-индуцированные иммунные ответы приводили к умерщвлению опухолевых клеток с последующим усилением противоопухолевых ответов на другие опухолевые антигены. Распространение антигенов является важным событием в индукции противоопухолевого защитного иммунитета, так как оно предупреждает выход опухоли из под удара ответов, индуцированных вакциной. Следовательно, способность MVA-BN-PRO опосредовать иммунные ответы на два опухолевых антигена у людей является свойством, которое обеспечивает эффективную иммунотерапию.

1. Способ лечения ракового пациента-человека, включающий введение данному пациенту рекомбинантного модифицированного вируса коровьей оспы Анкара (MVA), кодирующего полипептид, содержащий человеческий простато-специфический антиген (PSA), и полипептид, содержащий антиген человеческой простатической кислой фосфатазы (РАР).

2. Способ по п.1, где MVA представляет собой MVA-BN (модифицированный вирус коровьей оспы Анкара - баварский северный (Bavarian Nordic)).

3. Способ по п.1, где вирус MVA содержит нуклеотидные последовательности SEQ ID NO:1 и SEQ ID NO:2.

4. Способ по п.1, где антиген PSA и антиген РАР вставлены в межгенную область 014L/015L MVA.

5. Способ по п.1, где рак представляет собой рак простаты.

6. Способ по п.1, где рак представляет собой метастатический рак простаты.

7. Способ по п.1, где рекомбинантный MVA вводят перед введением дозы таксана, уничтожающей опухолевые клетки.

8. Способ по п.1, где рекомбинантный MVA вводят в то же самое время, что и дозу таксана, уничтожающую опухолевые клетки.

9. Способ по п.1, где рекомбинантный MVA вводят после введения дозы таксана, уничтожающей опухолевые клетки.

10. Способ по п.7, где таксан представляет собой доцетаксел или паклитаксел.

11. Способ по п.9, где таксан представляет собой доцетаксел или паклитаксел.

12. Набор для профилактики рака простаты, содержащий:
(а) рекомбинантный MVA, кодирующий полипептид, содержащий человеческий антиген PSA, и полипептид, содержащий человеческий антиген РАР; и
(б) инструкции для введения данного рекомбинантного MVA до обнаружения рака простаты.

13. Набор для лечения рака простаты, содержащий:
(а) рекомбинантный MVA, кодирующий полипептид, содержащий человеческий антиген PSA, и полипептид, содержащий человеческий антиген РАР; и
(б) инструкции для введения данного рекомбинантного MVA пациенту с раком простаты.

14. Набор по п.13, дополнительно содержащий инструкции для введения данного рекомбинантного MVA до, в то же самое время или после лечения дозой таксана, уничтожающей опухолевые клетки.

15. Иммуногенная композиция, содержащая рекомбинантный вирус MVA, кодирующий полипептид, содержащий человеческий антиген РАР, и полипептид, содержащий человеческий антиген PSA, где данная иммуногенная композиция индуцирует В-клеточные и Т-клеточные иммунные ответы против PSA и РАР при введении хозяину-человеку.

16. Иммуногенная композиция по п.15, индуцирующая антитела против PSA и РАР при введении хозяину-человеку.

17. Иммуногенная композиция по п.16, где данный рекомбинантный вирус MVA содержит нуклеотидную последовательность SEQ ID NO:1.

18. Иммуногенная композиция по п.16, где данный рекомбинантный вирус MVA содержит нуклеотидную последовательность SEQ ID NO:2.

19. Иммуногенная композиция по п.16, где данный рекомбинантный вирус MVA содержит нуклеотидную последовательность SEQ ID NO:1 и нуклеотидную последовательность SEQ ID NO:2.

20. Иммуногенная композиция по п.16, где вирус MVA представляет собой MVA-BN, депонированный в Европейской коллекции клеточных культур (ЕСАСС) под регистрационным номером V00083008.

21. Способ индукции В-клеточных и Т-клеточных иммунных ответов против РАР и PSA, включающий введение пациенту-человеку примирующей дозы рекомбинантного MVA, кодирующего полипептид, содержащий человеческий антиген РАР, и полипептид, содержащий человеческий антиген PSA, и введение одной или более бустер-дозы рекомбинантного MVA, кодирующего полипептид, содержащий антиген РАР, и полипептид, содержащий человеческий антиген PSA.

22. Способ по п.21, где пациенту вводят примирующую дозу 1·108 TCID50 (средняя цитопатогенная доза) и две бустер-дозы 2·108 и 4·108 TCID50.

23. Способ по п.22, где бустер-дозы дают через четыре и восемь недель после примирующей дозы.



 

Похожие патенты:
Изобретение относится к медицинской иммунологии, иммунохимии, а именно к способу получения поликлональной моноспецифической сыворотки против секреторного иммуноглобулина A (SIgA) человека, не содержащей в исходном состоянии примесных антител к лактоферрину.

Группа изобретений относится к медицине и касается композиции для индукции иммунной системы, содержащей синтетические наноносители, обладающие по меньшей мере одной поверхностью с иммунными свойствами, образованной множеством молекул, которые обеспечивают высокую авидность и низкую аффиность связывания с антигенпрезентирующими клетками (АРС), и фармацевтически приемлемый наполнитель; способа индукции иммунной системы, включающего введение указанной композиции индивидууму.

Группа изобретений относится к области медицины и фармацевтики и касается стабильной изотонической действующей композиции, содержащей протеин в количестве по крайней мере 50 мг/мл и растворитель, который разбавляет композицию, полученную из лиофилизированной смеси протеина и лиопротектора, где мольное соотношение лиопротектора и протеина в смеси составляет 100-600 моль лиопротектора на 1 моль протеина, причем концентрация протеина в разбавленной действующей композиции в 2-40 раз выше, чем концентрация протеина в смеси до лиофилизации.

Группа изобретений относится к медицине, а именно к композициям и способам для доставки наноносителей к клеткам иммунной системы, способным стимулировать иммунный ответ в Т-клетках и/или в В-клетках.

Данное изобретение относится к медицине, биофармацевтики и может быть использовано для приготовления вакцин. Для этого иммуногенная композиция содержит: 1) антиген нейссериальный аутотранспортерный белок, представляющий собой NadA или Hsf; 2) антиген нейссериальный белок, участвующий в усвоении железа, представляющий собой Lipo28 или низкомолекулярный и высокомолекулярный TbpA и 3) препарат везикул наружной мембраны, включающий нейссериальный липополисахарид (LPS) иммунотипа L3; и где указанные антигены, в тех случаях, когда они присутствуют в везикуле наружной мембраны, позитивно отрегулированы рекомбинантным образом в указанной везикуле наружной мембраны.

Группа изобретений относится к композициям, включающим Tr1-клетки и мезенхимальные стволовые клетки, представляющие собой специфические клетки для антигена, в норме толерантного у здорового субъекта, где указанный антиген представляет собой аллерген, собственный антиген, пищевой антиген или антиген микроорганизмов, и способам лечения аутоиммунного заболевания, аллергического заболевания или воспалительного заболевания.

Изобретение относится к области иммунологии и касается увеличения иммуногенности вакцин путем совместного введения синтетического гликолипида, обозначенного PBS-57, вместе с вакциной.

Изобретение относится к соединению формулы (1) или (1'): где: Z представляет собой реактивный карбоксильный эфир, выбранный из группы, состоящей из N-сукцинимидила, N-сульфосукцинимидила, N-фталимидила, N-сульфофталимидила, 2-нитрофенила, 4-нитрофенила, 2,4-динитрофенила, 3-сульфо-4-нитрофенила, 3-карбокси-4-нитрофенила и сложного эфира трифторфенила, или галоацетамида; D представляет собой майтанзиноид; Х представляет собой алифатическую структурную единицу; Y представляет собой алифатическую структурную единицу, присоединенную к майтанзиноиду через тиоэфирную связь; где указанная алифатическая структурная единица, представленная Х или Y, является простой или разветвленной алкильной группой, имеющей 1-20 атомов углерода в цепи, циклической алкильной группой, имеющей 3-10 атомов углерода, простой или разветвленной алкенильной группой, имеющей 2-15 атомов углерода в цепи, или простой или разветвленной алкинильной группой, имеющей 2-15 атома углерода в цепи; 1 представляет собой 0 или 1; p представляет собой 0 или 1; и n представляет собой целое число от 1 до 2000.

Изобретение относится к области ветеринарии и касается способа получения антигена из сетарий. .

Группа изобретений относится к области биотехнологии и иммунологии. Предложен способ получения вакцины с применением обратимого латекса. На первой стадии получают адъювантную композицию путем диспергирования в водном физиологически приемлемом растворе обратимого латекса или полимерного порошка, полученного распылением указанного обратимого латекса. На второй стадии смешивают полученную адъювантную композицию с антигенсодержащей средой, предназначенной для получения вакцинной композиции. Адъювант на основе обратимого латекса отличается высокой безопасностью и обладает высоким адъювантным эффектом как на уровне гуморального ответа, так и на уровне клеточного ответа. 3 н. и 5 з.п. ф-лы, 2 ил., 3 пр.

Настоящая группа изобретений относится к медицине, а именно к терапии, и касается лечения вирусных инфекций. Для этого вводят комплексное лекарственное средство, включающее активированные-потенцированные антитела к гамма- интерферону человека, к CD4 рецептору и к гистамину. Введение такого комплексного средства обеспечивает лечение различных вирусных заболеваний, таких как острые респираторные вирусные инфекции, герпесвирусные инфекции, острые кишечные инфекции вирусной этиологии и др., за счет воздействия на различные звенья иммунной системы. 2 н. и 8 з.п. ф-лы, 5 пр., 2 ил., 8 табл.

Изобретение относится к области биотехнологии, конкретно к апоптотическим факторам, и может быть использовано в медицине. Получают композицию, включающую ингибитор TNF-подавляющей активности Core 1 митохондриального дыхательного комплекса III в опухолевой клетке на основе нуклеиновой кислоты; член суперсемейства фактора некроза опухоли (TNF) и носитель. Изобретение позволяет повысить чувствительность опухолевой клетки к апоптотической активности члена суперсемейства фактора некроза опухоли. 3 н. и 13 з.п. ф-лы, 5 ил., 9 пр.

Изобретение относится к области биотехнологии. Описана модифицированная липидами двухцепочечная РНК, включающая антисмысловую нить, нуклеотидная последовательность которой комплементарна целевой последовательности в целевом гене, и смысловую нить, нуклеотидная последовательность которой комплементарна антисмысловой нити. К первому нуклеотиду на 5′-конце смысловой нити напрямую или через линкер присоединен двухцепочечный липид. РНК обладает высокой устойчивостью к действию нуклеазы и эффективно поглощается клеткой, а также производит превосходный эффект РНК-интерференции. 4 н. и 11 з.п. ф-лы, 14 ил., 3 пр.

Изобретение относится к области биотехнологии и генной инженерии. Предложен способ получения вектора экспрессии, кодирующего адаптированную рекомбиназу. Указанная адаптированная рекомбиназа рекомбинирует асимметричные участки-мишени в LTR провирусной ДНК ретровируса, встроенного в геном клетки-хозяина, и пригодна в качестве средства для вырезания провируса из генома клетки-хозяина. Настоящее изобретение дополнительно относится к способу оптимизации лечения ретровирусной инфекции у индивида in vitro и к использованию адаптированных рекомбиназ для получения фармацевтических композиций для снижения вирусной нагрузки у индивида, инфицированного ретровирусом. 11 н. и 10 з.п. ф-лы, 11 ил., 1 табл., 4 пр.
Изобретение относится к области ветеринарии и медицины. Предложен способ лечения гриппа птиц A/H5N1 с помощью высокополимерной дрожжевой РНК. В качестве лекарственного средства используют мылкую амфифильную одноцепочечную высокополимерную РНК Saccharomyces cerevisiae, извлекаемую из сухих пекарских дрожжей с помощью оттитрованной щелочью олеиновой кислоты, или с помощью додецилсульфата натрия путем обработки выделенной РНК олеиновой кислотой. Изобретение обеспечивает высокоэффективное противогриппозное средство, содержащее природный индуктор интерферона. 1 пр.

Настоящая группа изобретений относится к медицине, а именно к терапии, и касается лечения бактериальных инфекций. Для этого вводят комплексное лекарственное средство, содержащее активированную-потенцированную форму антител к гамма-интерферону человека (ИФН-γ), активированную-потенцированную форму антител к CD4 рецептору и активированную-потенцированную форму антител к гистамину. Это обеспечивает эффективное лечение бактериальных инфекций за счет потенцирования антибактериального действия активированных-потенцированных антител к гамма-интерферону. 3 н. и 8 з.п. ф-лы, 1 пр., 1 табл.
Изобретение относится к области ветеринарной протозоологии и касается способа получения антигена для серологической диагностики анаплазмоза мелкого рогатого скота. Предложенный способ включает введение спленэктомированному животному заражающей дозы 14·1010 или 16·107 анаплазм/животное, на 15 или 22-24 соответственно день, проведение обескровливания, центрифугирование крови 2-3 раза при 6000 об/мин в течение часа с физиологическим раствором pH 6,8-7,2, получение осадка анаплазм с форменными элементами крови, проведение 2-3 разовой отмывки физиологическим раствором, разрушение эритроцитов путем 2-3 кратного замораживания и оттаивания, концентрирование 2-3 раза центрифугированием при тех же условиях и выделение антигена с титром 1:32-1:64. Способ позволяет получить чувствительный, высокоактивный и специфичный анаплазменный антиген и найдет применение в ветеринарных лабораториях, занимающихся диагностикой инфекционных и протозойных болезней. 4 табл., 4 пр.

Настоящая группа изобретений относится к медицине, а именно к терапии и неврологии, и касается лечения кинетозов. Для этого вводят фармацевтическую композицию, содержащую активированную-потенцированную форму антител к мозгоспецифическому белку S-100 и активированную-потенцированную форму антител к эндотелиальной NO-синтазе. Это обеспечивает эффективное лечение кинеотозов за счет синергетического действия компонентов композиции. 2 н. и 9 з.п. ф-лы, 16 табл., 4 пр.

Изобретение относится к области биотехнологии. Раскрыты способы, композиции и наборы для диагностики остеоартрита у животных семейства кошачьих. Способы по изобретению включают детектирование дифференциальной экспрессии, по меньшей мере, одного маркера в образце из организма, предпочтительно в образце крови, где биомаркер дифференциально экспрессируется при остеоартрите. 6 н. и 17 з.п. ф-лы, 4 ил., 7 табл., 3 пр.
Наверх