Способ предупреждения преждевременных родов

Авторы патента:


Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов
Способ предупреждения преждевременных родов

 

A61M5/00 - Устройства для подкожного, внутрисосудистого и внутримышечного введения сред в организм; вспомогательные устройства для этих целей, например приспособления для наполнения или очистки устройств для введения сред, консольные стойки (соединители, муфты, клапаны или ответвления для трубок, специально предназначенные для медицинских целей A61M 39/00; емкости, специально предназначенные для медицинских или фармацевтических целей A61J 1/00)

Владельцы патента RU 2501573:

КОРТЕРА, ИНК. (US)

Изобретение относится к медицине, а именно к акушерству и гинекологии. Предлагается введение беременным женщинам фармацевтического состава, включающего фармацевтически активный релаксин Н2. Способ обеспечивает предупреждение преждевременных родов у женщин за счет выявленного свойства релаксина Н2 к подавлению раскрытия шейки матки. 6 з.п. ф-лы, 3 табл., 2 пр., 4 ил.

 

Перекрестные сведения на родственные заявки

По настоящей заявке испрашивается приоритет в соответствии с 35 разделом Свода законов США, §119(е), на основе предварительной заявки на патент США US 61/127888, поданной 16 мая 2008 г., сущность которой включена в настоящее изобретение в виде ссылки.

Область техники, к которой относится изобретение

Настоящее изобретение относится к способам уменьшения раскрытия шейки матки и преждевременных родов у женщин посредством введения релаксина. Лечение релаксином особенно применимо для субъектов, которые предрасположены к преждевременным родам.

Предпосылки создания настоящего изобретения

Релаксин представляет гормон с молекулярной массой 6000 дальтон, полипептидные цепи которого связаны дисульфидными мостиками, и концентрация которого у многих видов заметно повышается в течение беременности. В некоторых исследованиях показано, что релаксин играет важную роль в течение беременности и родов, благодаря изменению половых путей.

Релаксин преимущественно вырабатывается желтым телом и у беременных, и у небеременных особей женского пола, а также он обнаружен в семенной жидкости у особей мужского пола (Bryant-Greenwood, Endocrine Reviews, 3, 1982, cc.62-90, Weisse, Ann. Rev. Physiol. 46, 1984, cc.43-52). У особей женского пола его уровни достигают максимума в периферической плазме через 7-10 суток после пика промежуточного цикла лютеинизирующего гормона и продолжают повышаться в случае оплодотворения яйцеклетки из-за дополнительного образования релаксина отпадающей оболочкой (Stewart и др., J. Clin. Endo. Metab., 70, 1990, cc.1771-1773). Во время беременности концентрации релаксина в сыворотке при измерении гомологичным радиоиммуноанализом достигают максимума примерно к десятой неделе и постепенно снижаются и остаются на уровне примерно 500 пг/мл в течение остального периода беременности (Bell и др., Obstet. Gynecol., 69, 1987, cc.585-589). Разновидности гена релаксина человека идентифицированы путем геномного клонирования, используя зонды на основе гена релаксина свиньи (Hudson и др., Nature, 301, 1983, с.628, Hudson и др., ЕМВО J., 3, 1984, с.2333, US 4758516, US 4871670). Установлено, что только одна из этих разновидностей гена, обозначенная Н2, транскрибируется и экспрессируется в желтом теле, свидетельствуя о том, что эта последовательность непосредственно вовлечена в физиологию беременности.

Установлено, что у животных релаксин изменяет половые пути, чтобы облегчить процесс родов, включая созревание шейки матки, утолщение эндометрия матки беременных, а также повышение васкуляризации этой области и изменение синтеза коллагена (в кн.: Sherwood «The physiology of reproduction», 1994, 2-ое изд.). Также обнаружена его связь с лактацией, и некоторые сообщения указывают, что релаксин проявляет эффект активирования роста тканей млекопитающих (Wright, Anderson, Adv. Exp. Med. Biol., 143, 1982, с.341).

Роль релаксина человека в течение беременности все еще недостаточно ясна. Исследования in vitro действия релаксина человека показывают, что он ингибирует сокращение миометрия матки при отсутствии беременности, но не влияет на миометрий беременных (MacLennan, J. Reprod. Med., 36, 1991, cc.630-634). В настоящее время нет сообщений о стимулирующем эффекте релаксина человека на миометрий. Было отмечено, что релаксин свиньи обладает эффектом у людей, указывая на то, что функция релаксина является видоспецифической. Evans и др., используя релаксин свиньи в виде интрацервикальных гранул, в рандомизированном двойном слепом контролируемом клиническом исследовании наблюдали более значительное сглаживание (утончение) шейки матки и укорачивание срока до родов в группе, получавшей релаксин (Evans и др., Am J. Obstet. Gynecol, 147, 1983, cc.410-414). Используя подобный план исследования, MacLennan и др. вводили релаксин свиньи или плацебо в виде интрацервикального геля (MacLennan, Obstet. Gynecol., 68, 1986, cc.595-601), Группа, получавшая релаксин, была более склонна к переходу к спонтанному родовому акту и показала более значительное изменение в созревании шейки матки при увеличении дозы релаксина. Эти исследования показывают, что релаксин свиньи можно использовать для индукции родового акта у женщин. Однако релаксин свиньи у женщин может проявлять иммуногенные свойства.

Релаксин человека, введенный внутрь влагалища, исследовали в 1 фазе исследований безопасности у небеременных женщин, но какого-либо эффекта на созревание шейки матки показано не было. Это исследование показало, что введение релаксина человека безопасно и связано с минимальными неблагоприятными побочными эффектами. Важно, что уровни релаксина в сыворотке крове не повышались у женщин, получавших релаксин, показывая, что отсутствие эффекта релаксина на шейку матки можно объяснить неадекватным или несоответствующим способом дозирования (Bell и др., Obstet. Gynecol., 82, 1993, cc.328-333, Brennand и др. в кн.: «2nd International congress on the hormone relaxin», 1995, cc.380-388). На основе функции релаксина у животных и наблюдений, заключающихся в том, что релаксин свиней может способствовать созреванию шейки матки у людей, сделано предположение, что введение релаксина можно использовать для облегчения родов у людей.

В большинстве случаев беременность продолжается примерно 40 недель, считая от последнего менструального цикла (ПМЦ). Дети, рожденные в срок примерно от 37 до 42 недель беременности, считаются доношенными. Примерно 12,5 процентов детей (более полумиллиона в год) в США рождаются до 37 полных недель беременности. Преждевременные роды являются серьезной проблемой для здоровья и являются причиной приблизительно 85% заболеваемости и смертности у новорожденных в США. Они представляют основную часть расходов на медицинское обслуживание новорожденных в значительной степени из-за того, что у 2% американских женщин рождаются сильно недоношенные дети до 32 полных недель беременности.

Недоношенные дети рождаются до полного развития их тел и систем органов. Эти дети часто очень малы, с низкой массой при рождении (менее 2500 г или 5,5 фунтов), и им может быть необходимо содействие в дыхании, питании, борьбе с инфекцией и поддержании тепла. Эти новорожденные подвержены повышенному риску осложнений состояния здоровья, а также длительной беспомощности, например, задержки умственного развития, церебрального паралича, проблем с легкими и желудочно-кишечным трактом, потери зрения и слуха и даже смерти. Общие осложнения, которые более вероятны у недоношенных, чем у доношенных детей, включают, но ими не ограничиваются, респираторный дистресс-синдром (РДС), апноэ, внутрижелудочковое кровоизлияние (ВЖК), открытый артериальный проток, некротизирующий энтероколит (НЭК), ретинопатию недоношенных, желтуху, анемию, хронические заболевания легких и инфекции. Более поздно рожденные дети обычно имеют незначительные или умеренные проблемы, однако у детей, рожденных примерно до 32-34 недель беременности, может быть значительное количество осложнений (от умеренных до тяжелых). Выжить младенцы могут при рождении ранее 24-27 недель беременности, но эти дети могут столкнуться с проблемами со здоровьем на протяжении жизни.

По до конца не установленным причинам за последние 25 лет в США показатель преждевременных родов повысился более чем на 30 процентов. Большую часть этого повышения можно объяснить увеличением числа многоплодных беременностей, вызываемых вспомогательными репродуктивными технологиями. Примерно 20-25% всех беременностей, вызванных такими процедурами, приводит к беременности двойней, которая особенно подвержена повышенному риску раннего родового акта. Приблизительно в 50% случаях рождение двойни происходит преждевременно, при этом средний внутриутробный возраст плода составляет 37 недель по сравнению с 40 неделями при одноплодной беременности.

В настоящее время нет надежного и безопасного способа предупреждения преждевременного родоразрешения или досрочного родового акта. Современные способы включают способы самостоятельного контроля для снижения инфекций, а также диетологические и психологические воздействия. Кроме того, эти способы включают тщательные и частые дородовые обследования и контролирование факторов риска досрочных родов. Однако эти способы оказались недостаточными для значительного снижения преждевременных родов. В случае преждевременных сокращений матки обычно используют терапию токолитиками. Описаны различные типы агентов с переменными показателями эффективности и побочными эффектами, например, сульфат магния, нифедипин и тербуталин. Некоторые лекарственные средства не были одобрены Управлением по контролю качества продуктов и лекарств США (Food and Drug Administration - FDA) для применения с целью приостановки сокращений матки при досрочном родовом акте, независимо от этого они применяются. Подавление сокращений часто является только частичным и использование токолитиков может лишь отсрочить роды на несколько суток. Этот способ можно использовать, чтобы выиграть время для введения глюкокортикоидных препаратов, например, бетаметазона, который значительно ускоряет созревание легких плода, чтобы уменьшить риск развития респираторного дистресс-синдрома, внутрижелудочкового кровоизлияния, некротизирующего энтероколита, инфекции и смерти младенцев. Глюкокортикоидным препаратам требуется от одних до двух суток для действия. Исследовалась способность антибиотиков предотвращать преждевременные роды, путем подавления инфекций, однако их эффективность не была доказана. Кроме того, испытывали использование влагалищного прогестерона, а также инъекции природного метаболита прогестерона 17-альфа-гидроксипрогестерона капроата (Fonseca и др., NEJM, 357 (5), 2007, cc.462-469, Romero, Ultrasound Obstet. Gynecol., 30, 2007, cc.675-686). Этот подход базируется на полученных данных, что начало родового акта связано с физиологическим выводом прогестерона. Оба способа лечения показали эффективность в приостановке сокращений матки, однако FDA и его группа экспертов недавно подвергли сомнению безопасность 17-альфа-гидроксипрогестерона капроата из-за ассоциированного с ним увеличения выкидышей и внутриутробной гибели плода (Meis и др., NEJM, 348 (24), 2003, cc.2379-85, и консультативные комитеты FDA: CDER 2006).

Таким образом, существует потребность в безопасном и эффективном способе предупреждения преждевременных родов. Описываемое здесь изобретение предусматривает такой способ и обладает рядом дополнительных преимуществ.

Краткое описание предпочтительных вариантов осуществления настоящего изобретения

Настоящее изобретение предусматривает способы, которые связаны с сокращением раскрытия шейки матки путем введения релаксина. Эти способы можно использовать для уменьшения риска преждевременных родов и выкидышей и для удлинения срока беременности, в результате чего можно повысить массу новорожденного. Количество преждевременных родов в больницах США за последнее десятилетие заметно выросло. Несмотря на попытки предотвратить такие преждевременные роды, безопасного и эффективного лечения без отрицательных побочных эффектов до настоящего времени не найдено. Некоторые способы были сосредоточены на методах самостоятельного контроля, которые могут помочь в некоторых случаях, но непригодны в других. Поэтому желательны новые способы предупреждения преждевременных родов, которые являются безопасными и эффективными, и настоящее изобретение удовлетворяет эту потребность. Таким образом, настоящее изобретение предусматривает способы предупреждения преждевременных родов и снижения их риска путем введения релаксина. Одним из преимуществ настоящего изобретения является то, что введение релаксина практически не имеет неблагоприятных побочных эффектов у женщин, склонных к преждевременным родам. Еще одним преимуществом является то, что релаксин можно вводить в сочетании с другими лекарственными средствами, например, токолитиками или прогестероном, чтобы обеспечить еще более мощный способ предупреждения недоношенности плода. Поскольку токолитики и прогестерон влияют на сокращения матки, а релаксин предотвращает раскрытие шейки матки, в сочетании эти методы лечения обеспечивают значительное улучшение по сравнению с известными методами.

В одном объекте настоящего изобретения предусматривают способ понижения раскрытия шейки матки, включающий выбор женщины, предрасположенной к преждевременным родам, и введение этой женщине фармацевтического состава с фармацевтически действующим релаксином. В предпочтительном варианте осуществления настоящего изобретения предусматриваются способы снижения скорости раскрытия шейки матки, включающие введение беременной женщине фармацевтического состава, содержащего фармацевтически действующий релаксин, с целью снижения скорости раскрытия шейки матки. В другом объекте настоящего изобретения предусматривают способ снижения риска преждевременных родов, включающий выбор женщины, предрасположенной к преждевременным родам, и введение этой женщине фармацевтического состава, включающего фармацевтически действующий релаксин. В предпочтительном варианте осуществления настоящего изобретения предусматривают способ снижения риска преждевременных родов, включающий введение беременной женщине фармацевтического состава, включающего фармацевтически действующий релаксин, для снижения риска преждевременных родов. Настоящее изобретение также включает способ снижения риска выкидыша, путем выбора женщины, предрасположенной к выкидышу, и введение этой женщине фармацевтического состава, включающего фармацевтически действующий релаксин. В одном из предпочтительных вариантов осуществления настоящего изобретения в способах женщина является беременной. В другом варианте осуществления способов настоящего изобретения релаксин также можно вводить женщине, предрасположенной к преждевременным родам, до беременности. Следует отметить, что в описанных способах настоящего изобретения релаксин можно вводить беременной женщине при появлении у нее симптомов, которые включают, но ими не ограничиваются, схватки, спазмы в нижней части живота, тупую боль в пояснице, давление ее тазовой области, спазмы желудка, выделения из влагалища, влагалищные кровотечения и влагалищные выделения водянистой жидкости.

В еще одном объекте настоящего изобретения предусматривают способ удлинения срока беременности, включающий выбор женщины, предрасположенной к преждевременным родам, и введение женщине фармацевтического состава с фармацевтически действующим релаксином, который снижает риск преждевременных родов. Настоящее изобретение также направлено на способ увеличения массы младенца при рождении, включающий выбор женщины, предрасположенной к преждевременным родам, и введение указанной женщине фармацевтического состава с фармацевтически действующим релаксином, чтобы увеличить уровень рождаемости за счет увеличения срока беременности. В одном из вариантов осуществления способов настоящего изобретения релаксин вводят беременной женщине при появлении у нее симптомов, которые включают, но ими не ограничиваются, схватки, спазмы в нижней части живота, тупую боль в пояснице, давление в ее тазовой области, спазмы желудка, выделения из влагалища, влагалищные кровотечения и влагалищные выделения водянистой жидкости.

Используемый в фармацевтических составах настоящего изобретения релаксин может быть, например, очищенным, синтетическим или рекомбинантным релаксином. В одном варианте осуществления настоящего изобретения релаксин является релаксином Н2 человека. В другом варианте осуществления настоящего изобретения релаксин представляет релаксин H1 человека, релаксин Н3 человека или агонист релаксина. В другом варианте осуществления настоящего изобретения релаксин является синтетическим или рекомбинантным релаксином Н2 человека. Таким образом, субъекта можно лечить фармацевтическим составом с синтетическим или рекомбинантным релаксином человека. В одном варианте осуществления настоящего изобретения субъекта лечат синтетическим релаксином Н2 человека. В еще одном варианте осуществления настоящего изобретения субъекта лечат рекомбинантным релаксином Н2 человека. Релаксин можно вводить субъекту посредством большого числа различных способов, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное или местное введение. В одном из предпочтительных вариантов осуществления настоящего изобретения релаксин вводится внутривенно. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводится подкожно. В еще одном варианте осуществления настоящего изобретения релаксин вводят посредством спинальной инъекции. Точнее, фармацевтический состав с релаксином можно вводить субъекту в количестве в диапазоне примерно от 0,1 до 500 мкг/кг массы тела субъекта в сутки. По существу, релаксин вводят субъекту с тем расчетом, чтобы поддерживать концентрацию релаксина в сыворотке примерно от 0,5 до 50 нг/мл.

Введение релаксина, описанного в способах настоящего изобретения, предотвращает преждевременный родовой акт или преждевременные роды у женщин при риске этих симптомов. Кроме того, введение релаксина может привести к повышению массы младенца при рождении и/или к нормальной массе младенца при рождении. В одном варианте осуществления способов настоящего изобретения релаксин вводят в период от начала первого триместра беременности до начала родового акта. В другом варианте осуществления релаксин вводят в период от начала второго или третьего триместра до начала родового акта. Релаксин можно вводить ежедневно, еженедельно или ежемесячно в течение этих периодов.

Настоящее изобретение дополнительно предусматривает релаксин для применения с целью снижения скорости раскрытия шейки матки у женщины, предрасположенной к преждевременным родам, релаксин для применения с целью снижения риска преждевременных родов и выкидыша у женщины, предрасположенной к преждевременным родам или выкидышу, и релаксин для применения с целью удлинения срока беременности и увеличения массы новорожденного у женщины, предрасположенной к преждевременным родам.

Краткое описание фигур

Настоящее изобретение более понятно при рассмотрении в сочетании с сопутствующими фигурами, которые служат для иллюстрации предпочтительных вариантов осуществления настоящего изобретения. Однако очевидно, что изобретение не ограничивается конкретными вариантами осуществления, которые раскрыты в этих фигурах.

Фиг.1А изображает пептидный гормон релаксин Н2, который по размеру и форме близок инсулину. Фиг.1Б представляет аминокислотную последовательность цепи В (SEQ ID NO:1) и цепи A (SEQ ID NO:2, где Х представляет глутаминовую кислоту [Е] или глутамин [Q]) релаксина 2 человека (Н2).

Фиг.2 показывает средний уровень концентраций релаксина в сыворотке крови в объединенной группе, получавшей релаксин, и объединенной группе применения плацебо с течением времени.

Фиг.3 показывает средние общие показатели Бишопа в объединенной группе, получавшей релаксин, и объединенной группе применения плацебо в указанных точках времени.

Фиг.4 показывает изменение в раскрытии шейки матки в объединенной группе, получавшей релаксин, и объединенной группе применения плацебо с течением времени.

Подробное описание изобретения

Общее представление

Настоящее изобретение основано на наблюдении, что внутривенное введение релаксина человека беременным женщинам приводит к значительному снижению скорости раскрытия шейки матки. Раскрытие шейки матки является важным параметром при определении физической готовности женщины к влагалищному родоразрешению. Неожиданно в настоящем изобретении было установлено, что введение релаксина можно применять для подавления раскрытия шейки матки у женщин. Это открытие резко контрастирует с результатами, полученными в исследованиях на животных, где введение релаксина повышает созревание и раскрытие шейки матки. Следует отметить, что преждевременное увеличение раскрытия повышает риск досрочного родоразрешения. Таким образом, торможение раскрытия шейки матки предоставляет способы предупреждения преждевременного родоразрешения до достижения полного срока беременности, а также способы предупреждения выкидышей на ранних сроках беременности. Путем предупреждения преждевременного родоразрешения, срок беременности можно удлинить до обеспечения полного развития младенца или, по меньшей мере, до уровня зрелости органов младенца, который является достаточным для жизнеспособности младенца вне матки.

Преждевременные роды представляют риск для здоровья и ребенка, и матери, и являются дорогостоящей проблемой здравоохранения. Недоношенные дети требуют особого ухода, часто страдают от серьезных заболеваний, и преждевременные роды могут оказывать пожизненное влияние на их здоровье. Кроме этих физических ограничений, преждевременные роды также могут иметь сильное психологическое воздействие и на младенца, и на мать. Хотя получен ряд технологических достижений в области перинатальной и неонатальной медицины, которые повышают шансы на выживание и восстановление от медицинских осложнений у недоношенных детей, преждевременные роды остаются одной из ведущих причин смертности младенцев в течение их первого года жизни.

Определения

Понятие «релаксин» относится к пептидному гормону, который хорошо известен в данной области (см. фиг.1). Понятие «релаксин» в контексте настоящего изобретения охватывает релаксин человека, включая интактный релаксин человека полной длины или часть молекулы релаксина, сохраняющую биологическое действие. Более того, понятие «релаксин» рассматривает синтетический релаксин человека и рекомбинантный релаксин человека, включая синтетический релаксин Н2 человека и рекомбинантный релаксин Н2 человека. Кроме того, это понятие охватывает действующие агенты с действием, подобным действию релаксина, например, аналоги релаксина и их части, которые сохраняют биологическое действие, и агенты, которые конкурентоспособно вытесняют связанный релаксин из связи с рецепторами к релаксину, например, рецепторами LGR7 или LGR8. Кроме того, последовательность нуклеиновых кислот релаксина человека, используемая в настоящем изобретении, не должна быть на 100% идентична релаксину Н2 человека, но может иметь, по меньшей мере, примерно на 40%, 50%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична с релаксином Н2 человека. Релаксин, используемый в настоящем изобретении, можно получить любым способом, известным специалистам в данной области. Примеры таких способов представлены, например, в US 5759807, а также в работе Bullesbach и др., The Journal of Biological Chemistry, 266 (17), 1991, cc.10754-10761. Примеры молекул релаксина и аналогов приведены, например, в US 5166191.

Понятие «раскрытие шейки матки» относится к процессу, в котором зев (отверстие) шейки матки и канал шейки матки расширены на менее чем примерно на 1 см до примерно 10 см, что дает возможность изгнания плода из матки.

Понятие «созревание шейки матки» относится к процессу, который подготавливает шейку матки к родовому акту, например, к смягчению и утончению (т.е. сглаживанию) шейки матки.

Понятия «преждевременное родоразрешение», «преждевременные роды», «досрочные роды», «досрочное родоразрешение» относятся к родам примерно до 37 полных недель беременности и используются в описании в качестве взаимозаменяемых.

Понятия «преждевременный родовой акт» или «досрочный родовой акт», относятся к началу родового акта до около 37 полных недель беременности и характеризуются сокращением матки или повышенной возбудимостью матки. Понятия «преждевременный родовой акт» или «досрочный родовой акт» используются в описании в качестве взаимозаменяемых.

Понятия «выкидыш» или «самопроизвольный аборт» относятся к естественному или спонтанному окончанию беременности на стадии, когда эмбрион или плод не способен выжить, и обычно у людей происходят в сроки беременности примерно до 20 недель. Эти понятия используются в описании в качестве взаимозаменяемых.

Понятия «младенец» или «ребенок» относятся к ребенку на самом раннем этапе жизни, в частности, до его способности ходить и, как правило, в возрасте до одного года. Эти понятия используются в описании в качестве взаимозаменяемых.

Понятия «новорожденный младенец» или «новорожденный» относятся к младенцу в возрасте примерно до одного месяца с момента рождения. Эти понятия используются в описании в качестве взаимозаменяемых и включают недоношенных, переношенных и доношенных младенцев.

Понятие «примерно» в контексте настоящего изобретения охватывает диапазон до 10% выше или ниже заявленного значения (например, 90-110% от заявленного значения). Например, скорость внутривенного вливания примерно 30 мкг/кг/сутки включает скорости внутривенного вливания, составляющие от 27 мкг/кг/сутки до 33 мкг/кг/сутки.

Понятие «терапевтически эффективное» относится к количеству фармацевтически действующего релаксина, которое приводит к измеримой желаемой медицинской или клинической пользе пациенту, по сравнению с исходным состоянием пациента или состоянием субъекта при отсутствии лечения или в случае применения плацебо (например, субъекта, не получавшего релаксин).

Релаксин

Релаксин является пептидным гормоном, который по размеру и форме близок инсулину (см. фиг.1) Точнее, релаксин является эндокринным и аутокринным/паракринным гормоном, который принадлежит к надсемейству генов инсулина. Действующая форма кодируемого белка состоит из цепи А и цепи В, связанных вместе дисульфидными связями, двумя межцепочечными и одной внутрицепочечной связями. Таким образом, структура по расположению дисульфидных связей напоминает инсулин. У людей существуют три изоформы релаксина, кодируемые неаллельными генами, релаксин-1 (RLN-1 или H1), релаксин-2 (RLN-2 или Н2) и релаксин-3 (RLN-3 или Н3). H1 и Н2 разделяют высокую степень гомологии последовательностей. Существуют два альтернативно сплайсированных варианта транскриптов, кодирующих различные изоформы, которые описаны для этого гена. Экспрессия H1 у людей точно не известна. Н2 экспрессируется в репродуктивных органах, а Н3 обнаруживают главным образом в мозге. Эволюция пептидного семейства релаксина в его рецепторах, в общем, хорошо известна в данной области (см. Wilkinson и др., ВМС Evolutionary Biology, 5(14), 2005, cc.1-17, и Wilkinson и Bathgate в кн.: «Relaxin and Related Peptides», изд-во Landes Bioscience and Springer Science + Business Media, 2007, глава 1).

Релаксин активирует два специфических рецептора релаксина, т.е. LGR7 (RXFP1) и LGR8 (RXFP2). LGR7 и LGR8 являются сопряженными с G-белками рецепторами, содержащими богатые лейцином повторы, (leucine-rich repeat-containing, G protein-coupled receptors - LGR), которые представляют уникальную подгруппу сопряженных с G-белками рецепторов. Они содержат трансмембранный домен из семи спиралей и большой гликозилированный эктодомен с низкой степенью родства с рецепторами гликопротеогормонов, например, LH-рецептором или FSH-рецептором. Эти рецепторы релаксина обнаружены в сердце, гладких мышцах, соединительной ткани, а также в центральной и периферической нервной системе. Действующие релаксины, например, релаксины H1, H2, релаксины свиньи и кита, обладают определенной общей последовательностью, т.е. Arg-Glu-Leu-Val-Arg-X-X-Ile (SEQ ID NO:3) последовательностью или связывающей кассетой. Релаксины, которые отклоняются от гомологии его последовательности, например, релаксины крысы, акулы, собаки и лошади, показывают ослабление биологического действия, осуществляемого через рецепторы LGR7 и LGR8 (см. Bathgate и др., Ann. N.Y. Acad. Sci., 1041, 2005, cc.61-76, Receptors for Relaxin Family Peptides).

Релаксин обнаружен и у женщин, и у мужчин (см. Tregear и др. в кн.: «Relaxin 2000, Proceedings of the Third International Conference on Relaxin & Related Peptides» (22-27 октября 2000 г, Брум, Австралия). У женщин, релаксин вырабатывается желтым телом, молочной железой, а на протяжении беременности также плацентой, хорионом и отпадающей оболочкой. У мужчин релаксин образуется в яичках. Уровни релаксина повышаются после овуляции в результате его образования желтым телом, и его максимум достигается в течение первого триместра, а не к концу беременности. В отсутствие беременности его уровень снижается. У людей, релаксин играет важную роль в беременности, в повышении подвижности сперматозоидов, регулировании кровяного давления, контролировании частоты сердечных сокращений и высвобождении окситоцина и вазопрессина. У животных релаксин расширяет лобковую кость, способствует родовому акту, смягчает шейку матки (созревание шейки матки) и расслабляет мускулатуру матки. У животных, релаксин также влияет на метаболизм коллагена, ингибируя синтез коллагена и усиливая его распад путем повышения матриксных металлопротеиназ. Он также повышает ангиогенез и является почечным сосудорасширяющим фактором.

Релаксин имеет характерные свойства фактора роста и способен изменять природу соединительной ткани и влиять на сокращение гладких мышц. Известно, что H2 главным образом экспрессируется в репродуктивных тканях (см. US 5023321) и вовлечен в раскрытие шейки матки у животных. Однако в настоящем изобретении установлено, что у людей релаксин вызывает противоположный эффект и в действительности снижает скорость раскрытия шейки матки.

Агонисты релаксина

В некоторых вариантах осуществления настоящего изобретения предусматривают способы, включающие введение агониста релаксина. В некоторых способах агонист релаксина активирует один или несколько родственных релаксину сопряженных с G-белком рецепторов (GPCR), выбранных из рецепторов RXFP1, RXFP2, RXFP3, RXFP4, FSHR (LGR1), LHCGR (LGR2), TSHR (LGR3), LGR4, LGR5, LGR6 LGR7 (RXFP1) и LGR8 (RXFP2), но ими не ограничивающихся. В некоторых вариантах осуществления настоящего изобретения агонист релаксина включает аминокислотную последовательность формулы I в заявке WO 2009/007848 (которая включена в настоящее описание в качестве ссылки для ознакомления с последовательностями агонистов релаксина).

Пептиды формулы I содержат предпочтительно 7-100 аминокислот в длину и включают аминокислотную последовательность: X1-Х2-Х3-Х4-Х5-Х6-Х7-Х8-Х9-Х10-X11-Х12-Х13-Х14-Х15-Х16-Х17-Х18-Х19-Х20-Х21-Х22-Х23- Х24-Х25-Х26-Х27-Х28-Х29-Х30-Х31-Х32-Х33; где X1 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; Х2 отсутствует или означает Q или полярную природную или неприродную аминокислоту; Х3 отсутствует или означает K или основную природную или неприродную аминокислоту; Х4 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; Х5 отсутствует или означает Q или S полярную природную или неприродную аминокислоту; Х6 отсутствует или означает V, или А, или Р, или М, или полярную природную или неприродную аминокислоту; Х7 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; Х8 отсутствует или означает Р, или L, или А, природную или неприродную аминокислоту; Х9 отсутствует или означает Р или Q, природную или неприродную аминокислоту; Х10 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; X11 отсутствует или означает А, или Н, или Е, или D, или гидрофобную или низкомолекулярную или кислую природную или неприродную аминокислоту; X12 отсутствует или означает А, или Р, или Q, или S, или R, или Н, или гидрофобную или низкомолекулярную природную или неприродную аминокислоту; X13 отсутствует или означает С, или V, или гидрофобную природную или неприродную аминокислоту; X14 отсутствует или означает R, или K, или Q, или Р, или основную или полярную природную или неприродную аминокислоту; X15 отсутствует или означает R, или Q, или S, или основную или полярную природную или неприродную аминокислоту; X16 отсутствует или означает А, или L, или Н, или Q, или гидрофобную или низкомолекулярную природную или неприродную аминокислоту; X17 отсутствует или означает Y или гидрофобную или ароматическую природную или неприродную аминокислоту; X18 отсутствует или означает А или гидрофобную или низкомолекулярную природную или неприродную аминокислоту; X19 отсутствует или означает А или гидрофобную низкомолекулярную природную или неприродную аминокислоту; Х20 отсутствует или означает F или гидрофобную или ароматическую природную или неприродную аминокислоту; Х21 отсутствует или означает S, или Т, или полярную природную или неприродную аминокислоту; Х22 отсутствует или означает V, или гидрофобную природную или неприродную аминокислоту; Х23 отсутствует или означает G, или гидрофобную, или низкомолекулярную неприродную аминокислоту, или замещен амидом; Х24 отсутствует, или означает R, или основную природную, или неприродную аминокислоту; Х25 отсутствует, или означает R, или основную природную, или неприродную аминокислоту; Х26 означает А, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту; Х27 означает Y, или гидрофобную, или ароматическую природную или неприродную аминокислоту; Х28 означает А, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту; Х29 означает А, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту; Х30 означает F, или гидрофобную природную или неприродную аминокислоту; Х31 означает S, или Т, или полярную природную или неприродную аминокислоту; Х32 означает V, или гидрофобную природную или неприродную аминокислоту; Х33 отсутствует или означает G, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту, или замещен на амид; или его фармацевтически приемлемую соль (SEQ ID NO:4). В некоторых вариантах осуществления настоящего изобретения агонист релаксина представляет последовательность пептида P59C13V (свободная кислота) GQKGQVGPPGAA VRRA Y AAFSV (SEQ ID NO:5). В другом предпочтительном варианте осуществления настоящего изобретения агонист релаксина представляет последовательность пептида P74C13V (свободная кислота) GQKGQVGPPGAA VRRA Y AAFS VGRRA Y AAFS V (SEQ DD NO:6). Другие производные комплемент C1Q фактор некроза опухоли-родственного белка 8 (CTRP8 или C1QT8), например, пептид P59-G (свободная кислота Gly) GQKGQVGPPGAACRRA Y AAFSVG (SEQ ID NO:7), также могут быть пригодны для применения в способах по настоящему изобретению. Аминокислотная последовательность C1QT8 представлена далее в виде последовательности SEQ ID NO:8

MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDL WRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQV GPPGAACRRAYAAFSVGRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGA FDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSV MQAQSLMLLLAAGDAVWVRMF QRDRDNAIYGEHGDLYITFSGHLVKP AAEL.

Настоящее изобретение также охватывает гомологи указанных полипептидов, которые могут быть по меньшей мере на 50%, по меньшей мере на 55%, по меньшей мере на 60%, по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или даже на 100% идентичны аминокислотной последовательности типичного агониста релаксина (например, SEQ ID NO:5 или SEQ ID NO:6), которую можно определить с использованием программного обеспечения BlastP Национального центра биотехнологической информации США (National Center of Biotechnology Information - NCBI), используя параметры по умолчанию, необязательно, но, предпочтительно включая следующие: фильтрацию (эта опция фильтрует повторяющиеся или с низкой сложностью последовательности из запроса с использованием программы Seg (белка)), матрицей оценки является BLOSUM62 для белков, размер слова равен 3, значение Е равно 10, цена гэпов составляет 1 1, 1 (инициализация и (инициализация и расширение)). Необязательно и предпочтительно идентичность/гомологию последовательности нуклеиновых кислот определяют с программным обеспечением BlastN Национального центра биотехнологической информации (NCBI), используя параметры по умолчанию, которые предпочтительно включают использование программы фильтрации DUST, а также предпочтительно включают значение Е равное 10, фильтрацию последовательностей низкой сложности и размер слова 11. Наконец, настоящее изобретение также охватывает фрагменты описанных выше полипептидов и полипептидов, имеющих мутации, например делеции, вставки или замены одной или нескольких аминокислот, либо природные, либо искусственно полученные, или случайные или целенаправленно созданные.

Лечение релаксином приводит к снижению скорости раскрытия шейки матки

Беременность поддерживается отсутствием сильных сокращений матки и закрытой, нормально функционирующей шейкой матки. Шейка матки служит защитным барьером от вторжения микроорганизмов и в качестве структурного барьера для выхода плода. Нарушение нормального функционирования шейки матки приводит к досрочным родам, даже при отсутствии сокращений матки, свойственных родовому акту. Однако сильные сокращения матки при наличии жесткой шейки матки являются недостаточными, чтобы привести к родоразрешению. Таким образом, своевременные изменения в функционировании шейки матки в течение беременности имеют решающее значение для успешной беременности. В течение родов и после них шейка матки претерпевает кардинальный процесс ремоделирования соединительной ткани, который происходит в четыре стадии: размягчение, созревание, раскрытие и восстановление (Word и др., Semin. Reprod. Med., 25(1), 2007, cc.69-79). Начальная фаза размягчения представляет медленный, нарастающий процесс, который характеризуется увеличением синтеза коллагена и ростом шейки матки и приводит к реорганизации фибриллярной коллагеновой сети. Этот процесс обеспечивает прочность на разрыв размягченной шейки матки на ранних стадиях беременности. Во время созревания шейки матки концентрации коллагена снижаются в основном за счет увеличения синтеза гидрофильных гликозаминогликанов. На этой стадии прочность на разрыв уменьшается, и шейка матки начинает сглаживаться (утончаться) и раскрываться. Раскрытие в течение родового акта отличается от этого первоначального процесса раскрытия в период созревания и вызвано другим механизмом, который вовлекает высвобождение протеаз и коллагеназ во внеклеточный матрикс лейкоцитами. Заключительная фаза ремоделирования - восстановление шейки матки, происходит после родов.

Примечательно, что созревание шейки матки необходимо для раскрытия шейки матки, и хорошо известно, что оба процесса необходимы для успешных своевременных родов. Стандартной оценкой созревания шейки матки является показатель Бишопа. Он показывает степень размягчения, раскрытия и утончения шейки матки (раскрытие и сглаживание), а также насколько низко в тазовой области расположены шейка матки и ребенок, тем самым, оценивая готовность к влагалищному родоразрешению. Созревание шейки матки обычно начинается за несколько недель до начала сокращений матки, показывая, что и досрочные роды, и роды в положенный срок у женщин являются процессом длительным и, что родовые сокращения матки являются поздними событиями в процессе родов (Word и др., выше). Релаксин применялся для облегчения процесса родов, благодаря его способности стимулировать созревание и раскрытие шейки матки у животных. Неожиданно в настоящем изобретении было установлено, что введение релаксина имеет обратный эффект у женщин, а также предоставляет способ снижения скорости раскрытия шейки матки. На основании этого вывода релаксин (например, релаксин человека или релаксин Н2 человека) можно вводить беременной женщине, склонной к преждевременным родам, чтобы уменьшить скорость раскрытия шейки матки. Релаксин можно вводить несколькими способами введения, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное или местное введение, или спинальную инъекцию. Лечение релаксином можно начинать уже в первом триместре беременности до начала родового акта, или, наоборот, лечение можно начать в начале второго или третьего триместра беременности до начала родового акта.

Лечение релаксином предоставляет способ предупреждения преждевременных родов или выкидыша

Современные способы предупреждения преждевременных родов направлены на стратегии и методы лечения, позволяющие предотвратить преждевременный родовой акт, который характеризуется маточными сокращениями или увеличением возбудимости матки раньше срока. Реальный физиологический механизм, который инициирует досрочный родовой акт, точно не определен, но показано, что он находится под влиянием ряда факторов, например, синтеза простагландинов, высвобождения окситоцина, гормональных соотношений (снижения уровня прогестерона, повышения уровня эстрадиола), механического растяжения тканей матки, а также изменения в маточном кровотоке. В большинстве случаев досрочный родовой акт приводит к преждевременным родам, поскольку на сегодняшний день нет высоко эффективного и надежного способа, чтобы остановить родовую деятельность. Поэтому снижение случаев возникновения досрочного родового акта считается решающим для уменьшения риска преждевременного родоразрешения. Соответственно, методология профилактики сосредоточена на просвещении и врачей, и пациентов по поводу рисков преждевременного родового акта и методов его раннего выявления. Следует обращать внимание на типичные признаки досрочного родового акта, например схватки, которые происходят более шести раз в час, тупую боль в пояснице, ощущение тазового давления, диарею, влагалищные кровянистые выделения или кровотечение, или водянистые влагалищные выделения. Кроме того, у женщин с высоким риском преждевременного родового акта и родоразрешения предлагается проведение еженедельной оценки состояния шейки матки, трансвагинальной ультразвуковой эхографии, определения фибронектина плода (в качестве показателя нарушения плацентарных тканей) и домашнего мониторинга активности матки (Weissmiller, American Academy of Family Physicians, 1999). В настоящее время контролирование досрочного родового акта включает постельный режим, снижение физической активности и использование токолитиков для предупреждения схваток, которые помогают в некоторых случаях, но не являются достаточными в других.

Настоящее изобретение предусматривает новый способ уменьшения риска досрочных родов путем снижения скорости раскрытия шейки матки, вместо воздействия на сокращения матки. Следует отметить, что созревание и раскрытие шейки матки предшествует сокращениям матки при родах в срок, а также раньше срока, в течение преждевременного родового акта (Word и др., выше). Поэтому введение релаксина особенно полезно в тех случаях, когда важно предотвратить раскрытие шейки матки. В других случаях маточные сокращения в течение досрочного родового акта вызывают раскрытие шейки матки. Введение релаксина в таких случаях можно также применять для снижения скорости раскрытия шейки матки, тем самым, предотвращая роды. При этом релаксин можно применять отдельно или в сочетании с агентами, которые влияют на сократимость (например, токолитики или прогестерон), что предоставляет еще более мощный способ предупреждения преждевременных родов.

Примечательно, что повышенная стимуляция яичников или экстракорпоральное оплодотворение приводит к беременностям с повышенным уровнем циркулирующего релаксина по сравнению с нормальной беременностью в связи с увеличением лютеиновой ткани. Поскольку эти беременности связаны с более высокой частотой преждевременного родоразрешения, выдвинуто предположение, что повышенные уровни релаксина в сыворотке связаны с ранним началом родового акта (Weiss и др., Obstet Gynecol., 82, 1993, cc.821-828). Однако в этих случаях при беременности увеличение риска недоношенности плода может зависеть от множества факторов. Важно отметить, что введение релаксина, согласно описанию в способах настоящего изобретения, приводит к уровням релаксина в сыворотке, в несколько раз превышающим уровни, наблюдаемые при указанных беременностях. В настоящем изобретении показано, что при таких значительно более высоких уровнях релаксин уменьшает раскрытие шейки матки, являющегося предпосылкой для влагалищного родоразрешения, и таким образом предотвращает преждевременное родоразрешение.

Кроме того, настоящее изобретение охватывает способ, который снижает риск выкидыша. Выкидыш, потеря беременности без очевидной причины до примерно 20-й недели беременности, является наиболее частым осложнением ранней беременности. По данным Американской коллегии акушеров и гинекологов (ACOG - American College of Obstetricians and Gynecologists) около 15 процентов известных беременностей заканчиваются выкидышами. Но реальное число, вероятно, гораздо выше, поскольку многие выкидыши происходят на такой ранней стадии беременности, когда женщина даже не знает о беременности. Большинство выкидышей происходит до 12-й недели беременности, иногда в связи с генетическими проблемами эмбриона, которые обычно не связаны с матерью. Другой причиной раннего самопроизвольного аборта может быть дефицит прогестерона. В этих случаях прописывают дополнительные введения прогестерона, но ни одно исследование не показало, что они могут уменьшить риск выкидыша. Другие причины выкидыша, особенно на более поздних этапах беременности, включают, но ими не ограничиваются, пороки матки, новообразования в матке, проблемы с шейкой матки, а также проблемы с пуповиной или плацентой. Хотя во многих случаях выкидыш связан с аномалиями развития плода, потеря продукта зачатия примерно до 20-й недели беременности является нарушением неизвестной этиологии.

В настоящее время при высоком риске выкидыша у беременной женщины показан постельный режим. Выкидыши часто связаны со спастическими болями в животе или вагинальными кровотечениями. Другие симптомы включают, но ими не ограничиваются, боли в пояснице или боли в животе, которые бывают тупыми или острыми, влагалищные кровянистые выделения, сопровождающиеся спазмами живота или без них, жидкие, тканевые или сгусткообразные выделения из влагалища, лихорадку и рвоту. Методики сокращения риска выкидыша сосредоточены главным образом на снижении физической активности и постельном режиме, который часто изнурителен для матери, ожидающей ребенка. Кроме того, до лечения релаксином по настоящему описанию не существовало надежного метода для предупреждения выкидыша. Однако настоящее изобретение предусматривает надежный способ для предупреждения выкидыша и уменьшения риска выкидыша посредством введения релаксина. Выкидышу часто сопутствуют изменения шейки матки, например, раскрытие шейки матки. Поэтому введение релаксина весьма применимо в этих случаях, поскольку он значительно снижает скорость раскрытия шейки матки, что показано в настоящем изобретении.

В результате предупреждения досрочного родоразрешения или выкидыша путем введения релаксина длина срока беременности может быть увеличена. В некоторых случаях введение релаксина может продлить беременность до полного срока, который является предпочтительным, поскольку доношенные дети меньше подвержены риску многих неонатальных осложнений. В связи с медицинским состоянием матери или ребенка, например, преэклампсией, влагалищным кровотечением или дистрессом плода, иногда требуется родоразрешение до полного срока. В этих случаях релаксин можно вводить, чтобы продлить беременность до стадии, когда органы ребенка достаточно развиты, чтобы обеспечить жизнеспособность младенца.

Важным фактором шансов выживания новорожденного является масса плода при рождении. Средняя масса при рождении доношенных новорожденных составляет примерно около 7,5 фунтов (3,2 кг), но обычно находится в диапазоне примерно 5,5-10 фунтов (2,7-4,6 кг). Масса при рождении у недоношенных детей классифицируется следующим образом: масса при рождении ниже 5 фунтов 8 унций (2500 г) считается низкой массой при рождении (НМР); масса менее 3 фунтов 5 унций (1500 г) - очень низкой массой при рождении (ОНМР); и масса менее 2 фунтов 3 унции (1000 г) - крайне низкой массой при рождении (КНМР). НМР, ОНМР и КНМР связаны с повышенным риском различных осложнений у младенцев, включая, но ими не ограничиваясь, церебральный паралич, сепсис, хронические заболевания легких и смерть. Эти младенцы также больше подвержены риску гипотермии, которая может представлять опасность. Масса при рождении ниже среднего уровня часто наблюдается у недоношенных новорожденных. Поэтому предотвращение преждевременных родов с использованием релаксина предоставляет средства для увеличения массы при рождении у новорожденных. Примечательно, что масса при рождении ниже средних значений иногда наблюдается и у доношенных детей. В определенных случаях введение релаксина можно использовать для продления срока беременности, превышающего полный срок, в целях увеличения массы при рождении и повышения шансов на выживание.

Настоящее изобретение предусматривает способы уменьшения риска преждевременных родов и выкидышей, а также способы увеличения срока беременности и массы младенцев при рождении, путем введения релаксина. Релаксин (например, релаксин человека Н2) можно вводить женщине, предрасположенной к преждевременным родам, несколькими способами, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное, местное введение или спинальную инъекцию. Лечение релаксином можно начинать уже в первом триместре беременности до начала родового акта, или, в другом варианте, лечение можно начать в начале второго или третьего триместра беременности до начала родового акта.

Женщины с риском преждевременных родов или выкидыша

Женщины, которые имеют историю досрочного родового акта, преждевременного родоразрешения или выкидышей, а также беременные женщины с двумя или большим числом плодов, или беременные женщины с одним плодом после экстракорпорального оплодотворения (ЭКО), подвергаются более высокому риску досрочных родов. Кроме того, женщины, не относящиеся к белой расе, а также женщины моложе 18 или старше 35 лет, подвергаются большему риску досрочного родоразрешения. Другими факторами повышения этого риска являются недоедание, ожирение, недостаточный вес до беременности и менее 5 футов роста. Другим важным объектом является время между беременностями, поскольку короткие сроки от 6 до 9 месяцев между родами и началом другой беременности коррелируют с более высокой частотой преждевременных родов. Кроме того, женщины, которые имеют определенные аномалии матки или шейки матки, часто рожают преждевременно. Например, женщины с нарушениями шейки матки - функциональной недостаточностью, при котором шейка матки начинает раскрываться (расширяться) и утончаться (сглаживаться) без боли или сокращений матки до окончания срока беременности. Эти события происходят из-за слабости в шейке матки, которая раскрывается под растущим давлением матки с развитием беременности. Кроме того, определенные факторы, связанные с образом жизни, к которым относятся, но которыми перечень не ограничивается, поздний или отсутствующий дородовой уход, курение, потребление алкоголя, употребление запрещенных наркотиков, насилие в семье, отсутствие социальной поддержки, чрезвычайно высокий уровень стресса и длинный рабочий день с длительными периодами работы в стоячем положении, могут также увеличивать риск досрочных родов. Определенные медицинские состояния во время беременности также могут повышать вероятность досрочных родов у женщин. К ним относятся аномальное прикрепление плаценты, инфекции мочевых путей, влагалищные инфекции, инфекции, передаваемые половым путем, а также возможно другие инфекции, диабет, высокое кровяное давление, повышенная свертываемость крови (тромбофилия), кровотечение из влагалища, определенные врожденные дефекты у ребенка и воздействия ДЭС (диэтилстильбэстрола, синтетического эстрогена, назначаемого для лечения состояния недостаточности эстрогена).

К женщинам, подверженным более высокому риску выкидыша, относятся женщины старше 35 лет или с женщины, у которых ранее случались выкидыши, а также женщины с многоплодной беременностью. Кроме того, гормональная недостаточность или дисбаланс, патологии матки или шейки матки, заражение краснухой, хламидиоз или другие инфекции, передаваемые половым путем, бактериальный вагиноз, неконтролируемый диабет, заболевания щитовидной железы, нарушения иммунной системы, тяжелые заболевания почек и врожденные пороки сердца увеличивают риск выкидыша. Дополнительно вероятность спонтанных абортов повышают и определенные факторы, связанные с образом жизни, например, курение, употребление алкоголя или запрещенных наркотиков, а также некоторые лекарственные препараты, например, противоугревое средство аккутан, серьезное недоедание и воздействие неблагоприятных факторов окружающей среды или факторов, связанных с профессиональной деятельностью, например, высоких уровней излучения или отравляющих веществ.

Композиции и составы с релаксином

Релаксин и аналоги релаксина перерабатывают в фармацевтические средства для использования в способах настоящего изобретения. В качестве фармацевтических препаратов в настоящем изобретении можно использовать какую-либо композицию или соединение, которые могут стимулировать биологический ответ, обусловленный связыванием биологически или фармацевтически действующего релаксина (например, синтетического релаксина, рекомбинантного релаксина) или агониста релаксина (например, аналога релаксина или релаксин-подобного модулятора) с рецепторами релаксина. Общие сведения о методах приготовления лекарственных средств и введения хорошо описаны в научной литературе (см. кн.: «Remington's Pharmaceutical Sciences», изд-во Maack Publishing Co, Истон, Пенсильвания). Фармацевтические составы, содержащие фармацевтически действующий релаксин, можно приготовить в соответствии каким-либо из известных в данной области методов для получения фармацевтических препаратов. Составы, содержащие фармацевтически действующий релаксин или агонисты релаксина, используемые в способах настоящего изобретения, можно приготовить для введения каким-либо приемлемым традиционным способом, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное, местное введение или посредством спинальной инъекции. Наглядные примеры приводятся ниже. В одном из предпочтительных вариантов осуществления настоящего изобретения релаксин вводят внутривенно.

Если лекарственные препараты вводятся путем внутривенной инъекции, составы, содержащие фармацевтически действующий релаксин или агонисты релаксина, могут быть в форме стерильного инъекционного препарата, например, стерильной водной или масляной суспензии для инъекций. Эту суспензию можно получить в соответствии с известными методами в данной области, используя пригодные диспергирующие или смачивающие агенты или суспендирующие агенты, которые упоминались выше. Стерильный инъекционный препарат может также представлять стерильный инъекционный раствор или суспензию в нетоксичном приемлемом для парентерального введения разбавителе или растворителе. Среди приемлемых пригодных для использования наполнителей и растворителей имеются вода и раствор Рингера, изотонический раствор хлорида натрия. Кроме того, традиционно в качестве растворителя или суспендирующей среды можно использовать стерильные нелетучие масла. С этой целью можно использовать какое-либо обычное нелетучее масло, включая синтетические моно- или диглицериды. Кроме того, для приготовления инъекционных препаратов можно использовать жирные кислоты, например олеиновую кислоту.

Фармацевтические составы для местного введения содержат фармацевтически приемлемый для местного применения носитель и дозировки, пригодные для местного введения, и могут быть представлены в какой-либо форме, пригодной для нанесения на поверхность тела. Составы включают, например, крем, лосьон, раствор, гель, мазь, пасту и др. В составы для местного применения можно включать различные добавки, известные специалистам в данной области. Для растворения некоторых компонентов препарата можно использовать, например, растворители, включая относительно небольшие количества спирта. Также иногда в состав желательно включать Дополнительный усилитель проницаемости. Усилители проницаемости для местного введения лекарств известны специалистам в данной области и/или описаны в соответствующей литературе. См., например, кн.: «Percutaneous Penetration Enhancers», ред. Smith и др., изд-во CRC Press, 1995. Составы для местного применения могут также включать традиционные добавки, например, глушители, антиоксиданты, ароматизаторы, красители, образователи геля, загустители, разбавители, стабилизаторы, поверхностно-активные вещества и им подобные. Можно также добавлять другие агенты, например, антимикробные вещества для предотвращения порчи при хранении, т.е. для подавления роста микробов, например, дрожжей и плесневых грибов. Составы могут также содержать добавки, смягчающие раздражение, чтобы минимизировать или исключить возможность раздражения кожи или повреждения кожи в результате применения фармакологически действующего вещества или других компонентов композиции.

Фармацевтические составы для перорального введения можно получать с использованием фармацевтически приемлемых носителей, хорошо известных в данной области, в дозировках, пригодных для перорального введения. Такие носители позволяют получать фармацевтические составы в стандартных лекарственных формах, например, таблетках, пилюлях, порошках, капсулах, жидкостях, леденцах, гелях, сиропах, гидросмесях, суспензиях и т.д., пригодных для употребления пациентом. Фармацевтические препараты для перорального применения можно получать путем сочетания соединений релаксина с твердым эксципиентом, необязательно измельчением полученной смеси и переработкой смеси гранул, после добавления соответствующих дополнительных соединений, при необходимости, для получения таблеток или пилюль. Пригодными твердыми эксципиентами являются углеводные или белковые наполнители, которые включают, но ими не ограничиваются, сахара, в том числе лактозу, сахарозу, маннит, сорбит или крахмал из кукурузы, пшеницы, риса, картофеля или других растений, целлюлозу, например, метилцеллюлозу, гидроксипропилметилцеллюлозу или натриевую соль карбоксиметилцеллюлозы и смолы, включая гуммиарабик и трагакант, а также белки, например, желатин и коллаген. При необходимости можно добавлять разрыхлители или солюбилизаторы, например, поливинилпирролидон с поперечными связками, агар, альгиновую кислоту или ее соли, например, альгинат натрия. Фармацевтические препараты по настоящему изобретению, которые также можно использовать перорально, представляют, например, твердые капсулы, приготовленные из желатина, а также мягкие, запечатанные капсулы, приготовленные из желатина и покрытия, например, глицерина или сорбита. Твердые капсулы могут содержать релаксин, смешанный с наполнителем или связывающим веществом, например, лактозой или крахмалами, смазывающим веществом, например, тальком или стеаратом магния, и, необязательно, стабилизаторами. В мягких капсулах соединения релаксина можно растворять или суспендировать в соответствующих жидкостях, например, жирных маслах, вазелиновом масле или жидком полиэтиленгликоле со стабилизаторами или без них.

Водные суспензии по настоящему изобретению содержат релаксин в смеси с эксципиентами, применимыми для приготовления водных суспензий. Такие эксципиенты включают суспендирующие агенты, например, натриевую соль карбоксиметилцеллюлозы, метилцеллюлозу, гидрокипропилметилцеллюлозу, альгинат натрия, поливинилпирролидон, трагакантовую камедь и гуммиарабик, и диспергирующие или увлажняющие агенты, например, природный фосфатид (например, лецитин), продукт конденсации алкиленоксида с жирной кислотой (например, стеарат полиоксиэтилена), продукт конденсации этиленоксида с алифатическим спиртом с длинной цепью (например, гептадекаэтиленоксицетанол), продукт конденсации этиленоксида с неполным сложным эфиром, производным жирной кислоты и гексита (например, полиоксиэтиленсорбит моноолеат), или продукт конденсации этиленоксида с неполным сложным эфиром, производным жирной кислоты и гекситангидрида (например, полиоксиэтиленсорбитана моноолеат). Водная суспензия может также содержать один или несколько консервантов, например, этил- или н-пропил-п-гидроксибензоат, один или несколько красителей, один или несколько ароматизаторов и один или несколько подсластителей, например, сахарозу, аспартам или сахарин. Составы могут быть скорректированы с учетом осмолярности.

Масляные суспензии могут быть переработаны путем суспендирования релаксина в растительном масле, например, арахисовом масле, оливковом масле, кунжутном масле или кокосовом масле, или в минеральном масле, например, вазелиновом масле. Масляные суспензии могут содержать загустители, например, пчелиный воск, твердый парафин или цетиловый спирт. Для придания пероральному препарату приятного вкуса можно использовать подсластители. Для сохранения этих составов можно добавить антиоксидант, например, аскорбиновую кислоту.

Диспергируемые порошки и гранулы по настоящему изобретению, пригодные для получения водной суспензии путем добавления воды, можно получать из релаксина в смеси с диспергирующим, суспендирующим и/или смачивающим агентом, и одним или несколькими консервантами. Примеры пригодных диспергирующих или увлажняющих агентов и суспендирующих агентов приведены в изобретении выше. Также могут присутствовать дополнительные эксципиенты, например, подсластители, ароматизаторы и красители.

Фармацевтические составы по настоящему изобретению могут также быть в форме эмульсии «масло в воде». Масляная фаза может представлять растительное масло, например, оливковое масло или арахисовое масло, минеральное масло, например, вазелиновое масло, или их смеси. Пригодные эмульгаторы включают природные смолы, например, гуммиарабик и трагакант, природные фосфатиды, например, соевый лецитин, сложные эфиры или неполные сложные эфиры, производные жирных кислот и гекситангидридов, например, сорбитана моноолеат, и продукты конденсации этих неполных сложных эфиров с этиленоксидом, например, полиоксиэтиленсорбитана моноолеат. Эмульсии могут быть переработаны с подсластителями и ароматизаторами. Сиропы и эликсиры можно получать с подсластителями, например, глицерином, сорбитом или сахарозой. Такие составы могут также содержать успокоительное средство, консервант, ароматизатор или краситель.

Введение и режим дозирования

Составы, содержащие фармацевтически действующий релаксин, используемые в способах настоящего изобретения, можно вводить каким-либо традиционным приемлемым способом, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное, местное введение и спинальную инъекцию. Введение будет меняться в зависимости от фармакокинетики и других свойств лекарственных средств и состояния здоровья пациентов. Общие руководящие принципы представлены ниже.

Способы настоящего изобретения уменьшают раскрытие шейки матки у женщин, предрасположенных к преждевременным родам. Кроме того, способы настоящего изобретения уменьшают риск преждевременных родов и выкидышей у женщин, предрасположенных к преждевременным родам или выкидышам, а также увеличивают длину срока беременности и повышают массу ребенка при рождении у этих субъектов. Количество релаксина отдельно или в комбинации с другим агентом или лекарством (например, прогестероном или токолитиком), которое является достаточным для достижения этой цели, считается терапевтически эффективной дозой. Схема дозирования и количество, эффективные для такого использования, т.е. «режим дозирования», будет зависеть от ряда факторов, в том числе от стадии беременности, степени досрочного раскрытия шейки матки, серьезности досрочного родового акта, серьезности неблагоприятных побочных эффектов, общего состояния здоровья пациента, физического состояния пациента, возраста и тому подобных. При расчете режима дозирования для пациента, также принимается во внимание способ введения. Режим дозирования должен также учитывать фармакокинетику лекарственного вещества, т.е. скорость всасывания, биодоступность, метаболизм, выведение и тому подобное. На основе этих принципов, релаксин можно использовать для сокращения раскрытия шейки матки у женщин, предпочтительно беременных женщин, предрасположенных к преждевременным родам.

Современный уровень науки в данной области позволяет врачу определить режим дозирования релаксина для каждого конкретного пациента. В качестве иллюстративного примера, в качестве руководства для определения режима дозирования, т.е. схемы дозирования и уровней доз, составов, содержащих фармацевтически действующий релаксин, при осуществлении способов настоящего изобретения, можно использовать руководящие принципы, которые приводятся ниже для релаксина. В качестве основного принципа предполагается, что суточная доза фармацевтически действующего релаксина Н2 человека (например, синтетического, рекомбинантного) типично представляет количество в диапазоне примерно от 0,1 до 500 мкг/кг массы тела субъекта в сутки, и более типично в диапазоне примерно от 1 до 500 мкг/кг массы тела субъекта в сутки. Субъекты также могут получать фармацевтически действующий релаксин Н2 человека (например, синтетический, рекомбинантный) в количестве в диапазоне примерно от 10 до 1000 мкг/кг массы тела субъекта в сутки. В одном варианте осуществления настоящего изобретения дозировки релаксина составляют 10, 30, 100 и 250 мкг/кг/сутки. В другом варианте осуществления настоящего изобретения эти дозировки создают концентрации релаксина в сыворотке, составляющие примерно 3, 10, 30 и 75 нг/мл, соответственно. В еще одном варианте осуществления настоящего изобретения введение релаксина продолжают для поддержания концентрации релаксина в сыворотке примерно от 0,5 до примерно 500 нг/мл, более предпочтительно примерно от 0,5 до примерно 300 нг/мл, и наиболее предпочтительно примерно от 3 до примерно 75 нг/мл. В другом варианте осуществления настоящего изобретения введение релаксина продолжают с тем расчетом, чтобы поддерживать концентрацию релаксина в сыворотке примерно от 0,1 до примерно 50 нг/мл, более предпочтительно примерно от 0,1 до примерно 30 нг/мл, и наиболее предпочтительно примерно от 1 до примерно 20 нг/мл, в зависимости от субъекта и состояния. Введение релаксина продолжают в течение определенного периода времени, который необходим для подавления раскрытия шейки матки и досрочных родов. Например, лечение релаксином может продолжаться в течение времени в диапазоне примерно от 4 ч до примерно 96 ч, в зависимости от пациента, и при необходимости необязательно проводятся один или несколько повторных курсов лечения. В другом варианте релаксин можно вводить в течение нескольких недель. Например, для подкожного введения релаксина можно использовать переносной инфузионный насос, чтобы лечить женщин с риском преждевременных родов в течение нескольких недель без необходимости госпитализации.

Однократные или многократные введения составов с релаксином можно проводить в зависимости от дозировки и частоты в соответствии с необходимостью и переносимостью женщинами с риском преждевременных родов. Составы должны обеспечивать достаточное количество релаксина, чтобы эффективно уменьшать раскрытие шейки матки. Типичный фармацевтический состав для внутривенного введения релаксина зависит от специфической терапии. Например, релаксин можно вводить пациенту посредством монотерапии (т.е. без каких-либо других сопутствующих лекарственных препаратов) или в комбинированной терапии с другим лекарственным средством, например, прогестероном, токолитическим агентом или другим лекарством. Примечательно, что дозы релаксина, вводимые пациенту, могут меняться в зависимости от возраста, стадии беременности, толерантности к лекарственному средству, и сопутствующих лекарственных средств и условий.

Примеры

Следующие конкретные примеры предназначены для иллюстрации настоящего изобретения и не должны рассматриваться в качестве вариантов, ограничивающих объем формулы настоящего изобретения.

Пример 1

Клиническое исследование по оценке безопасности и действия релаксина человека на созревание шейки матки

Общее представление о клиническом исследовании. Данное исследование планируют с двумя целями. Первая цель заключается в определении безопасности внутривенного введения рекомбинантного релаксина человека женщинам в течение 24 ч. Вторая цель состоит в определении, могут ли высокие дозы релаксина при ведении этим способом в течение 24 ч способствовать созреванию шейки матки или индуцировать родовую деятельность. Первичной конечной точкой эффективности является отклонение от исходного значения показателя Бишопа, который является составной общепринятой оценкой зрелости шейки матки (Bishop, 1964). Показатель включает 5 компонентов, которые все способствуют изменениям шейки матки, необходимым для влагалищного родоразрешения: раскрытие, сглаженность, состояние, консистенция и положение шейки матки. Неожиданно было установлено, что релаксин не продвигал созревания шейки матки или начало родового акта, а напротив уменьшал раскрытие шейки матки у этих субъектов.

Испытуемые. Исследуемыми субъектами являются здоровые первородящие женщины со сроком беременности >40 недель, поступившие в больницу по предписанию индукции родовой деятельности. Критерии включения и исключения исследуемых субъектов в исследование перечислены в табл.1. Данное исследование проводят в соответствии с требованиями протокола Международной конференции по гармонизации (ICH - International Conference on Harmonization), надлежащей клинической практики (GCP - Good Clinical Practices), FDA, местных правил и фирмы BAS Medical, инструкций стандартных операционных процедур (SOP - standard operating procedures). Исследователи несут ответственность за получение информированного согласия от каждого пациента, участвующего в исследовании. Все соответствующие задачи исследования объясняют пациенту, прежде чем он или она подписывает форму информированного согласия. Информированное согласие одобряют местными комитетами по этике и получают от пациента перед какой-либо деятельностью или началом проведения лечения, которое не является частью обычной практики. Оно включает, но ими не ограничивается, выполнение диагностических или лечебных процедур и введение первой дозы исследуемого лекарственного средства.

Таблица 1.
Исследуемые субъекты
Показатели включения в исследование
Здоровые первородящие женщины >40 недель беременности
Показатель Бишопа <4
Неповрежденные мембраны, затылочное предлежание плода и менее 8 сокращений матки в час
Реактивный нестрессовый тест плода
Одноплодная беременность
Возраст 18-40 лет
ИМТ (индекс массы тела) до беременности <29 и прибавка в весе в течение беременности <18 кг
Показатели исключения из исследования
Гемоглобин <8,5 г/дл
Текущий диагноз артериальной гипертензии (устойчивое САД >140 мм Hg или ДАД >90 мм Hg)
Диагностика токсикоза беременности (проявления тошноты, рвоты, отека и/или протеинурии)
Масса тела <50 кг
Хроническое почечное заболевание матери
Аутоиммунное или коллагеновое сосудистое заболевание матери
Материнский предгестационный диабет или гестационный диабет, требующий инсулинотерапии
История эндометриоза
Электрокардиографическое доказательство каких-либо аномалий сердечной проводимости
Тяжелая болезнь сердца матери, требующая наблюдения в отделении интенсивной терапии
Планируемое и/или предшествующее родоразрешение посредством кесарева сечения или предшествующий классический разрез матки
Предлежание плаценты или предлежание сосудов пуповины
Неправильное предлежание плода, включая поперечное положение
Выпадение пуповины
Активная половая герпесная инфекция
Известные аномалии плода
Задержка внутриутробного развития плода (ЗВРП), масса ниже 10-го процентиля для гестационного возраста и окружность живота которого ниже 2,5-го процентиля

План исследования: Исследование состоит из двух частей:

Часть А представляет многоцентровое рандомизированное двойное слепое с плацебо-контролем с повышением дозы исследование 18 субъектов со сроком беременностью ≥40 недель, у которых запланирована индукция родов. Исследуют дозы релаксина 7,5, 25 и 75 мкг/кг/сутки. Субъектов разделяют на три группы по 6 женщин в каждой, которые случайным образом получают релаксин или плацебо в соотношении 4:2, соответственно. Повышение дозы до следующего уровня дозы производят сразу после проверки данных по безопасности.

Соответствующие пациенты поступают в больницу, по крайней мере, за 24 ч до запланированной индукции. Либо релаксин, либо сочетающееся плацебо вводят путем непрерывного внутривенного вливания в течение 24 ч, предшествующих индукции. У субъектов на протяжении введения исследуемого лекарственного средства контролируют артериальное давление и частоту сердечных сокращений, а также сокращения матки и начало родового акта. Для оценки состояния здоровья плода проводят нестрессовый тест плода и мониторинг сердечного ритма. Перед дозированием, на 12 и 24 ч дозирования, через 2-е суток, 1 неделю и 4 недели после родов, отбирают образцы крови для общего и биохимического анализов крови. Для оценки уровня сывороточного релаксина образцы крови отбирают перед дозированием, через 30 мин, 1, 4, 6, 12 и 24 ч дозирования, кроме того, для измерения уровня релаксина отбирают образец пуповинной крови. Образец также отбирают у исследуемого субъекта через 2 суток после родов. Образцы для измерения образования антител к релаксину отбирают перед дозированием и через 1 и 4 недели после родов. У новорожденных оценивают уровень релаксина через 2-е суток и наличие антител к релаксину через 1 и 4 недели.

Часть Б исследования представляет многоцентровое рандомизированное двойное слепое плацебо-контролируемое исследование в параллельных группах по 50 субъектов с беременностью ≥40 недель, у которых запланирована индукция родов. Субъектов рандомизируют в соотношении 1:1 для приема наиболее соответствующей дозы релаксина, установленной в части А исследования, или приема плацебо. Подобно исследованиям в части А, выбранным субъектам проводят внутривенные вливания релаксина или плацебо в течение 24 ч, предшествующих индукции. Оценку состояния субъектов и новорожденных по всем показателям проводят способом, идентичным таковому в части А.

Первичной конечной точкой эффективности является отклонение от исходного значения показателя Бишопа через 6, 12 и 24 ч (или в конце исследования введения препарата). Показатель варьирует от 0 (отсутствие каких-либо изменений шейки матки) до максимального значения 13, означающего, что шейка матки полностью раскрыта (>5 см), сглажена (>80%), размягчена, на +1 или +2 положении и расположена спереди (Бишоп, 1964). Изучают также несколько вторичных конечных точек эффективности: время до полного раскрытия, долю субъектов с изменением показателя Бишопа >3, долю субъектов с показателем Бишопа >5, долю субъектов с показателем Бишопа >8, время до активной родовой деятельности, время до родоразрешения (влагалищного или путем кесарева сечения), частоту сокращений матки, частоту гиперстимуляции матки, требующей лечения тербуталином или прекращения вливания исследуемого лекарственного средства (релаксина или плацебо), частоту самопроизвольных родов, доли кесарева сечения, частоту прослеживаемых аномалий сердечного ритма плода, отклонения от исходного уровня систолического и диастолического артериального давления, отклонения от исходного уровня креатинина сыворотки и прогнозируемый клиренс креатинина, определяемый по формуле Кокрофта-Голта (Cockroft-Gault).

Безопасность. Безопасность оценивают на основании сообщаемых и наблюдаемых побочных проявлений, медицинского осмотра и данных 12-канальной ЭКГ, основных показателей состояния организма и результатов клинических лабораторных исследований. Образцы для биохимического анализа сыворотки крови отбирают перед дозированием, через 12 и 24 ч после начала дозирования, через 2 суток, 1 неделю и 4 недели после родов. Основные показатели состояния организма матери включают температуру, частоту сердечных сокращений и кровяное давление. Эти оценки проводят при скрининге, перед дозированием, в течение дозирования, в течение 24-48 ч после дозирования и через 2 суток, 1 неделю и 4 недели после родов. Измерения в течение периода 24-48 ч после дозирования проводят на 28, 32, 36, 40, 44 и 48 ч. Основные показатели состояния организма новорожденных включают температуру, пульс, дыхание и кровяное давление. Все измерения жизненно важных показателей проводят при родах, через 2 суток, 1 неделю и 4 недели после родов.

Побочные проявления у испытуемых регистрируют в начальный период времени, т.е. в период дозирования (0-24 ч), через 24 ч после вливания (24-48 ч) и в последующий период (>48 ч). Также по группе лечения обобщают побочные проявления, зарегистрированные у плодов и новорожденных. По лабораторным исследованиям (гематология, биохимический анализ сыворотки, анализ мочи), жизненно важным показателям состояния организма, медицинскому осмотру и ЭКГ готовят сводку статистических данных для исходного уровня и отклонений от исходного уровня для каждого запланированного времени по группе лечения. Впоследствии также проводят повторные измерения систолического и диастолического артериального давления.

Одно тяжелое побочное проявление, клинически узкий таз, зарегистрировано у субъекта в группе плацебо. Это проявление обнаружено в период после дозирования (>48 ч после дозирования). Состояние субъект восстановилось без каких-либо медицинских действий или лекарств. Серьезные побочные проявления зарегистрированы у трех плодов. Два проявления зарегистрированы в объединенной группе применения релаксина (гипоксия плода средней тяжести). Ни в одном случае не потребовались какие-либо медицинские действия или лекарства, и побочные проявления не связаны с исследуемым лекарственным средством. Один случай острого дистресса плода средней степени тяжести зарегистрирован в группе плацебо. После введения лекарственного средства нормальное состояние плода восстановилось. Серьезные неблагоприятные события зарегистрированы у 8 новорожденных: у одного в группе, получавшей дозу 7,5 мкг/кг/сутки, у четырех в объединенной группе релаксина и у трех в группе плацебо. Ни одно из этих событий не было связано с исследуемым лекарством и все новорожденные оправились от этих побочных проявлений. Эти побочные проявления включали 2 сообщения о гемолитической болезни и по одному сообщению о тяжелой асфиксии новорожденного, недостающем приросте массы тела, макростомии, гипербилирубинемии, церебральной ишемии, отсутствии адекватного самостоятельного дыхания, врожденном заболевании сердца, мекониевой аспирации и конъюнктивите.

Статистический анализ. Анализы проводят на группе ITT (Intent-to-treat - сформированной в зависимости от назначенного лечения), которая состоит из всех рандомизированных субъектов, и на группе РР (Per-protocol - все пациенты, выполнившие требования протокола), которая состоит из всех рандомизированных субъектов, которые получают исследуемое лекарственное средство в течение по меньшей мере 18 ч (75% соответствия), и у которых оценивают исходные значения и значения через 24 часа (или в конце лечения) показателя Бишопа. Для сравнений эффективности пациентов из части А исследования, которые получают действующую дозу, вводимую в части Б, объединяют с пациентами из части Б (объединенная группа релаксина), как и всех плацебо-пациентов из частей А и Б (объединенная группа плацебо).

ELISA релаксина. Измерение концентрации релаксина в сыворотке проводят иммуноферментным анализом, с использованием 96-луночных планшетов для микротитрования, покрытых афинно очищенными козьими антителами к релаксину. Предварительно разбавленные контрольные и неизвестные образцы вносят пипеткой в лунки планшета и инкубируют при температуре 2-8°С, давая какому-либо имеющему релаксину связаться с антителами к релаксину. После инкубации в течение ночи планшеты промывают, чтобы удалить непрореагировавшие компоненты сыворотки. Добавляют афинно очищенный конъюгат кроличьих антител к релаксину с пероксидазой и инкубируют в течение 3 ч при комнатной температуре при встряхивании. Добавленный конъюгат распознает какой-либо связанный релаксин. Несвязанный белок и реагенты удаляют путем еще одной стадии промывки, после чего в лунки добавляют субстрат, раствор тетраметилбензидина (ТМБ), для образования цветной реакции. После 20-мин инкубации, для остановки цветной реакции добавляют аликвоту 2М серной кислоты, и измеряют поглощение при 450 нм (опорная длина волны 650 нм), используя планшетный спектрофотометр. Интенсивность получаемой окраски пропорциональна концентрации релаксина в образце. Уровни релаксина определяют по стандартной кривой, построенной на основе измерения очищенного рекомбинантного релаксина в 20% растворе сыворотки человека, используя уравнение построения кривой по четырем параметрам. Этот анализ имеет рабочую чувствительность 96 пг/мл. Контроли закалывают с релаксином на низком, среднем и высоком уровне, и высокий уровень анализируют методом ELISA, показавшем приемлемую точность результатов между разными сериями опытов с коэффициентом вариации (KB) от 7,21% до 9,16%. Данное исследование проводят в соответствии с частью 58 раздела 21 свода федеральных постановлений США (CFR, Code of Federal Regulations) Надлежащей лабораторной практики (GLP - Good Laboratory Practice) Управления продовольственных и лекарственных препаратов США (FDA, Food and Drug Administration).

Исследование антител к релаксину. В основе этого анализа лежит иммуноферментный анализ с использованием 96-луночных планшетов для микротитрований, покрытых молекулами релаксина. Предварительно разбавленные контрольные и неизвестные образцы вносят пипеткой в лунки планшета для микротитрований и инкубируют при встряхивании при комнатной температуре, что позволяет какому-либо из присутствующих антител к релаксину связаться с релаксином. После инкубации в течение трех часов планшеты промывают, чтобы удалить непрореагировавшие компоненты сыворотки. Конъюгат видоспецифических анти-IgG/IgM с пероксидазой хрена, который распознает любые IgG или IgM антитела, связывается с релаксином твердой фазы. Несвязанный белок и реагенты удаляют путем еще одной стадии промывки, после чего в лунки добавляют субстрат, раствор тетраметилбензидина (ТМБ). После десяти минут инкубации добавляют аликвоту 2М серной кислоты и измеряют поглощение при 450 нм (опорная длина волны 630 нм), используя планшетный спектрофотометр. Интенсивность получаемой окраски пропорциональна концентрации антител к релаксину в образце. Антитело-положительные образцы определяют путем сравнения оптической плотности с заранее определенной отсекаемой оптической плотностью.

Полученные данные. Всего в исследование включают 72 субъекта (22 в части А и 50 в части Б), из которых 40 получают лечение релаксином и 32 получают плацебо. Средний возраст исследуемой группы составляет 24 года (диапазон: 18-32 года). Большинство субъектов принадлежат к европеоидной расе (85%, N=61). Средняя масса тела субъектов до беременности составляет 60 кг (диапазон: 45-80 кг) и срок беременности составляет 40 недель. Субъекты, рандомизированные по получению 3 уровней доз в части А исследования и 2 группы, получающих различные дозы в части Б, имеют близкие демографические характеристики. Показатель Бишопа у всех субъектов <4 и при скрининге, и при предварительной оценке. Среднее значение показателя Бишопа у всех субъектов составляет 2,1+1,5 (среднее + СО) и при скрининге, и при оценке исходного состояния перед дозированием.

Часть А: В первой когорте части А семь субъектов получают 7,5 мкг/кг/сутки релаксина и 3 субъекта получают плацебо. Данные по безопасности от этих субъектов анализируют слепым образом, и поскольку они сочтены приемлемыми, шесть субъектов рандомизируют в когорту 2 и зачисляют на получение 25 мкг/кг/сутки релаксина или плацебо. После подтверждения данных по безопасности у этих субъектов регистрируют третью когорту и четырем и двум субъектам вводят дозу релаксина 75 мкг/кг/сутки и плацебо, соответственно. На основании данных, полученных от 22 субъектов в части А, доза релаксина 75 мкг/кг/сутки выбрана в качестве дозы для исследования в части Б.

Часть Б: В эту часть исследования всего включают 50 пациентов, равномерно распределяемых на группу, получающую 75 мкг/кг/сутки лекарства, и группу, получающую плацебо. В общей сложности 9 из 72 субъектов получают вливание исследуемого лекарственного средства в течение менее 18 ч. Вливание краткосрочно прерывают у 4 субъектов из-за технических проблем с системой доставки инфузионного насоса и прекращают у 16 субъектов в связи с наступлением родового акта (n=12) или разрыва плодных оболочек (n=4). Средний период воздействия лечения в объединенной группе релаксина составляет 22,3+4,2 ч (n=29) и средний период воздействия в объединенной группе плацебо составляет 21,4+6,1 ч (n=32). Средние исходные концентрации релаксина в сыворотке в группах релаксина и плацебо составляют 0,293 и 0,561 нг/мл, что отражает уровни эндогенного релаксина. Концентрации релаксина в группе релаксина быстро выросли до пика 13,0 нг/мл на 12 ч дозирования, в то же время уровни релаксина в группе плацебо остались неизменными. На вторые сутки после родов концентрации в обеих группах снижаются до уровней, немного превышающих уровни обнаружения (см. фиг.2).

Средние показатели Бишопа в объединенных группах релаксина и плацебо в начале исследования и через 6, 12 и 24 ч после начала лечения исследуемым лекарственным средством показаны на фиг.3. В начале исследования средние показатели Бишопа составили 2,2 и 1,9 в объединенной группе релаксина и объединенной группе плацебо, соответственно. Ниже в табл.2 суммированы исходные показатели Бишопа и изменения по сравнению с исходным значением через 6, 12 и 24 ч в объединенной группе плацебо и объединенной группе релаксина. Обе группы, получавшие лечение, показывают увеличение показателей Бишопа по сравнению с исходными значениями через 6, 12 и 24 ч вливания исследованного лекарственного средства. Среднее увеличение колеблется в пределах от 1,55 до 3,26 в объединенной группе релаксина и от 1,77 до 4,19 в группе плацебо.

В какое-либо время наблюдения различия между объединенной группой релаксина и объединенной группой плацебо не являлись статистически значимыми. Отдельные компоненты показателей Бишопа были также близки между объединенной группой релаксина и объединенной группой плацебо, за исключением одного параметра - раскрытия шейки матки.

В объединенной группе плацебо и объединенной группе релаксина исходные показатели раскрытия шейки матки близки, и проводят оценку изменений раскрытия с течением времени (фиг.4). Плацебо-группа показала непрерывное увеличение раскрытия шейки матки, которое изменилось на 1,39 см по сравнению с начальным раскрытием при измерении через 24 ч. Напротив, группа релаксина показала лишь незначительное увеличение в течение первого часа введения релаксина, которое практически не менялось с течением времени. Через 24 ч раскрытие шейки матки увеличилось лишь на 0,69 см по сравнению с начальным раскрытием в этой группе. Таким образом, раскрытие шейки матки было значительно ниже в группе релаксина по сравнению с группой плацебо (p<0,024 по критерию Стьюдента), свидетельствуя о том, что релаксин задерживает раскрытие шейки матки. Общие показатели Бишопа в группах, получавших более низкие дозы (7,5 и 25 мкг/кг/сутки) релаксина, в части А исследования также не отличались от таковых, наблюдаемых в объединенной группе плацебо (данные не приведены). Вторичные конечные точки, связанные с родоразрешением, приведены в табл.3. Вливание релаксина существенно не влияло на частоту или время влагалищного родоразрешения, частоту самопроизвольных родов или время начала родовой деятельности. Лечение релаксином не влияло на частоту сердечных сокращений у плода.

Таблица 2.
Общий показатель Бишопа - отклонение от исходного уровня
Отклонение от исходного уровня через: Параметр 75 мкг/кг/сутки (n=29) Объединенная группа плацебо p-величина *
N 29 30
Среднее 1,55 1,77 0,2407
СО 2,13 1,45
Медиана 1,00 2,00
Минимум 0 0
Максимум 9 4
12 ч N 28 28
Среднее 2,11 2,64 0,1085
СО 2,02 1,64
Медиана 2,00 3,00
Минимум 0 0
Максимум 7 7
24 ч N 23 26
Среднее 3,26 4,19 0,2507
СО 2,26 1,90
Медиана 4,00 4,00
Минимум 0 0
Максимум 7 8
Последнее наблюдение N 29 30
Среднее 3,59 4,03 0,4900
СО 2,50 1,90
Медиана 4,00 4,00
Минимум 0 0
Максимум 9 8

Комментарии к таблице 2. 1) Объединенная группа релаксина (75 мкг/кг/сутки) включает субъектов, которые получают одну и ту же действующую дозу в частях А и Б исследования. Объединенная группа плацебо включает субъектов, которые получают плацебо в частях А и Б исследования. 2) В эту таблицу включены все рандомизированные исследованные субъекты (ITT-популяция). 3) В этой таблице использованы общие показатели Бишопа, установленные по CRF. Если общий балл по шкале Бишопа >13, то используют показатель «13». 4) Исходное значение означает общий показатель Бишопа перед дозированием. Если значение перед дозированием недоступно, используют скрининговое значение. 5) Последнее наблюдение означает последнее доступное значение после исходного. 6) Изменение рассчитывают на основании значения при осмотре минус исходное значение. * Р-величина получено только для оценки различий между объединенной группой релаксина и объединенной группой плацебо.

Таблица 3.
Вторичные точки эффективности, относящиеся к объединенным группам применения релаксина и плацебо
Релаксин Плацебо Величина p
Доля влагалищного родоразрешения 20/29 (69%) 27/32 (84%) 0,153
Время до влагалищного родоразрешения (среднее + СО) 62±40 ч (n=20) 54±29 ч (n=27) 0,644
Время до родов для влагалищного родоразрешения + кесарева сечения (среднее + СО) 69±40 ч (n=29) 55±30 ч (n=32) 0,251
Доля спонтанной родовой деятельности 12/29 (41%) 20/32 (63%) 0,213
Время до наступления активной родовой деятельности 53 ч (n=26) 46 ч (n=32) 0,412

Заключение. Цель настоящего изобретения заключалась в определении безопасности рекомбинантного релаксина человека при внутривенном введении беременным женщинам и в исследовании влияния релаксина человека на созревание шейки матки. Исследование представляет первое использование вводимого внутривенно релаксина человека по этому показанию и демонстрирует, что во всем диапазоне доз релаксин не проявляет существенных побочных эффектов. В отличие от эффекта релаксина у животных, у беременных женщин с нормальным сроком релаксин не вызывал увеличения показателя Бишопа, стандартной оценки созревания шейки матки. Наоборот, это исследование показывает, что введение релаксина снижает скорость раскрытия шейки матки у этих женщин. Таким образом, релаксин можно использовать для снижения преждевременного раскрытия шейки, и, следовательно, он весьма пригоден для лечения с целью уменьшения риска преждевременного родоразрешения или выкидыша.

Пример 2

Клиническое исследование с целью определения эффективности применения релаксина у женщин при риске преждевременных родов

Общее представление и план исследования. С целью оценки эффективности релаксина человека для торможения дальнейшего раскрытия шейки матки у женщин с досрочным раскрытием шейки проводят рандомизированное двойное слепое с плацебо-контролем исследование. Женщин с этим симптомом обычно госпитализируют и назначают им постельный режим. Этих лиц зачисляют в исследование, и вводят им релаксин либо путем внутривенного вливания в больнице, либо с помощью инфузионных насосов для подкожного введения, которое не требует госпитализации. Первичной конечной точкой эффективности является продление срока от начала преждевременного раскрытия шейки матки и введения релаксина или плацебо до родоразрешения. Этот период времени сравнивают между группами, получающими лечение релаксином, и контрольными группами, с провидением статистического анализа.

Специалистам в данной области очевидны различные модификации и изменения настоящего изобретения, не затрагивающие объема и сущности настоящего изобретения. Хотя изобретение описывается в связи с конкретными предпочтительными вариантами осуществления, следует понимать, что заявленное изобретение не должно ограничиваться лишь такими конкретными вариантами осуществления. На самом деле подразумевается, что в рамках объема формулы настоящего изобретения находятся различные модификации описанных способов осуществления настоящего изобретения, которые понятны специалистам в данной области.

1. Способ снижения скорости раскрытия шейки матки, включающий введение беременным женщинам фармацевтического состава, включающего фармацевтически активный релаксин Н2.

2. Способ по п.1, в котором беременная женщина испытывает симптомы, выбранные из группы, состоящей из ранних схваток, спазмов в нижней части живота, тупой боли в пояснице, давления в тазовой области, спазмов желудка, выделений из влагалища, влагалищных кровотечений и влагалищных выделений водянистой жидкости.

3. Способ по п.1, в котором релаксин вводят в количестве при диапазоне величин примерно от 0,1 до 500 мкг/кг массы тела субъекта.

4. Способ по п.3, в котором релаксин вводят в количестве, чтобы поддерживать концентрацию релаксина в сыворотке примерно от 0,5 до 50 нг/мл.

5. Способ по п.1, в котором релаксин вводят в начале первого триместра беременности.

6. Способ по п.1, в котором релаксин вводят в начале второго триместра беременности.

7. Способ по п.1, в котором релаксин вводят в начале третьего триместра беременности.



 

Похожие патенты:
Изобретение относится к медицине, в частности к экспериментальной фармакологии, и может быть использовано для коррекции нарушения микроциркуляции в плаценте у беременных.
Изобретение относится к медицине, а именно к акушерству и гинекологии, и может быть использовано для профилактики или лечения синдрома задержки внутриутробного развития плода.
Изобретение относится к медицине, а именно к акушерству. .
Изобретение относится к медицине, в частности к экспериментальной фармакологии, и может быть использовано для изучения коррекции эндотелиальной дисфункции у беременных.
Изобретение относится к медицине, в частности к экспериментальной фармакологии, и может быть использовано при разработке способов коррекции эндотелиальной дисфункции у беременных.
Изобретение относится к медицине, в частности к экспериментальной фармакологии, и может быть использовано для изучения механизмов коррекции эндотелиальной дисфункции у беременных.
Изобретение относится к медицине, а именно к гинекологии, и может быть использовано для лечения больных с привычным невынашиванием беременности в первом триместре.
Изобретение относится к медицине, в частности к экспериментальной фармакологии, и может быть использовано для коррекции эндотелиальной дисфункции у беременных. .
Изобретение относится к медицине, а именно к акушерству, и может быть использовано для профилактики тяжелого гестоза. .
Изобретение относится к медицине, а именно к акушерству и трансплантологии, и касается прерывания беременности у реципиенток почечного аллотрансплантата. .
Изобретение относится к медицине, в частности к онкологии и пульмонологии, и касается лечения рака легкого. До проведения лечебной процедуры из крови больного производят забор лимфоцитов методом лимфоцитафереза, из которых готовят лейкоцитарную массу.

Изобретение относится к медицинской технике, а именно к автоматическому инъектору для инъекции медикаментов пациенту. Автоматический инъектор имеет гибкий контейнер, иглу, корпус, насос и главную приводную пружину.

Группа изобретений относится к медицинской технике. Устройство включает держатель для фиксации полого тела, имеющего, по меньшей мере, одно первое и одно второе отверстия, и средство вставки заглушки, с помощью которого во второе отверстие полого тела может вводиться заглушка.

Изобретение относится к медицинской технике, а именно к картриджу для автоматического инъектора. .

Изобретение относится к медицинской технике, а именно к соединению компонентов с устройством для введения медицинской текучей среды. .
Изобретение относится к медицине, а именно к интенсивной терапии, анестезиологии и реанимации, и может быть использовано у пациентов, которым необходима коррекция жидкостного баланса.
Изобретение относится к медицине, а именно к гинекологии, и может быть использовано при лечении пациенток, больных бесплодием, обусловленным непроходимостью маточных труб и ановуляторным менструальным циклом на фоне хронического туберкулеза органов малого таза.
Изобретение относится к медицине, а именно к кардиологии и кардиохирургии, и может быть использовано при лечении диффузного поражения миокарда. .
Изобретение относится к области фармацевтики и представляет собой питательную композицию для младенца или ребенка, содержащую липид или жир; источник белка; источник полиненасыщенных жирных кислот с длинной цепью, который содержит докозагексаеновую кислоту; до 2,5 вес.% источника дополнительного кальция, причем по меньшей мере 20% источника дополнительного кальция представляет собой глюконат кальция, и от 0,015 до 0,1 миллионных долей (пг/мкг) ТРФ-β.
Наверх