Органические соединения

Изобретение относится к области биотехнологии, а именно к эукариотическому вектору для экспрессии целевого рекомбинантного продукта в клетке млекопитающего и его применению, к клетке млекопитающего для продуцирования целевого рекомбинантного продукта и способу ее получения, способу отбора клетки млекопитающего и способу получения целевого рекомбинантного продукта. Вектор включает первый полинуклеотид, кодирующий функциональный связанный с мембраной фолатный рецептор в качестве селективного маркера, и второй полинуклеотид, кодирующий целевой продукт, который рекомбинантно экспрессируется. Целевой продукт представляет собой фармацевтически активный, терапевтически активный или диагностический полипептид. Функциональный связанный с мембраной фолатный рецептор и целевой продукт экспрессируются с указанного вектора экспрессии. Система отбора основана на введении гена экзогенного функционального связанного с мембраной фолатного рецептора в клетку млекопитающего. Предложенное изобретение позволяет эффективно проводить селекцию трансформированных клеток и получать с высоким выходом целевой продукт. 6 н. и 20 з.п. ф-лы, 3 табл., 2 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к новой системе селекции для применения в процессе культивирования эукариотических клеток и для экспрессии целевого рекомбинантного продукта. Система селекции основана на введении гена экзогенного функционального связанного с мембраной фолатного рецептора вместе с полинуклеотидом или геном, кодирующим целевой продукт, в эукариотическую клетку и может широко использоваться в эукариотических клетках, клеточная жизнеспособность которых зависит от поглощения фолиевой кислоты.

Предпосылки создания изобретения

Селективные маркеры и системы селекции широко используются в генной инженерии, технологии рекомбинантных ДНК и при получении рекомбинантных продуктов, например антител, гормонов и нуклеиновых кислот, в культуре эукариотических клеток. Основная задача таких доминантных селективных маркеров и систем селекции заключается во введении селективного гена, который под воздействием селективных условий роста обеспечивает способность клеток к образованию высоких уровней целевых рекомбинантных продуктов.

В настоящее время известны 3 селективные маркерные системы:

(а) Глютаминсинтетазная система: фермент глютаминсинтетаза (ГС) ответственен за биосинтез глютамина из глютамата и аммония. Эта биосинтетическая реакция обеспечивает единственный путь образования глютамина в клетках млекопитающих. Соответственно, в отсутствие глютамина в питательной среде, фермент ГС необходим для выживания клеток млекопитающих в культуре. Важно, что определенные линии клеток млекопитающих, включая клетки миеломы мышей, не экспрессируют ГС и таким образом не могут выживать без экзогенно добавленного глютамина. Поэтому такая клеточная линия является соответствующим акцептором для трансфецированного гена ГС, который в этой системе может функционировать в качестве селективного маркера, который дает возможность клеткам расти в среде, не содержащей глютамина. Напротив, клеточные линии, например, широко используемые клетки яичников китайского хомячка (СНО), экспрессируют достаточное количество ГС, чтобы поддерживать рост в среде без глютамина. Поэтому, при использовании таких клеток СНО в качестве реципиентных клеток для тренсфекции гена ГС, можно использовать специфический и сильный ингибитор ГС метионинсульфоксимин (МСО), чтобы ингибировать эндогенную активность ГС для того, чтобы только трансфектанты, экспрессирующие высокие уровни трансфецированного гена ГС, могли выживать в среде без глютамина. Главным недостатком ГС системы является относительно длительное время (т.е. 2-6 месяцев) селективного роста для получения клеток, которые стабильно сверхэкспрессируют интересующий целевой ген. Другим недостатком является частое использование цитотоксического агента МСО для увеличения селективного давления. Присутствие такого цитотоксического агента вместе с целевым рекомбинантным продуктом (например, полипептидом, подобным антителу) может потребовать дополнительных стадий очистки, чтобы удалить этот цитотоксический агент.

(б) Система селекции на основе дигидрофолатредуктазы/метотрексата (МТ): дигидрофолатредуктаза (ДГФР) катализирует НАДФ-зависимое восстановление дигидрофолиевой кислоты до тетрагидрофолиевой кислоты (ТГФ). Затем ТГФ преобразуется в 10-формил-ТГФ и 5,10-метилен-ТГФ, которые используются в биосинтезе de novo пуринов и тимидилата, соответственно. ДГФ является побочным продуктом каталитической активности тимидилатсинтазы (ТС), которая катализирует конверсию dUMP в dTMP в 5,10-метилен-ТГФ-зависимой реакции. Таким образом, ДГФР играет важную роль в кругообороте кофакторов ТГФ, которые необходимы для биосинтеза пуриновых и пиримидиновых нуклеотидов, необходимых для репликации ДНК. Следовательно, клетки (например, клетки СНО), которые утрачивают ген ДГФР (т.е. путем направленной геномной делеции), могут использоваться в качестве реципиентов для трансфекции гена ДГФР в среде, которая не содержит нуклеотидов. После трансфекции, клетки можно подвергать воздействию постепенного повышения концентраций антифолата МТ, наиболее сильного ингибитора ДГФР (Kd - 1 пМ), таким образом, стимулируя клетки к выработке повышенных уровней ДГФР. При множественных циклах селекции, селективный маркер ДГФР часто подвергается значительной генной амплификации. Кроме того, мутантная мышиная ДГФР с существенной устойчивостью к МТ также может широко использоваться в качестве доминирующего селективного маркера, который заметно усиливает приобретение повышенного уровня МТ-устойчивости в трансфецированных клетках. Основной недостаток селективной системы ДГФР/ МТ заключается в том, что при этом способе используется мутагенный цитотоксический агент (МТ), который может легко изменять генотип реципиентных клеток. Кроме того, необходимо применять специфические меры безопасности, чтобы защитить людей, работающих с такими агентами. Это часто приводит к МТ-устойчивым клеточным популяциям, в которых отсутствует экспрессия целевого гена из-за утраты функциональных мутаций в переносчике восстановленных фолатов (RFC - reduced folate carrier) и/или потери экспрессии гена RFC, обе из которых нарушают поглощение МТ. Другой недостаток заключается в том, что мутагенный лекарственный препарат МТ может легко загрязнять выделяемый сверхэкспрессированный целевой продукт (например, полипептид, например, антитело), содержащийся в питательной среде, из-за чего требуется применение интенсивных, трудоемких и дорогостоящих хроматографических методов, чтобы избавиться от этого мутагенного соединения (МТ). Кроме того, отсутствие МТ в конечном продукте должно быть показано соответствующими анализами.

(в) Система селекции на основе переносчика восстановленных фолатов: переносчик восстановленных фолатов (RFC) представляет универсально экспрессируемый гликопротеин, который служит в качестве главного переносчика для поглощения восстановленных фолатов, например, 5-метил-ТГФ и 5-формил-ТГФ. Однако RFC проявляет очень слабое сродство к окисленному фолату, фолиевой кислоте. Поэтому клетки, у которых утрачена экспрессия RFC или у которых удален геномный локус RFC, могут служить в качестве реципиентов для трансфекции селективного маркерного гена RFC в условиях, при которых восстановленные фолаты, например 5-формил-ТГФ, постепенно изымаются из питательной среды, таким образом, стимулируя клетки к экспрессии повышенных уровней этого переносчика фолатов. Система селекции на основе RFC имеет несколько недостатков: а) Необходимо использовать реципиентные клетки без RFC, у которых эндогенный локус RFC «выбит» или инактивирован путем направленного нокаута или утраты функциональных мутаций, б) RFC обладает чрезвычайно слабым транспортным сродством для фолиевой кислоты и поэтому этот окисленный фолат нельзя использовать для селекции, в) В противоположность настоящей системе на основе фолатного рецептора, которая представляет однонаправленную систему поглощения фолата и которая будет подробно описана ниже, RFC является двунаправленным фолатным переносчиком, который показывает равносильные введение и выведение фолатов. Это означает, что при условиях недостатка фолата сверхэкспрессия RFC может оказаться вредной для реципиентных клеток, которые дополнительно экспортируют фолат посредством сверхэкспрессированного RFC.

Цель настоящего изобретения заключается в предоставлении новой метаболической системы селекции, которая имеет определенные преимущества над указанными выше системами селекции из предшествующего уровня техники. Новая система селекции основана на использовании фолатов в среде для культивирования клеток и на присутствии фолатных рецепторов, введенных посредством вектора экспрессии в рекомбинантную эукариотическую клетку, предназначенную для получения целевого продукта. Этот новый подход не требует делении гена эндогенного фолатного рецептора (FR). После введения вектора, несущего одновременно селективный ген FR и полинуклеотид, кодирующий целевой продукт (например, полипептид), клетки культивируют в селективной среде, содержащей крайне ограниченные концентрации фолатов. Поэтому только клетки, которые очевидно сверхэкспрессируют FR, могут потреблять фолаты, достаточные для устойчивого клеточного роста, репликации ДНК и клеточной пролиферации, таким образом, предоставляя возможность для сверхэкспрессии целевого продукта.

Окисленный фолат, т.е. фолиевая кислота, а также восстановленные производные фолиевой кислоты, известные в качестве восстановленных фолатов или тетрагидрофолатов (ТГФ), представляют группу витаминов В-9, которые являются необходимыми кофакторами и/или коферментами для биосинтеза пуринов, тимидилата и определенных аминокислот в эукариотических клетках, особенно клетках млекопитающих. Кофакторы ТГФ особенно необходимы для репликации ДНК и, следовательно, для клеточной пролиферации. В частности, кофакторы ТГФ функционируют в качестве доноров одноуглеродных единиц в ряде сцепленных метаболических путей, включая de novo биосинтез пуринов и тимидилата, аминокислот, а также метаболизме метиловой группы, включая метилирование CpG-островков ДНК. В частности, кофакторы ТГФ, включая 10-формил-ТГФ (10-СНО-ТГФ) поставляют одноуглеродные единицы в двух ключевых de novo реакциях формилтрансферазы, вовлеченных в de novo биосинтез пуринов. Первый фермент, глицинамидрибонуклеотидтрансформилаза (GARTF - glycinamide ribonucleotide transformylase), вовлечена в образование имидазольного кольца пуринов, а более нижняя по потоку реакция, опосредованная 5-аминоимидазол-4-карбоксамидрибонуклеотид-трансформилазой (AICARTF - 5-aminoimidazole-4-carboxamide ribonucleotide transformylase), приводит к образованию предшественника пурина инозин-5'-монофосфата (ИМФ). Последний служит в качестве ключевого предшественника АМФ и ГМФ. Более того, 5,10-метилен-ТГФ (5,10-СН2-ТГФ), является другим важным коферментом ТГФ, который функционирует в качестве ключевого кофактора для фермента тимидилатсинтазы (ТС). ТС катализирует образование тимидинмонофосфата (dTMP) из dUMP. Следовательно, эти фолат-зависимые ферменты являются ключевыми посредниками de novo в биосинтезе пуриновых и тиминовых нуклеотидов, необходимых для репликации ДНК. По существу, эти фолат-зависимые ферменты идентифицированы в качестве мишеней для действия антагонистов фолиевой кислоты, известных в качестве антифолатов. Например, аналог 4-аминофолиевой кислоты аминоптерин и его гомолог 4-амино-10-метилфолиевая кислота, метотрексат (МТ) были первым классом антиметаболитов, которые внедрены в клинику для терапевтического лечения детского острого лимфобластического лейкоза (ОЛЛ). В настоящее время антифолаты являются ключевыми компонентами различных химиотерапевтических режимов, используемых в настоящее время для лечения других злокачественных заболеваний человека, включая остеосаркому, рак молочной железы, первичную лейкому центральной нервной системы, хориокарциному и гестационную трофобластическую неоплазию.

В отличие от большинства прокариот, растения, грибы и определенные простейшие, которые синтезируют свои собственные фолаты, млекопитающие и другие эукариотические виды лишены биосинтеза кофактора ТГФ и поэтому должны получать их из экзогенных источников. В настоящее время известны три независимые транспортные системы, опосредующие поглощение фолатов и антифолатов в клетках млекопитающих:

а) Преобладающая клеточная транспортная система кофакторов восстановленных фолатов является переносчиком восстановленных фолатов (RFC - reduced folate carrier). Переносчик RFC (также известен в качестве представителя 1 семейства переносчиков растворенных веществ 19, SLC19A1) является повсеместно экспрессированным мембранным гликопротеином с молекулярной массой -85 кДа, функционирующим в качестве двунаправленного облегчающего переносчика, который опосредует восходящий транспорт восстановленных фолатов путем обмена органических фосфатов, например, адениновых нуклеотидов, которые, как известно, накапливаются до очень высоких внутриклеточных уровней, а также тиаминмоно- и пирофосфата. RFC проявляет высокую аффинность к кофакторам ТГФ, включая лейковорин (5-формил-ТГФ; Kt = 1 мкМ), в то же время имея только очень слабую транспортную аффинность (Kt = 200-400 мкМ) для фолиевой кислоты, окисленного фолата.

б) Другой способ потребления фолатов представляет протон-сопряженный фолатный переносчик (PCFT - proton-coupled folate transporter, также обозначаемый SLC46A), который недавно был клонирован. PCFT, который, по-видимому, экспрессируется независимо от RFC, оптимально функционирует при кислом значении рН (5,5) и опосредует приток обоих окисленных (например, фолиевой кислоты) и ТГФ кофакторов (т.е. восстановленных фолатов), а также различных гидрофильных антифолатов, включая МТ. PCFT, который показывает оптимальный транспорт фолатов и антифолатов при кислом значении рН (5,5), но не активен при физиологическом значении рН (7,4), играет ключевую роль в абсорбции обоих фолатов и антифолатов в верхнем отделе тонкой кишки.

в) В третьем способе транспорта, на котором основано настоящее изобретение, участвуют фолатные рецепторы (FR - folate receptor). FR являются высокоаффинными фолат-связывающими гликопротеинами, кодируемыми тремя различными генами FRα (FR альфа), FR(3 (FR бета) и FRγ (FR гамма). FRα (или FR-альфа) также известен в качестве фолат-связывающего белка взрослых (или FDP-Adult Folate Binding Protein), а также фолатного рецептора 1 или FOLR (у мышей folbpl), а также в качестве ассоциированного с раком яичника антигена (Ovarian cancer-Associated Antigen) или MOv 18. Рецептор FRJ3 (или FR бета) также известен в качестве рецептора FOLR2 (фетального) и в качестве рецептора FBP/PL-1 (плацентарного). FRγ (или FR гамма) также известен в качестве FOLR3 и в качестве FR-G (см. обзор M.D. Salazar и М. Ratnam, Cancer Metastasis Rev., 26(1), 2007, cc.141-152). Зрелые FR, которые хорошо охарактеризованы, являются гомологичными белками с -70-80% аминокислотной идентичностью и содержат от 229 до 236 аминокислот, а также от двух до трех N-гликозилированных участков. FRα (FR альфа) и FRp (FR бета) являются мембраносвязанными, в частности гликозилфосфатидилинозит (GPI-glycosylphosphаtidylinositol)-заякopeнными, гликопротеинами на поверхности клеток, причем FRγ лишен GPI-якоря и является секретируемым белком. FRα (FR альфа) и FRp (FR бета) проявляют высокую аффинность к фолиевой кислоте (Kd = 0,1-1 нМ), 5,10-дидеазатетрагидрофолиевой кислоте (5,10 dideazatetrahydrofolic acid - DDATHF; лометексол; Ki = 0,4-1,3 нМ, используя [3Н]фолиевую кислоту в качестве субстрата) и BGC945 (который является ингибитором тимидилатсинтазы на основе циклопента[g]хиназолина, специфически транспортируемым исключительно посредством FRα (FR альфа) и не транспортируемый посредством переносчика восстановленных фосфатов) (Kd=1 нМ), но гораздо меньшую аффинность к МТ (Kd>100 нМ). FR-зависимое поглощение фолатов и антифолатов происходит посредством классического механизма рецептор-опосредованного эндоцитоза. Исследования с использованием нокаута генов показали, что рецептор FRα (FR альфа) (также называемый у мышей Folbp 1) очень важен на стадии раннего эмбрионального развития, и материнское дополнение фолатов спасает от in utero эмбриональной летальности и дает возможность нормального развития плода.

В настоящее время существует потребность в надежной высоко эффективной и рентабельной системе отбора, которая преодолевает один или несколько недостатков известных в настоящее время селективных систем.

Краткое описание изобретения

Настоящее изобретение относится к эукариотическому вектору экспрессии, включающему первый полинуклеотид, кодирующий функциональный связанный с мембраной фолатный рецептор, и второй полинуклеотид, кодирующий целевой продукт.

Настоящее изобретение также относится к эукариотическим клеткам, у которых жизнеспособность клеток зависит от потребления фолиевой кислоты, и в которые устойчиво введен указанный вектор экспрессии таким образом, чтобы клетки экспрессировали функциональный фолатный рецептор, кодируемый этим вектором.

Кроме того, настоящее изобретение относится к способу отбора для получения рекомбинантной эукариотической клетки, способной стабильно экспрессировать с высоким выходом целевой продукт.

Настоящее изобретение может успешно применяться для получения с высоким выходом целевого продукта.

Подробное описание изобретения

В ходе настоящего изобретения неожиданно было обнаружено, что система отбора для получения рекомбинантных эукариотических клеток, способных вырабатывать целевой продукт, может основываться на ограниченной доступности фолата в среде для культивирования клеток. Эта система может применяться широко, т.е. по отношению к эукариотическим клеткам, у которых жизнеспособность зависит от потребления фолата.

Новая система может использоваться для ускоренного отбора, скрининга и создания клонов эукариотических клеток, например, клеток млекопитающих, которые стабильно экспрессируют сверхвысокие уровни рекомбинантных продуктов при отсутствии цитотоксических лекарственных препаратов. Кроме того, и в противоположность другим известным системам отбора, нет существенной потребности (хотя иногда допустимой) в модифицированных клетках, получаемых, например, путем мутации или нокаута эндогенного гена (генов). Поскольку, например, FRα (FR альфа) проявляет более высокую аффинность к ФК (КD=0,1 нМ), чем, например, RFC к лейковорину (Kt = 1 мкМ), и транспортирует фолиевую кислоту в клетки посредством однонаправленного пути, настоящее изобретение предусматривает применение FRα (FR альфа) и других фолатных рецепторов в качестве явно улучшенного основного метаболического селективного маркера, в частности, посредством постепенного . истощения фолатов (например, фолиевой кислоты) в питательной среде. Новая селекция на основе фолатов является успешной стратегией, которая пригодна для ускоренной и стабильной сверхэкспрессии на высоком уровне целевых белков в культивируемых клетках млекопитающих при отсутствии отбора на основе цитотоксических лекарственных препаратов, которая обычно применяется в различных системах сверхэкспрессии.

Новая система селекции проявляет несколько важных преимуществ по сравнению с известными в данной области доступными системами отбора.

1. Система отбора по настоящему изобретению представляет очень быстро действующую систему: в течение четырех недель истощения фолиевой кислоты можно легко получить производные от популяции клеток или клеточного клона, экспрессирующие целевой ген. Это отличается от указанной выше системы ГС, которая может потребовать 2-6 месячного отбора и стабилизации целевого гена.

2. Система отбора по настоящему изобретению не требует геномной делеции или ослабления эндогенных генов FRα (альфа), β (бета) или γ (гамма) перед трансфекцией и поэтому может применяться к любой реципиентной клетке, даже при некоторой экспрессии эндогенных генов FR. Это основное преимущество основано на том факте, что после трансфекции FRα (FR альфа) клетки могут подвергаться внезапному и сильному истощению фолатов (например, фолиевой кислоты) в питательной среде. В результате только трансфецированные клетки, которые экспрессируют значительные количества селективного маркера FRα (FR альфа), могут транспортировать достаточное количество фолата для устойчивой репликации ДНК и клеточной пролиферации. Это происходит при отсутствии какого-либо значительного повышения экспрессии эндогенного гена FRα (FR альфа). Это является отличием от указанной выше системы ДГФР/МТ, в которой у реципиентных клеток часто удален эндогенный ген ДГФР (например, клетки СНО DG44 и СНО Dux).

в) Система отбора по настоящему изобретению не нарушается из-за утраты строгости отбора из-за ослабления селективного давления через повышенную экспрессию других путей поглощения фолатов, включая повышенную экспрессию эндогенного RFC. Это важное преимущество обусловлено тем, что если FRα (FR альфа) имеет высокую аффинность к фолиевой кислоте (Kd = 0,1 нМ), RFC проявляет чрезвычайно слабое сродство к фолиевой кислоте (Km = 0,2-0,4 мМ). Напротив, другие различные системы отбора в предшествующем уровне техники, включая систему ДГФР/МТ, могут нарушаться из-за существенной утраты строгости отбора, поскольку в результате отбора по МТ могут часто возникать МТ-устойчивые клетки, которые не имеют или имеют слабую экспрессию селективного маркера. Взамен, утрата функции RFC часто приводит к частому механизму устойчивости к М первоначального транспортера МТ. Установлено, что это происходит из-за частого появления инактивирующих мутаций в гене RFC или серьезной потери экспрессии гена RFC.

г) В системе отбора по настоящему изобретению не используют цитотоксический лекарственный агент и/или мутагенное соединение, например, МТ в системе ДГФР или МСО в системе ГС, которые могут изменить генотип реципиентных клеток, а также исследуемого целевого гена. Скорее, FR отбор использует принцип недостаточности витамина в питательной среде.

Соответственно, одна из задач, решаемая в настоящем изобретении, относится к эукариотическому вектору экспрессии, включающему первый полинуклеотид, кодирующий функциональный связанный с мембраной фолатный рецептор (т.е. селективный маркерный ген), и второй полинуклеотид, кодирующий целевой продукт.

Функциональный связанный с мембраной фолатный рецептор по настоящему изобретению в частности характеризуется в качестве функционального связанного с мембраной рецептора, способного к однонаправленному импорту или поступлению фолата в эукариотическую клетку.

Фолат в соответствии с настоящим изобретением может быть либо окисленным фолатом (т.е. фолиевой кислотой), либо восстановленным фолатом. В общем, в настоящем изобретении может применяться такой фолат, который способен поступать в эукариотическую клетку посредством функционального связанного с мембраной фолатного рецептора. Предпочтительным примером окисленного фолата является фолиевая кислота. Предпочтительным примером восстановленного фолата являются 5-метилтетрагидрофолиевая кислота, 5-формилтетрагидрофолиевая кислота, 10-формилтетрагидрофолиевая кислота и 5,10-метилентетрагидрофолиевая кислота.

В предпочтительном варианте осуществления настоящего изобретения вектор экспрессии по настоящему изобретению способен к экспрессии в эукариотической клетке и функционального связанного с мембраной фолатного рецептора, и целевого продукта.

Целевой продукт, кодируемый вторым полинуклеотидом, может быть каким-либо биологическим продуктом, который может вырабатываться благодаря транскрипции, трансляции или какого-либо другого события экспрессии генетической информации, кодируемой вторым полинуклеотидом. В этом отношении, продукт будет являться продуктом экспрессии. Например, в предпочтительном варианте осуществления настоящего изобретения такой продукт выбирают из группы, состоящей из полипептида, РНК и ДНК. «Полипептид» относится к молекуле, включающей полимер из аминокислот, связанных вместе полипептидными связями (связью). Понятие «полипептид» включает полипептиды какой-либо длины, которые могут называться «белком» в случае более крупной молекулы (включающей, например, примерно более 50 аминокислот) или «пептидом», в случае меньшей молекулы (включающей, например, 2-49 аминокислот). Продукт может являться фармацевтически или терапевтически действующим соединением или инструментом исследования, используемым в анализах, и другим подобным соединением. В особенно предпочтительном варианте осуществления настоящего изобретения продукт является полипептидом, предпочтительно фармацевтически или терапевтически действующим полипептидом, или инструментом исследования, используемым в диагностических или других анализах, и другим подобным соединением. В наиболее предпочтительном варианте осуществления настоящего изобретения, полипептид является молекулой иммуноглобулина или антителом, или их фрагментом (особенно функциональным фрагментом), например химерным, или частично или полностью гуманизированным антителом. Такое антитело может представлять диагностическое антитело, или фармацевтически или терапевтически действующее антитело. Обычно целевой продукт может быть гетерологичным в отношении эукариотической клетки-хозяина, используемой для экспрессии, что означает, что до трансфекции клетка-хозяин не производит целевой продукт естественным образом или эндогенно. Точнее, чтобы получить продукцию или экспрессию целевого продукта, необходимо ввести в эукариотическую клетку-хозяина полинуклеотид, кодирующий интересующий продукт, в частности путем трансфекции вектором экспрессии по настоящему изобретению.

Вектор по настоящему изобретению может быть представлен в линейной форме или, предпочтительно, в кольцевой форме, например, в форме плазмиды.

Векторы, используемые для экспрессии целевого полинуклеотида, обычно содержат элементы контроля транскрипции, пригодные для проведения транскрипции, например, промоторы, энхансеры, сигналы полиаденилирования, сигналы транскрипционной паузы или терминации. Если целевым продуктом является белок, в вектор обычно включают соответствующие элементы контроля трансляции, например, 5' нетранслируемые области, ведущие к 5' кэп-структурам, пригодным для рекрутинга рибосом, и стоп-кодоны для остановки процесса трансляции. В частности, оба полинуклеотида, полинуклеотид, служащий в качестве селективного маркерного гена, а также полинуклеотид, кодирующий целевой продукт, могут транскрибироваться под контролем элементов транскрипции, присутствующих в соответствующих промоторах. Получаемые в результате транскрипты обоих генов, гена селективного маркера и гена, целевого продукта, содержат функциональные элементы трансляции, которые способствуют получению существенных уровней экспрессии белка (т.е. трансляции).

Таким образом, предпочтительный вариант осуществления настоящего изобретения относится к вектору экспрессии по настоящему изобретению, в котором первый полинуклеотид и второй полинуклеотид находятся под контролем отдельных промоторов транскрипции. В общем, пригоден промотор, способный стимулировать экспрессию, в особенности транскрипцию, первого и/или второго полинуклеотида в эукариотической клетке. В предпочтительном варианте осуществления настоящего изобретения, отдельные транскрипционные промоторы являются идентичными. В другом предпочтительном варианте осуществления настоящего изобретения отдельные транскрипционные промоторы являются различными. Предпочтительно, транскрипционные промоторы выбирают из группы, состоящей из промотора SV40, мышиного промотора цитомегаловируса (ЦМВ), промотора EF1 альфа, промотора RSV, промотора BROAD3, промотора rosa 26, промотора pCEFL и промотора β-актина. В предпочтительном варианте осуществления настоящего изобретения промотор, контролирующий транскрипцию первого полинуклеотида и/или второго полинуклеотида, является промотором ЦМВ или, наиболее предпочтительно, промотором SV40. В особо предпочтительном варианте осуществления настоящего изобретения промотор, контролирующий транскрипцию первого полинуклеотида, является промотором SV40.

В другом предпочтительном варианте осуществления настоящего изобретения в векторе экспрессии по настоящему изобретению первый полинуклеотид и второй полинуклеотид находятся под контролем общего промотора транскрипции. Предпочтительно такой промотор транскрипции выбран из группы, состоящей из промотора SV40, промотора ЦМВ, промотора RSV, промотора BROAD3, мышиного промотора rosa 26, промотора pCEFL и промотора β-актина. В другом предпочтительном варианте осуществления настоящего изобретения в вектора экспрессии общий транскрипционный промотор является промотором SV40. В еще одном предпочтительном варианте осуществления настоящего изобретения вектор экспрессии, имеющий такой общий промотор транскрипции, включает элемент IRES, функционально локализованный между первым полинуклеотидом и вторым полинуклеотидом.

Связанный с мембраной фолатный рецептор, который вводят в эукариотическую клетку-хозяина посредством вектора экспрессии, используемого в соответствии с настоящим изобретением, можно получить от какого-либо вида, если он будет функционировать в рамках настоящего изобретения, т.е. будет совместим с используемой эукариотической клеткой. Предпочтительно используют фолатный рецептор, полученный от вида млекопитающего, например полученный от грызуна, или, наиболее предпочтительно, фолатный рецептор человека. В общем, фолатный рецептор, вводимый в эукариотическую клетку-хозяина и используемый в качестве селективного Маркера, может быть гомологичным или гетерологичным эндогенному фолатному рецептору клетки-хозяина. Когда он гомологичен, его получают из того же вида, что и клетку-хозяина, и он может, например, быть идентичным эндогенному фолатному рецептору клетки-хозяина. Когда он является гетерологичным, его получают из другого вида, иного, чем вида, от которого получены клетки-хозяева, и таким образом он может отличаться от эндогенного фолатного рецептора клетки-хозяина. Обычно вводимый фолатный рецептор, используемый в качестве селективного маркера, может быть гетерологичным клетке-хозяину. Например, фолатный рецептор, полученный от человека, может использоваться в качестве селективного маркера для клеток-хозяев грызуна, например, клеток СНО.

Предпочтительно, функциональный связанный с мембраной фолатный рецептор, кодируемый первым нуклеотидом вектора экспрессии по настоящему изобретению, выбран из группы, состоящей из фолатного рецептора FRα (FR альфа), FRP (FR бета) и их функциональных мутантов. Функциональный мутант включает производное фолатного рецептора, которое функционирует физиологическим способом, т.е. способен поглощаться эукариотической клеткой и поддерживать жизнеспособность клетки через фолатный метаболизм клетки. Например, мутантная форма фолатного рецептора может включать одну или несколько аминокислотных мутаций по типу замещения, делеции и/или добавления, а также химическое производное, причем химическая часть, подобная полимеру, например, структуры полиэтиленгликоля (ПЭГ), присоединена к фолатному рецептору. Предпочтительно, фолатный рецептор, кодируемый первым полинуклеотидом, является фолатным рецептором альфа (hFRα) человека, фолатным рецептором бета (hFRP) человека или их функциональным мутантом. Наиболее предпочтителен фолатный рецептор альфа (hFRα) человека, предпочтительно имеющий следующую аминокислотную последовательность (SEQ ID NO 1, однобуквенный код, показанный в направлении от N-конца к С-концу):

MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS

Другой предпочтительный вариант осуществления настоящего изобретения относится к фолатному рецептору бета (hFRP) человека, имеющему следующую аминокислотную последовательность (SEQ ID NO 2, однобуквенный код, показанный в направлении от N-конца к С-концу):

MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQTWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG

В другом варианте осуществления настоящее изобретение относится к фолатному рецептору, который в своей естественной среде не связан с мембраной. Такой не связанный с мембраной рецептор можно видоизменить, чтобы связать с мембраной, например, предусматривая гибридный белок между не связанным с мембраной фолатным рецептором и трансмембранной областью другого полипептида. Также возможны другие мутантные формы, которые легко доступны квалифицированным специалистам в данной области. Предпочтительные примеры в этом отношении могут базироваться на растворимом фолатном рецепторе гамма (FRγ), предпочтительно растворимом фолатном рецепторе гамма (FRγ) человека. В наиболее предпочтительном варианте осуществления растворимый фолатный рецептор гамма (FRγ) человека может иметь следующую аминокислотную последовательность (SEQ ID NO 3, однобуквенный код, показанный в направлении от N-конца к С-концу):

MDMAWQMMQL LLLALVTAAG SAQPRSARAR TDLLNVCMNA KHHKTQPSPE DELYGQCSPW KKNACCTAST SQELHKDTSR LYNFNWDHCG KMEPTCKRHF IQDSCLYECS PNLGPWIRQV NQSWRKERIL NVPLCKEDCE RWWEDCRTSY TCKSNWHKGW NWTSGINECP AGALCSTFES YFPTPAALCE GLWSHSFKVS NYSRGSGRCI QMWFDSAQGN PNEEVAKFYA AAMNAGAPSR GIIDS

которая затем может быть генетически изменена или может быть получено ее производное для создания функционального связанного с мембраной фолатного рецептора, способного потреблять фолат в контексте настоящего изобретения.

В другом объекте настоящего изобретения вектор экспрессии по настоящему изобретению может дополнительно включать один или несколько других полинуклеотидов, кодирующих один или несколько дополнительных селективных маркеров. Соответственно, в предпочтительном варианте осуществления настоящего изобретения для его оптимального выполнения можно применять совместный отбор с применением фолатной системы по настоящему изобретению вместе с одной или несколькими различными системами селекции (например, неомицин/0418).

В другом объекте настоящее изобретение относится к эукариотической клетке, клеточная жизнеспособность которой зависит от поглощения фолата, и в которую стабильно введены первый полинуклеотид, локализованный на векторе экспрессии и кодирующий функциональный связанный с мембраной фолатный рецептор, и второй полинуклеотид, локализованный на векторе экспрессии и кодирующий интересующий продукт, причем первый полинуклеотид и второй полинуклеотид локализованы на одном и том же векторе экспрессии или на разных векторах экспрессии. В предпочтительном варианте осуществления настоящего изобретения функциональный связанный с мембраной фолатный рецептор и целевой продукт экспрессируются эукариотической клеткой.

Помимо функционального связанного с мембраной фолатного рецептора, введенного в клеточную линию посредством вектора экспрессии, эукариотическая клетка в соответствии с настоящим изобретением может включать по меньшей мере одну эндогенную однонаправленную функциональную фолатную транспортную систему, в частности один или несколько эндогенных функциональных связанных с мембраной фолатных рецепторов. Преимущество настоящего изобретения заключается в том, что способ отбора, представленный в настоящем описании ниже, может использоваться даже в присутствии такой эндогенной однонаправленной функциональной фолатной транспортной системы, т.е. там, где сохраняется такая эндогенная система. Соответственно, другой предпочтительный вариант осуществления изобретения относится к эукариотической клетке настоящего изобретения, включающей по меньшей мере одну эндогенную однонаправленную функциональную фолатную транспортную систему, в которой такая эндогенная однонаправленная функциональная фолатная транспортная система предпочтительно включает по меньшей мере один эндогенный функциональный связанный с мембраной фолатный рецептор. В предпочтительном варианте осуществления настоящего изобретения эндогенный функциональный связанный с мембраной фолатный рецептор выбран из группы, состоящей из фолатного рецептора альфа (FRα) и фолатного рецептора бета (FRP).

Другой предпочтительный вариант осуществления настоящего изобретения относится к эукариотической клетке по настоящему изобретению, в которой эндогенная однонаправленная функциональная фолатная транспортная система, например, включающая по меньшей мере один эндогенный функциональный связанный с мембраной фолатный рецептор, не имеет полной активности, т.е. является ослабленной. Такое ослабление можно обеспечить, например, посредством какого-либо типа мутагенеза рассматриваемой эндогенной фолатной транспортной системы, например, эндогенного функционального связанного с мембраной фолатного рецептора, например, путем точечной мутации, генного разрушения и т.п. Ослабление может быть частичным или полным. В последнем случае эукариотическая клетка по настоящему изобретению не включает эндогенную однонаправленную функциональную фолатную транспортную систему, например, эндогенный функциональный связанный с мембраной фолатный рецептор. Соответственно, в предпочтительном варианте осуществления настоящее изобретение относится к такой эукариотической клетке, в которую стабильно введен вектор экспрессии настоящего изобретения, и которая утратила полную активность, по меньшей, одного эндогенного функционального связанного с мембраной фолатного рецептора.

Что касается вектора экспрессии, вводимого в указанную клетку-хозяина, можно использовать какой-либо вектор экспрессии настоящего изобретения, включая его предпочтительные варианты осуществления, согласно настоящему описанию. В предпочтительном варианте осуществления настоящего изобретения в эукариотической клетке настоящего изобретения первый полинуклеотид, кодирующий функциональный связанный с мембраной фолатный рецептор, и второй полинуклеотид, кодирующий целевой продукт, локализованы на одном и том же векторе экспрессии. Предпочтительно такой вектор экспрессии является вектором экспрессии по настоящему изобретению, т.е. описанным в настоящем изобретении.

Эукариотическая клетка в соответствии с настоящим изобретением предпочтительно выбрана из группы, состоящей из клетки млекопитающего, клетки насекомого, растительной клетки и грибной клетки. Что касается грибных клеток и растительных клеток, которые обычно являются прототрофами в отношении фолатов (т.е. такие клетки могут автономно синтезировать свои собственные фолаты, необходимые для их клеточной жизнеспособности, т.е. клеточного роста и пролиферации). Настоящее изобретение охватывает в частности такие грибные и растительные клетки, которые могут стать ауксотрофами в отношении фолатов. Это может произойти, например, благодаря генетическим манипуляциям, т.е. клетки станут неспособными синтезировать достаточные количества фолатов, необходимых для их клеточной жизнеспособности. Например, способность таких грибных или растительных клеток эндогенно биосинтезировать фолаты, например, посредством соответствующего метаболического пути, будет инактивирована, например, путем генного разрушения или генного сайленсинга соответствующих генов-мишеней, или путем ингибирования ключевых ферментов и т.д.

В предпочтительном варианте осуществления настоящего изобретения эукариотическая клетка является клеткой млекопитающего. Предпочтительно такая клетка млекопитающего выбрана из группы, состоящей из клетки грызуна, клетки человека и клетки обезьяны. Особо предпочтительна клетка грызуна, которая предпочтительно выбрана из группы, состоящей из клетки СНО, клетки ВНК, клетки NS0, мышиной фибробластной клетки 3Т3 и клетки SP2/0. Особо предпочтительной клеткой грызуна является клетка СНО. Также предпочтительна клетка человека, которая, предпочтительно выбрана из группы, состоящей из клетки НЕК293, клетки MCF-7, клетки РекС6 и клетки HeLa. Также предпочтительна клетка обезьяны, которая предпочтительно выбрана из группы, состоящей из клетки COS-1, клетки COS-7 и клетки Vero.

В другом варианте осуществления настоящее изобретение относится к способу получения эукариотической клетки по настоящему изобретению, который включает получение эукариотической клетки, у которой клеточная жизнеспособность зависит от потребления фолатов, и введение первого полинуклеотида, локализованного на векторе экспрессии и кодирующего функциональный связанный с мембраной фолатный рецептор, и второго полинуклеотида, локализованного на векторе экспрессии и кодирующего целевой продукт, причем первый полинуклеотид и второй полинуклеотид локализованы на одном и том же векторе экспрессии, который, в наиболее предпочтительном варианте осуществления, является вектором экспрессии в соответствии с настоящим изобретением, т.е. описанным в настоящем изобретении.

Еще один объект настоящего изобретения относится к способу отбора эукариотической клетки, способной стабильно экспрессировать целевой продукт, кодируемый вектором экспрессии, который вводится в клетку, включающему:

(i) получение множества эукариотических клеток, у которых клеточная жизнеспособность зависит от потребления фолатов, и в которые введены первый полинуклеотид, локализованный на векторе экспрессии и кодирующий функциональный связанный с мембраной фолатный рецептор, и второй полинуклеотид, локализованный на векторе экспрессии и кодирующий целевой продукт, причем первый полинуклеотид и второй полинуклеотид локализованы на одном и том же векторе экспрессии или на разных векторах экспрессии,

(ii) культивирование указанного множества эукариотических клеток в клеточной культуральной среде, имеющей ограниченную концентрацию фолата, таким образом, получая эукариотическую клетку, в которой достигается стабильная экспрессия интересующего продукта. В принципе, такой фолат может являться окисленным фолатом или восстановленным фолатом. Предпочтителен окисленный фолат, который, в частности, представлен фолиевой клеткой.

Что касается ограниченного количества фолата, квалифицированный специалист в данной области может установить соответствующую концентрацию в среде в соответствии с потребностями клетки-хозяина и строгости условий отбора, которые будут применены. В случае, когда используется в качестве фолата фолиевая кислота, например, с клеткой-хозяином СНО, соответствующая концентрация фолиевой кислоты в клеточной культуральной среде для строгого процесса селекции может составлять примерно 100 нМ или меньше, предпочтительно примерно 30 нМ или меньше, или примерно 10 нМ или меньше. Например, соответствующая концентрация фолиевой кислоты может иметь какое-либо значение в диапазоне 0,001 нМ - 100 нМ, предпочтительно в диапазоне 0,01 нМ - 100 нМ, более предпочтительно в диапазоне 0,1 нМ - 100 нМ или в диапазоне 1 нМ - 100 нМ. Также предпочтителен диапазон 0,001 пМ - 30 нМ, диапазон 0,01 нМ - 30 нМ, диапазон 0,1 нМ - 30 нМ, диапазон 1 нМ - 30 нМ или диапазон 3 нМ - 10 нМ. Например, пригодная для отбора концентрация фолиевой кислоты в клеточной культуральной среде может составлять 1 нМ, 3 нМ, 10 нМ или 30 нМ.

В том случае, когда в процессе селекции будет использоваться восстановленный фолат, подобный лейковорину, его концентрацию квалифицированный специалист в данной области также может установить в соответствии с потребностями клетки-хозяина и строгости условий селекции, которые будут использоваться. Такая концентрация лейковорина в клеточной культуральной среде может находиться например в диапазоне 0,2-2 нМ для точного процесса селекции.

В предпочтительном варианте осуществления настоящего изобретения способ селекции также включает идентификацию и выделение эукариотической клетки, в которой достигается стабильная экспрессия целевого продукта.

В наиболее предпочтительном варианте осуществления способа селекции множество эукариотических клеток составляют эукариотические клетки по настоящему изобретению, т.е. описанные в настоящем изобретении.

В предпочтительных вариантах осуществления указанного объекта настоящего изобретения, описанных в настоящем описании, также представлены предпочтительные варианты осуществления в частности, в отношении эукариотической клетки и вектора экспрессии.

Еще один вариант осуществления настоящего изобретения относится к способу получения целевого продукта, включающему:

(i) проведение способа селекции по настоящему изобретению, т.е. в соответствии с настоящим описанием,

(ii) и выделение целевого продукта из указанной клеточной культуральной среды или из указанной клетки.

Кроме того, объекты предпочтительных вариантов осуществления настоящего изобретения, описанные в настоящем описании, в частности, в отношении эукариотической клетки и вектора экспрессии.

Целевой продукт, например полипептид, вырабатываемый в соответствии с настоящим изобретением, можно выделить, дополнительно очистить и изолировать с помощью известных в данной области методов. Например, полипептид можно выделить из питательной среды традиционными методами, включая, но ими не ограничиваясь, центрифугирование, фильтрацию, ультрафильтрацию, экстракцию или осаждение. Очистку можно проводить различными известными в данной области способами, включая, но ими не ограничиваясь, хроматографию (например, ионообменную, аффинную, гидрофобную, хроматофокусировку и эксклюзионную), электрофоретические методы (например, препаративную изоэлектрическую фокусировку), дифференциальное растворение (например, осаждение сульфатом аммония) или экстракцию.

Еще один объект настоящего изобретения относится к применению функционального связанного с мембраной фолатного рецептора в качестве селективного маркера для отбора эукариотической клетки, у которой клеточная жизнеспособность зависит от потребления фолата, и которая способна стабильно экспрессировать целевой продукт. В рамках предпочтительного варианта осуществления такого применения, фолатный рецептор выбирают из группы, состоящей из фолатного рецептора альфа (FRα), фолатного рецептора бета (FRβ) и их функционального мутанта. Предпочтительно, фолатные рецепторы, используемые в указанном объекте настоящего изобретения, являются соответствующими фолатными рецепторами человека, при этом предпочтителен рецептор фолиевой кислоты альфа (FRα) человека. В настоящем описании представлены другие предпочтительные варианты осуществления указанного объекта настоящего изобретения, в частности, в отношении эукариотической клетки и вектора экспрессии.

Полное содержание текстов и документов, которые упоминаются в настоящем изобретении, включены в настоящее описание в качестве ссылок.

Последующие примеры предназначены для иллюстрации настоящего изобретения, без какого-либо ограничения его области охвата. В частности, примеры относятся к предпочтительным вариантам осуществления настоящего изобретения.

Примеры

Все материалы, упоминаемые в настоящем изобретении, например, реагенты, хорошо знакомы квалифицированным специалистам, коммерчески доступны и могут использоваться в соответствии с инструкциями производителей.

Пример 1. Высокий уровень экспрессии рекомбинантного антитела при использовании селективной системы на основе фолатного рецептора Пример 1.1. Векторы экспрессии

Для исследования эффективности отбора hFRальфа (hFRα)-трансфецированных клеток в условиях ограниченных концентраций фолата, т.е. фолиевой кислоты, в культуральной среде, создают плазмидный вектор (т.е. тест-вектор), пригодный для экспрессии в эукариотических клетках, в частности в клетках СНО, содержащий одновременно (i) кассету экспрессии, которая включает полинуклеотид, кодирующий тяжелую и легкую цепи секретируемого рекомбинантного антитела человека типа IgGl, и (ii) отдельную кассету экспрессии, которая включает полинуклеотид, кодирующий рецептор фолиевой кислоты альфа (hFRα) человека в качестве селективного гена-маркера. Экспрессия рецептора фолиевой кислоты альфа (hFRα) человека находится под контролем промотора SV40 и стандартного (SV40) сигнала полиаденилирования. Экспрессия рекомбинантного антитела находится под контролем промотора ЦМВ и стандартного (SV40) сигнала полиаденилирования. В качестве контроля (т.е. контрольного вектора), используют близкий вектор экспрессии, кодирующий то же самое антитело, утративший кассету экспрессии hFRальфа (hFRα), но содержащий в качестве селективного маркера ген неомицинфосфотрансферазы.

Пример 1.2. Клетки и условия культивирования

Клетки яичников китайских хомячков, полученные от штамма СНО-К1, поддерживают в условиях суспензионной культуры в соответствующей химически определенной питательной среде, содержащей 2,3 мкМ фолиевой кислоты.

Для анализа зависимости выживаемости клеток от фолиевой кислоты, проводят эксперимент с голоданием по фолиевой кислоте, используя концентрации фолиевой кислоты в диапазоне от 2300 нМ до 0,1 нМ. Клетки культивируют в такой среде и анализируют клеточную жизнеспособность, чтобы определить процент выживших клеток. В таблице 1 суммированы результаты, полученные с вышеуказанной клеточной линией СНО-К1.

Таблица 1
Выживание клеток СНО при различных концентрациях фолиевой кислоты
Концентрация ФК [нМ] Процент выживания
0,1 2,08
1 2,45
3 2
10 2,7
30 6,8
100 55,5
300 88,6
1000 100,8
2300 100

Приведенные результаты показывают, что для такой специфической линии клеток-хозяев концентрации фолиевой кислоты ниже 100 нМ, предпочтительно ниже 30 нМ, применимы для создания значительного селективного давления для отбора на основе рецептора фолиевой кислоты стабильно трансфецированных клеток.

Пример 1.3. Трансфекция и отбор

Клетки трансфецируют путем электропорации либо тест-вектором, содержащим кассету экспрессии hFRальфа (hFRα), либо контрольным вектором без hFRальфа (hFRα). Затем трансфецированные клетки выращивают в условиях суспензионной культуры в 125 мл качалочых колбах в среде с добавлением соответствующей концентрации глютамина и 2,3 мкМ фолиевой кислоты. Спустя сорок восемь часов после трансфекции клетки переносят в среду, содержащую ограниченное количество фолиевой кислоты, а именно 10 нМ или 1 нМ фолиевой кислоты, для инициации отбора в соответствии с настоящим изобретением в 24-луночных планшетах, для образцов, трансфецированных тест-вектором. Дополнительно, отбирают клетки, трансфецированные контрольной плазмидой, путем добавления селективного агента, а именно 0,8 мг/мл G418, к среде, содержащей 2,3 мкМ фолиевой кислоты (т.е. контроль 1), или культивируют при отсутствии какого-либо отбора (т.е. контроль 2). Клетки, которые успешно получены в результате этой схемы отбора, переносят в 6-луночные планшеты и затем размножают в качалочных колбах для анализа у них уровней выработки антитела.

Пример 1.4: Анализ выработки антител

Для анализа уровней экспрессии антител из трансфецированных и лишенных фолиевой кислоты клеточных популяций готовят в качалочных колбах сверхплотные культуры клеток. Клетки высевают при плотности 2×105 клеток/мл в среду, содержащую 2,3 мкМ фолиевой кислоты, и инкубируют в условиях суспендируемой культуры (т.е при встряхивании). На 14-е сутки собирают супернатант клеточной культуры и анализируют уровни антител, используя метод ВЭЖХ с белком А, т.е. аффинный тип очистки. Молекулы IgG специфически связываются на колонке, главным образом посредством их Fc-части, но другие белки проходят через колонку без взаимодействия с носителем. Захваченные белки IgG элюируют с колонки при низких значениях рН, определяют количество посредством измерения УФ-поглощения и при необходимости проводят дальнейшую очистку и выделение.

Пример 1.5: Результаты

Цель описанного подхода состоит в подтверждении справедливости концепции, заключающейся в том, что фолатный ген, в частности ген пРКальфа (hFRα), может служить в качестве селективного маркера в условиях истощения фолатов, таким образом, позволяя отбирать клетки, которые одновременно сверхэкспрессируют целевой продукт, например, моноклональное антитело. В качестве контроля также используют вектор, содержащий в качестве селективного маркера ген устойчивости к неомицину. После трансфекции клетки подвергают строгому отбору путем внезапного уменьшения концентраций фолиевой кислоты в среде с 2,3 мкМ до 10 нМ или 1нМ. Клетки, трансфецированные плазмидой, несущей рецептор фолиевой кислоты, легко восстанавливаются в условиях фолатного недостатка и могут быть в дальнейшем размножены в селективной среде. Напротив, в случае контрольного вектора концентрацию фолиевой кислоты оставляют неизменной, но применяют либо селективное давление с G418, либо совсем не применяют селективного давления. У отобранных клеточных популяций затем анализируют выработку антител, используя чрезмерно выросшие (т.е. сверхплотные) суспензионные (т.е. встряхиваемые в колбах) культуры в среде, содержащей 2,3 мкМ фолиевой кислоты. Затем на 14-е сутки определяют концентрацию антитела в культуральной среде. Ниже в табл. 14 показано, что клетки, трансфецированные плазмидой, содержащей рецептор фолиевой кислоты, и отобранные путем уменьшения содержания фолиевой кислоты, сверхэкспрессируют рекомбинантное антитело. Количество антитела, образуемого этими популяциями трансфецированных клеток, выше относительно клеток, трансфецированных контрольным вектором и отобранных с антибиотика G418. Что касается другого контроля, когда не применяют селективного давления, получают клетки, не образующие антитела. Эти данные подтверждают концепцию, что данный подход на основе гена рецептора фолиевой кислоты в качестве автономного доминантного метаболического селективного маркера, можно легко применять для быстрого обнаружения клеток, сверхэкспрессирующих целевой рекомбинантный продукт.

Таблица 2
Фолиевой кислоты: концентрация фолиевой кислоты в среде на протяжении отбора; CG418: концентрация G418 в среде на протяжении отбора; СmАb: концентрация секретируемого антитела в среде у культур с избыточным ростом)
Вектор Сфолиевой кислоты CG4I8
(нМ) (мг/мл) (мг/л)
Тест-вектор 10 нет 25
(hFRальфа(hFRα)) 1 нет 24
Контрольный вектор (неомицин) 2300 0,8 8
2300 нет 0

Пример 2. Повышение уровней выработки рекомбинантного антитела в качестве функции снижения концентрации фолиевой кислоты в питательной среде

Пример 2.1. Вектор экспрессии

Получают плазмидный вектор (т.е. тест-вектор), описанный в примере 1.1.

Пример 2.2. Клетки и условия роста

Клетки яичников китайского хомячка, которые являются производными штамма СНО-К1, поддерживают в условиях монослойной культуры в химически определенной питательной среде RPMI-1640, содержащей 2,3 мкМ фолиевой кислоты. Клетки лишают активности переносчика RFC, согласно описанию в других источниках (Y.G. Assaraf и R.T. Schimke, Proc. Natl. Acad. Sci. USA, 84, 1987, cc. 7154-7158; L. Rothem и др., Mol. Pharmacol., 68, cc. 616-624). Такие RFC-дефектные клетки используют, чтобы избежать потенциального обходного пути голодания по фолиевой кислоте посредством такой добавочной системы переносчика в настоящем примере.

Пример 2.3. Трансфекция и отбор

RFC-недостаточные клетки С15 трансфецируют тест-вектором путем электропорации. Спустя сорок восемь часов после трансфекции клетки размножают в среде, не содержащей фолиевой кислоты, обогащенной 30 нМ фолиевой кислоты для стимуляции экспрессии и селективного маркера, и рекомбинантного антитела, а впоследствии подвергают клонированию методом разведений. Клетки разводят до конечной плотности 5 клеток/мл и эту суспензию вносят по 100 мкл/лунку в 96-луночные планшеты (т.е. 0,5 клеток/лунку). Затем клоны поддерживают в среде, содержащей 0,25 нМ фолиевой кислоты и 500 мкг/мл G418. Чтобы обеспечить оптимальное проведение процесса отбора, применяют совместный отбор, используя фолатную систему по настоящему изобретению вместе с дополнительной системой селекции (т.е. неомицин/0418). Затем клоны с наивысшими уровнями выработки антитела выращивают при низких концентрациях фолиевой кислоты (т.е. 1200 пикоМ, 600 пикоМ и 60 пикоМ) для дальнейшей поддержки и адаптирования сверхэкспрессии антитела. Это подтверждают дальнейшим анализом экспрессии антитела в различных клонах.

Пример 2.4: Анализ выработки антитела

Анализ выработки антитела проводят по принципу, изложенному выше в примере 1.4. Концентрацию секретируемого антитела подвергают мониторингу, используя иммуноферментный анализ ELISA по следующей схеме: микропланшеты Maxisorp покрывают антителом против IgG человека. После этого блокируют буфером, содержащим бычий сывороточный альбумин (БСА), и несколько раз промывают, добавляют многократные разведения образцов секретируемого антитела. Затем добавляют второе антитело, конъюгированное с пероксидазой, состоящее из козьего антитела против IgG человека и пероксидазы. В заключение добавляют специфичный для пероксидазы колориметрический субстрат, после которого в каждой лунке спектрофотометрически определяют получающуюся в результате концентрацию красителя и затем сравнивают со стандартными концентрациями известных концентраций IgG.

2.5. Результаты

Согласно результатам, показанным ниже в табл. 2, уровни выработки рекомбинантного антитела четко коррелируют с уровнями недостатка фолиевой кислоты. Таким образом,, уровни выработки антитела повышаются при понижении в среде концентрации фолиевой кислоты. Кроме того, эти результаты подтверждают концепцию, что ген ЬРЯальфа (hFRα) является эффективным селективным маркером, который можно применять для сверхэкспрессии рекомбинантных белков в условиях недостатка фолатов.

Таблица 3
Фолиевой кислоты: концентрация фолиевой кислоты в среде; СmAb'- концентрация секретируемого антитела в среде)
Сфолиевой кислоты (nМ) СmАb (МКГ/Л)
60 216±30
600 138±15
1200 19±8

1. Эукариотический вектор экспрессии для экспрессии целевого рекомбинантного продукта в клетке млекопитающего, включающий первый полинуклеотид, кодирующий функциональный связанный с мембраной фолатный рецептор в качестве селективного маркера, и второй полинуклеотид, кодирующий целевой продукт, который рекомбинантно экспрессируется, где целевой продукт является фармацевтически активным, терапевтически активным или диагностическим полипептидом, и где функциональный связанный с мембраной фолатный рецептор и целевой продукт экспрессируются с указанного вектора экспрессии.

2. Вектор экспрессии по п.1, в котором первый полинуклеотид и второй полинуклеотид находятся под контролем отдельных промоторов транскрипции.

3. Вектор экспрессии по п.2, в котором промоторы транскрипции являются одинаковыми.

4. Вектор экспрессии по п.2, в котором промоторы транскрипции различны.

5. Вектор экспрессии по любому из пп.2-4, в котором промотором, контролирующим транскрипцию первого полинуклеотида, является промотор SV40.

6. Вектор экспрессии по п.1, в котором первый полинуклеотид и второй полинуклеотид находятся под контролем общего промотора транскрипции.

7. Вектор экспрессии по п.6, в котором общим промотором транскрипции является промотор SV40.

8. Вектор экспрессии по п.6, в котором указанный вектор включает элемент IRES, функционально локализованный между первым полинуклеотидом и вторым полинуклеотидом.

9. Вектор экспрессии по п.1, в котором функциональный связанный с мембраной фолатный рецептор, кодируемый первым полинуклеотидом, выбран из группы, состоящей из фолатного рецептора альфа (FRα), фолатного рецептора бета (FRβ) и их функционального мутанта.

10. Вектор экспрессии по п.9, в котором функциональный связанный с мембраной фолатный рецептор, кодируемый первым полинуклеотидом, является фолатным рецептором альфа (hFRα) человека.

11. Клетка млекопитающего для продуцирования целевого рекомбинантного продукта, причем клеточная жизнеспособность указанной клетки зависит от потребления фолата, и в которую стабильно введены первый полинуклеотид, локализованный на векторе экспрессии и кодирующий функциональный связанный с мембраной фолатный рецептор, и второй полинуклеотид, локализованный на векторе экспрессии и кодирующий целевой продукт, в которой первый полинуклеотид и второй полинуклеотид локализованы на одном и том же векторе экспрессии или на отдельных векторах экспрессии, и где функциональный связанный с мембраной фолатный рецептор и целевой продукт рекомбинантно экспрессируются клеткой млекопитающего, и где целевой продукт представляет собой фармацевтически активный, терапевтически активный или диагностический полипептид.

12. Клетка млекопитающего по п.11, причем указанная клетка утрачивает полное действие по меньшей мере одного эндогенного функционального связанного с мембраной фолатного рецептора.

13. Клетка млекопитающего по п.11 или 12, в которой указанный первый полинуклеотид, кодирующий функциональный связанный с мембраной фолатный рецептор, и указанный второй полинуклеотид, кодирующий целевой продукт, локализованы на одном и том же векторе экспрессии.

14. Клетка млекопитающего по п.11, в которой вектором экспрессии является вектор, описанный по одному из пп.1-10.

15. Клетка млекопитающего по п.11, в которой указанная клетка млекопитающего является клеткой грызуна.

16. Клетка млекопитающего по п.15, в которой указанная клетка грызуна является клеткой СНО.

17. Способ получения клетки млекопитающего по любому из пп.11-16, включающий получение клетки млекопитающего, клеточная жизнеспособность которой зависит от потребления фолата, и введение первого полинуклеотида, локализованного на векторе экспрессии и кодирующего функциональный связанный с мембраной фолатный рецептор, и второго полинуклеотида, локализованного на векторе экспрессии и кодирующего целевой продукт, в котором первый полинуклеотид и второй полинуклеотид локализованы на одном и том же векторе экспрессии или на отдельных векторах экспрессии.

18. Способ по п.17, в котором первый полинуклеотид и второй полинуклеотид локализованы на одном и том же векторе экспрессии.

19. Способ по п.18, в котором вектором экспрессии является вектор по любому из пп.1-10.

20. Способ отбора клетки млекопитающего, способной стабильно экспрессировать целевой продукт, кодируемый вектором экспрессии, который введен в клетку, включающий:
(i) получение множества клеток млекопитающих, клеточная жизнеспособность которых зависит от потребления фолатов, и в которые введены первый полинуклеотид, локализованный на векторе экспрессии и кодирующий функциональный связанный с мембраной фолатный рецептор, и второй полинуклеотид, локализованный на векторе экспрессии и кодирующий целевой продукт, причем первый полинуклеотид и второй полинуклеотид локализованы на одном и том же векторе экспрессии или на отдельных векторах экспрессии,
(ii) культивирование указанного множества клеток млекопитающего в среде для культивирования клеток, имеющей ограниченную концентрацию фолата, таким образом получая клетку млекопитающего, в которой достигается стабильная экспрессия целевого продукта.

21. Способ по п.20, дополнительно включающий идентификацию и выделение клетки млекопитающего, в которой достигается стабильная экспрессия интересующего продукта.

22. Способ по п.20 или 21, в котором множество клеток млекопитающего включает клетки млекопитающего по любому из пп.11-16.

23. Способ получения целевого рекомбинантного продукта, включающий:
(i) осуществление способа отбора по любому из пп.20-22, и
(ii) выделение целевого продукта из указанной клеточной культуральной среды или из указанной клетки.

24. Применение функционального связанного с мембраной фолатного рецептора, который вводится через вектор экспрессии, в качестве селективного маркера для отбора клетки млекопитающего, жизнеспособность которой зависит от потребления фолата, и которая при этом способна стабильно экспрессировать целевой рекомбинантный продукт, где целевой продукт представляет собой фармацевтически активный, терапевтически активный или диагностический полипептид.

25. Применение по п.24, причем фолатный рецептор выбран из группы, состоящей из фолатного рецептора альфа (FRα), фолатного рецептора бета (FRβ) и их функционального мутанта.

26. Применение по п.25, причем фолатный рецептор является человеческим фолатным рецептором альфа (hFRα) человека.



 

Похожие патенты:

Группа изобретений относится к области биотехнологии. Вектор экспрессии содержит: (a) ориджин репликации OriP, полученный из вируса Эпштейна-Барр (EBV), где ориджин репликации содержит: 1) элемент симметрии второго порядка (DS); и 2) участок дупликации (FR), который содержит участок связывания EBNA; (b) ориджин репликации SV40; (c) участок инсерции для вставки представляющего интерес гена; (d) промотор EF-1б, функционально связанный с участком инсерции; (e) сигнал поли-A; (f) бактериальный ориджин репликации; (g) селектируемый маркер; и необязательно содержащий (h) последовательность нуклеиновой кислоты, кодирующую константную область тяжелой или легкой цепи антитела, функционально связанную с участком инсерции.

Изобретение относится к области биотехнологии и может быть использовано для получения тканевого активатора плазминогена человека. Рекомбинантной плазмидной ДНК рВК415, кодирующей полипептид с последовательностью тканевого активатора плазминогена человека, включающей также MAR - область прикрепления к ядерному матриксу гена лизоцима птиц, усилитель транскрипции вируса CMV, внутренний сайт инициации трансляции IRES вируса энцефаломиокардита, ген DHFR мыши, сигнал полиаденилирования вируса SV40, ген аминогликозид-3'-фосфотрансферазы, обеспечивающей устойчивость к генетицину (Neo) и кассету для экспрессии в клетках бактерий гена β-лактамазы, обеспечивающей устойчивость к ампицилину, трансформируют клетки линии Cricetulus griseus CHO DHFR(-) с получением линии клеток Cricetulus griseus CHO 1F8, продуцирующей рекомбинантный белок тканевого активатора плазминогена со стабильно высоким выходом на уровне до 190 мг/л.

Изобретение относится к области биотехнологии и может быть использовано для получения рекомбинантного фактора свертываемости крови IX человека (hFIX). Рекомбинантная плазмидная ДНК рАК380, содержащая ген белка rhFIX, MAR - область прикрепления к ядерному матриксу гена лизоцима птиц, усилитель транскрипции вируса CMV, внутренний сайт инициации трансляции IRES вируса энцефаломиокардита, ген DHFR мыши, сигнал полиаденилирования вируса SV40, ген аминогликозид-3'-фосфотрансферазы для устойчивости к генетицину (Neo), кассету для экспрессии в клетках бактерий гена β-лактамазы для устойчивости к ампицилину, используется для получения рекомбинантного фактора hFIX в клетках линии Cricetulus griseus CHO 1E6.

Настоящее изобретение относится к области иммунологии. Предложено антитело, специфично связывающее сегмент M1' IgE и которое индуцирует апоптоз в экспрессирующих IgE В-клетках, и его антигенсвязывающий фрагмент.

Изобретение относится к области биохимии, в частности к способу синтеза целевого белка с пониженным ксилозилированием, пониженным фукозилированием или их комбинацией.

Изобретение относится к области биотехнологии, конкретно к бис-Met-гистонам, и может быть использовано в медицине. Молекула нуклеиновой кислоты кодирует полипептид, состоящий из двух остатков метионина в качестве первого и второго N-концевых аминокислотных остатков, соединенных через пептидную связь со зрелым эукариотическим гистоном.

Изобретение относится к области биотехнологии и касается химерного белка, нуклеиновой кислоты, кодирующей такой белок, кассеты экспрессии и эукариотической клетки-хозяина.

Группа изобретений относится к области белковой инженерии, молекулярной биологии растений и борьбы с вредителями и касается гибридного инсектицидного белка и его применений.

Настоящее изобретение относится к области иммунологии. Предложено гуманизированное моноклональное антитело против CD19 человека, полученное из антитела HB12B, и его фрагмент, охарактеризованные через аминокислотные последовательности вариабельных доменов.

Изобретение относится к области биохимии, в частности к пептиду со способностью связываться со скурфином и ингибировать биологическую активность скурфина, который выбран из пептида, состоящего из аминокислотной последовательности Arg-Asp-Phe-Gln-Ser-Phe-Arg-Lys-Met-Trp-Pro-Phe-Phe-X, где Х отсутствует или Х присутствует и представляет собой X14 или X14-X15, где X14 и X15 независимо друг от друга обозначают аминокислоту, варианта указанного пептида и его фармацевтически приемлемой соли.

Изобретение относится к области биотехнологии и может быть использовано для получения тканевого активатора плазминогена человека. Рекомбинантной плазмидной ДНК рВК415, кодирующей полипептид с последовательностью тканевого активатора плазминогена человека, включающей также MAR - область прикрепления к ядерному матриксу гена лизоцима птиц, усилитель транскрипции вируса CMV, внутренний сайт инициации трансляции IRES вируса энцефаломиокардита, ген DHFR мыши, сигнал полиаденилирования вируса SV40, ген аминогликозид-3'-фосфотрансферазы, обеспечивающей устойчивость к генетицину (Neo) и кассету для экспрессии в клетках бактерий гена β-лактамазы, обеспечивающей устойчивость к ампицилину, трансформируют клетки линии Cricetulus griseus CHO DHFR(-) с получением линии клеток Cricetulus griseus CHO 1F8, продуцирующей рекомбинантный белок тканевого активатора плазминогена со стабильно высоким выходом на уровне до 190 мг/л.

Изобретение относится к области биотехнологии и может быть использовано для получения рекомбинантного фактора свертываемости крови IX человека (hFIX). Рекомбинантная плазмидная ДНК рАК380, содержащая ген белка rhFIX, MAR - область прикрепления к ядерному матриксу гена лизоцима птиц, усилитель транскрипции вируса CMV, внутренний сайт инициации трансляции IRES вируса энцефаломиокардита, ген DHFR мыши, сигнал полиаденилирования вируса SV40, ген аминогликозид-3'-фосфотрансферазы для устойчивости к генетицину (Neo), кассету для экспрессии в клетках бактерий гена β-лактамазы для устойчивости к ампицилину, используется для получения рекомбинантного фактора hFIX в клетках линии Cricetulus griseus CHO 1E6.

Настоящее изобретение относится к области иммунологии. Предложено антитело, специфично связывающее сегмент M1' IgE и которое индуцирует апоптоз в экспрессирующих IgE В-клетках, и его антигенсвязывающий фрагмент.

Изобретение относится к биотехнологии и представляет собой рекомбинантную плазмиду BMPRIA-CBD, штамм E.coli, трансформированный данной плазмидой. Изобретение относится также к рекомбинантному белку BMPRIA-CBD, с использованием которого получают белок BMP-2.

Изобретение относится к биотехнологии и представляет собой рекомбинантную плазмиду BMPRIB-CBD, штамм E.coli, трансформированный данной плазмидой. Изобретение относится также к рекомбинантному белку BMPRIB-CBD, с использованием которого получают белок BMP-7.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены варианты антитела или его фрагмента, специфичных в отношении β-амилоидного белка.

Изобретение относится к области биотехнологии, конкретно к бис-Met-гистонам, и может быть использовано в медицине. Молекула нуклеиновой кислоты кодирует полипептид, состоящий из двух остатков метионина в качестве первого и второго N-концевых аминокислотных остатков, соединенных через пептидную связь со зрелым эукариотическим гистоном.

Изобретение относится к области биотехнологии и касается химерного белка, нуклеиновой кислоты, кодирующей такой белок, кассеты экспрессии и эукариотической клетки-хозяина.

Изобретение относится к области биотехнологии и генной инженерии. Предложен способ получения вектора экспрессии, кодирующего адаптированную рекомбиназу.

Изобретение относится к области биотехнологии, а именно к эукариотическому вектору для экспрессии целевого рекомбинантного продукта в клетке млекопитающего и его применению, к клетке млекопитающего для продуцирования целевого рекомбинантного продукта и способу ее получения, способу отбора клетки млекопитающего и способу получения целевого рекомбинантного продукта. Вектор включает первый полинуклеотид, кодирующий функциональный связанный с мембраной фолатный рецептор в качестве селективного маркера, и второй полинуклеотид, кодирующий целевой продукт, который рекомбинантно экспрессируется. Целевой продукт представляет собой фармацевтически активный, терапевтически активный или диагностический полипептид. Функциональный связанный с мембраной фолатный рецептор и целевой продукт экспрессируются с указанного вектора экспрессии. Система отбора основана на введении гена экзогенного функционального связанного с мембраной фолатного рецептора в клетку млекопитающего. Предложенное изобретение позволяет эффективно проводить селекцию трансформированных клеток и получать с высоким выходом целевой продукт. 6 н. и 20 з.п. ф-лы, 3 табл., 2 пр.

Наверх