Способ активирования лечения ран

Авторы патента:


Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран
Способ активирования лечения ран

 


Владельцы патента RU 2506092:

КОРТЕРА, ИНК. (US)

Представлена группа изобретений, относящихся к медицине, а именно к дерматологии. Способы улучшения косметического внешнего вида раны и снижения рубцевания при заживлении ран на коже, а также способ активации заживления ран. Способы включают введение фармацевтического состава, содержащего фармацевтически активный релаксин, субъекту с раной на коже в количестве, эффективном для заживления раны с улучшенным косметическим внешним видом по сравнению с заживленной раной у субъекта, не подвергавшегося лечению. Группа изобретений обеспечивает улучшение внешнего вида раны на коже, снижение рубцевания и активацию заживления за счет того, что было выявлено, что релаксин обращает ангиогенез и приводит к раннему исчезновению новых кровеносных сосудов. Это приводит к общему уменьшению кровеносных сосудов, соответственно, меньше красноты в ране, обеспечивая лучший косметический результат. 3 н. и 17 з.п. ф-лы, 15 ил.

 

Перекрестные сведения на родственные заявки

По настоящей заявке испрашивается приоритет в соответствии с 35 разделом Свода законов США, §119(е), на основе предварительной заявки на патент США US 61/127947, поданной 16 мая 2008 г., сущность которой включена в настоящее изобретение.

Область техники, к которой относится изобретение

Настоящее изобретение относится к способам активирования лечения ран и понижения формирования рубцов (шрамов). Описываемые способы включают введение релаксина.

Предпосылки создания изобретения

Часто после лечения раны остается заметный и уродливый шрам, и получаемая ткань обычно слабее окружающей ткани, поскольку ткань из-за коллагена в результате заживления не восстанавливает своей первоначальной ориентации. С помощью различных подходов предпринимались попытки повысить заживление ран и снизить формирование рубцов, например, за счет применения силиконовых пластин к поверхности кожи для снижения повышенного формирования рубцов. Некоторые кремы и гели для местного применения также продают в качестве лекарственного средства от рубцов, назначение которых в улучшении внешнего вида рубцов. Однако многие из этих подходов не могут обеспечить решения указанной проблемы. Например, кремы для местного применения, активирующие уменьшение рубцов, не проявили эффективности при тестировании в слепых исследованиях, поскольку они обычно не направлены на сеть коллагена, которая изменяется после возникновения раны.

При изучении конъюнктуры рынка, поведенном фирмой The Mattson Jack Group, установлено, что из 42 миллионов хирургических манипуляций в США в 2004 году в 34% случаев пациенты относятся к группе повышенного риска недостаточного лечения. Это исследование показало, что имеющиеся на рынке лекарственные средства неудовлетворительны, и что существует большая потребность в лекарственных средствах, которые повышают заживление хирургических ран. Таким образом, существует выраженная потребность в получении эффективного лекарственного средства для активации излечения ран. Особенно часто возникает потребность в повышении степени заживления в случае острых ран (например, проникающих повреждений, ожогов, повреждений нервов или даже ран, возникающих в результате плановых операций), хронических ран (например, диабетических, венозных и пролежней) или при общей недостаточности процесса заживления у индивидуумов (например, у пожилых людей или диабетиков). Во всех этих примерах раны могут тяжело повлиять на качество жизни индивидуума или даже привести к смерти. Например, бактериальная инфекция в месте ранения может воспрепятствовать процессу заживления и привести к осложнениям, опасным для жизни. Таким образом, желательно повысить степень заживления настолько, насколько это только клинически возможно.

Процесс заживления ран осложняется рядом событий, которые начинаются с момента получения повреждения и могут продолжаться на протяжении месяцев или лет. Конкретно излечение ран в тканях взрослых представляет сложный процесс репарации. Например, процесс заживления кожи включает восстановление различных специализированных клеток в месте ранения, внеклеточного матрикса и отложений базальной мембраны, ангиогенез, избирательную протеазную активность и реэпитализацию (Singer, Clark, The New England Journal of Medicine, 341, 1999, cc.738-743).

Имеется три различающиеся фазы в процессе заживления ран. Первая, фаза воспаления, обычно длится с возникновения раны до первых двух-пяти суток, на протяжении этой фазы тромбоциты агрегируют в откладывающиеся гранулы, индуцируя отложение фибрина и стимулируя высвобождение факторов роста. Лейкоциты мигрируют к месту ранения и начинают переваривать и уносить остатки органических веществ из раны. На протяжении фазы воспаления моноциты также преобразуются в макрофаги, которые выделяют ростовые факторы для стимуляции ангиогенеза и получения фибробластов.

Вторая фаза, фаза пролиферации, которая обычно длится от двух суток до трех недель, и во время которой формируется гранулирование ткани и начинается эпитализация. Фибробласты - ключевые типы клеток на этой фазе, пролиферируют и синтезируют коллаген для заполнения раны и создания сильного матрикса, в котором растут эпителиальные клетки. По мере выработки коллагена фибробластами васкуляризация распространяется от близлежащих сосудов для доставки питательных веществ к регенерирующей ткани. Красные петли кровеносных сосудов придают ране зернистый вид, отсюда название «гранулированная» ткань. Эпитализация включает миграцию эпителиальных клеток от поверхности раны для уплотнения раны. Эпителиальные клетки движутся из-за потребности клеток любого типа к контакту и направляются сетью тяжей фибрина, которые функционируют в качестве решетки, по которой эти клетки мигрируют. Сокращающиеся клетки, называемые миофибробластами, появляются в ранах и способствуют закрытию ран. Эти клетки проявляют синтез коллагена и сокращение и являются обычными в гранулирующихся ранах.

Третья фаза, фаза ремоделирования, является заключительной фазой заживления ран, которая может занять от трех недель до нескольких лет, и во время которой рубец претерпевает повторное разрушение и ресинтез. На этой фазе сила растяжения вновь сформированной кожи повышается.

Однако, по мере повышения степени заживления раны, часто в связи с ним повышается формирование рубца. Рубцевание представляет результат процесса заживления большинства тканей взрослых животных и человека. Ткань рубца не идентична ткани, которую он замещает, поскольку она обычно низкого по функциональности качества. Например, рубцы на коже менее устойчивы к ультрафиолету, а потовые железы и волосяные фолликулы заново в ткани рубца не вырастают. К типам рубцов относятся, но ими не ограничиваются, атрофические, гипертрофические и келоидные рубцы, а также стягивающие рубцы. Атрофические рубцы плоские и расположены ниже окружающей ткани, подобно лощине или дырке. Гипертрофические рубцы представляют возвышающиеся рубцы, которые сохраняются внутри границ первоначального повреждения и часто содержат избыток коллагена, собранный отличным от нормы образом. Келоидные рубцы представляют возвышающиеся рубцы, которые распространяются за пределы первоначальной раны и вторгаются на окружающую нормальную кожу, проявляя специфичность в зависимости от места расположения рубца, и часто содержат витки коллагена, собранные измененным образом. Стягивающие рубцы являются рубцами, которые пересекают суставы или кожные складки под прямыми углами, и склонны к развитию укорочения или стягивания. Стягивающие рубцы возникают при неполном формировании рубца и склонны к гипертрофии, что обычно приводит к потере трудоспособности и функциональности. Рубцевание также может быть ишемическим или в виде атрофических полосок кожи. Ишемические рубцы возникают из-за местной недостаточности снабжения кровью. Рубцы в виде атрофических полосок кожи формируются, если кожа быстро растягивается (например, во время беременности, при существенном увеличении массы тела или при резком росте в подростковом возрасте), или если кожа попадает под напряжение во время процесса заживления (обычно около суставов). Внешний вид рубцов такого типа обычно улучшается через несколько лет.

Напротив, нормальная кожа состоит из волокон коллагена, собранных наподобие плетенки, которые способствуют и прочности, и эластичности кожи. Таким образом, для достижения более ровного заживления ран желателен процесс, в котором не только стимулируется выработка коллагена, но также происходит укладка коллагена в более упорядоченную сборку для снижения формирования рубца. Настоящее изобретение направлено на решение этой неудовлетворенной потребности.

Краткое описание предпочтительных вариантов осуществления настоящего изобретения

Настоящее изобретение главным образом предусматривает способы улучшения заживления ран и снижения формирования рубцов. Объекты по настоящему изобретению относятся к способам активизации заживления повреждений и ран, активизации реэпитализации ран, понижения рубцевания при заживлении ран, предупреждения рубцевания при заживлении ран, ингибирования индуцированной TGF-бета коллагеном пролиферации фибробластов и выработки коллагена в ране на коже и улучшения внешнего вида физического недостатка.

Раны могут возникнуть в результате пореза, разрыва, ссадины, прокалывания, проникновения, огнестрельного выстрела, прокалывания, а также пластической хирургии лица и всего тела и реконструктивной хирургии. Хотя с помощью различных подходов, например, применения силиконовых пластин к поверхности кожи и кремов местного применения, пытались повысить заживление ран и понизить формирование рубцов, многие из этих подходов не могут достичь требуемого эффекта. Таким образом, настоящее изобретение предусматривает новый терапевтический подход, соответствующий указанной потребности. Одно из преимуществ настоящего изобретения заключается в том, что релаксин повышает скорость заживления ран. Другое преимущество настоящего изобретения заключается в том, что релаксин улучшает прочность в месте раны. Еще одно преимущество заключается в стимулировании антифиброзных действий, которые снижают формирование рубцов, и ингибировании пролиферации TGF-бета коллаген индуцированных фибробластов и выработки коллагена через введение релаксина.

Введение релаксина существенно повышает заживление ран. Например, у грызунов системное введение релаксина крысам связано с повышенной регуляцией VEGF и bFGF транскриптов и с повышенным формированием новых кровеносных сосудов избирательно в месте ранения (Unemori и др., Wound Repair и Regeneration, 8, 2000, cc.366-368). Однако механизмы заживления ран у грызунов отличаются от механизмов заживления ран у свиней и людей. Таким образом, преимущество настоящего изобретения заключается в том, что оно предусматривает способы введения релаксина в кожу животных (например, свиней) и людей безопасным и эффективным путем для активизации заживления ран и снижения формирования рубца.

Для каждого из указанных выше способов выбирают субъекта, животное или человека (в том числе диабетика), с повреждением или раной (которые могут быть открытой раной, закрытой раной, порезом или раной, полученной в результате лицевой пластической хирургии или пластической хирургии всего тела), и вводят фармацевтический состав с фармацевтически приемлемым релаксином в количестве, эффективном для активизации заживления повреждения или раны. В некоторых вариантах осуществления настоящего изобретения повреждение представляет порез (который может быть рассечением эпидермы) или рану (которая может быть открытой или закрытой). К примерам открытых ран относятся, но ими не ограничиваются, порез, разрыв, ссадина, колотая рана, проникающая рана, огнестрельная рана и ножевая рана. К примерам закрытых ран относятся, но ими не ограничиваются, ушибы или гематомы. В некоторых вариантах осуществления настоящего изобретения заживление раны, реэпитализация или снижение рубцевания во время заживления повышены. В других вариантах осуществления настоящего изобретения рана частично или полностью покрыта коркой, содержит активные фибробласты, или представляет острую или хроническую рану. В некоторых вариантах осуществления настоящего изобретения порез представляет рассечение эпидермы.

В других вариантах осуществления настоящего изобретения применительно к указанным выше объектам настоящего изобретения рана может быть следствием косметической хирургии, например, лицевой пластической хирургии или пластической хирургии всего тела. К примерам лицевой пластической хирургии относятся, но ими не ограничиваются, косметическая операция по удалению морщин, блефаропластика, ринопластика, отопластика, ментопластика, подтяжка лица, подтяжка лба, подтяжка бровей, изменение шрамов на лице, удаление шрамов на лице, лазерная хирургия, шлифовка кожи, удаление складок, плазмолифтинг, моделирования контуров лица собственными жировыми трансплантатами, натяжение кожи, удаление татуировок и замещение волос. К примерам пластической хирургии всего тела относятся, но ими не ограничиваются, пластика передней брюшной стенки, уменьшение молочной железы, увеличение молочной железы, процедуры бодилифтинга, лечение паутинных сосудистых сеточек, лечение растяжек кожи, липосакция, хирургическое удаление избытков кожи, уменьшение целлюлита, оконтуривание тела, шлифовка тела и импланты тела.

В некоторых вариантах осуществления настоящего изобретения активирование заживления ран или порезов у субъектов, активирование реэпитализации ран, снижение или предупреждение рубцевания при заживлении ран, или подавлении пролиферации TGF-бета коллаген индуцированных фибробластов и выработки коллагена в ранах происходит через модулирование специфических рецепторов. В частности, рецепторы LGR7 и LGR8 активируются через связывание релаксина, причем связывание приводит в действие выработку оксида азота (NO). В других вариантах осуществления настоящего изобретения релаксин активирует заживление ран или порезов за счет повышения расширения сосудов вокруг места повреждения, снижения гранулирования ткани в месте раны, снижения хронического воспаления в месте раны, снижения некроза в месте раны, повышения организации коллагена в месте раны, улучшения гистологической картины в месте раны, повышения прочности в месте раны и их сочетания. Указанные выше способы дополнительно включают активирование реэпителизации ран на коже, снижение рубцевания, предупреждение рубцевания и подавление пролиферации TGF-бета коллаген индуцированных фибробластов и выработки коллагена. В некоторых вариантах осуществления настоящего изобретения реэпителизация включает, но ими не ограничивается, повышение расширения сосудов вокруг места раны, снижение гранулирования ткани в месте раны, снижение хронического воспаления в месте раны, снижение некроза в месте раны, повышение организации коллагена в месте раны, улучшение гистологических признаков в месте раны и/или повышение прочности места раны. В других вариантах осуществления настоящего изобретения реэпителизация раны на коже дополнительно снижает рубцевание, предупреждает рубцевание и/или ингибирует пролиферацию TGF-бета коллаген индуцированных фибробластов и выработку коллагена.

Релаксин, применяемый в фармацевтических составах настоящего описания, может быть. например, синтетическим или рекомбинантным релаксином. В другом варианте осуществления настоящего изобретения релаксин является релаксином человека. В другом варианте осуществления настоящего изобретения релаксином является релаксин человека Н2. В еще одном из вариантов осуществления настоящего изобретения релаксин является синтетическим или рекомбинантным релаксином человека Н2. Таким образом, субъекта можно лечить фармацевтическим составом синтетического или рекомбинантного релаксина человека. В другом варианте осуществления настоящего изобретения субъекта лечат синтетическим релаксином человека Н2. В еще одном из вариантов осуществления настоящего изобретения субъекта лечат рекомбинантным релаксином человека Н2.

Релаксин можно вводить субъекту с помощью ряда разных способов, включая, но ими не ограничиваясь, местное, подкожное, системное, внутримышечное, внутривенное введение, введение путем ингаляции, путем инъекции, путем орошения и/или с помощью осмотического насоса (например, с помощью системы многокамерного осмотического насоса). Например, местная доставка может включать, но ими перечень не ограничивается, лосьон, гель, крем, раствор и перевязочные материалы (в которых релаксин нанесен на марлю перевязочного материала и когда их накладывают на влажную рану может высвобождаться в место раны). В некоторых вариантах осуществления настоящего изобретения релаксин вводят с постепенно уменьшаемой скоростью. Скорость может быть заранее определена таким образом, чтобы поддерживать концентрацию в сыворотке релаксина примерно от 0,5 до примерно 500 нг/мл, более предпочтительно примерно от 0,5 до примерно 300 нг/мл и наиболее предпочтительно примерно от 3 до примерно 75 нг/мл. Допустимый диапазон составляет примерно от 1 до примерно 50 нг/мл, причем предпочтительная концентрация в сыворотке составляет 20 нг/мл. В других вариантах осуществления настоящего изобретения релаксин вводят в количестве, варьирующем примерно от 10 до 1000 мкг/кг массы тела субъекта в сутки. В еще одном из вариантов осуществления настоящего изобретения дозы релаксина составляют 10, 30, 100 и 250 мкг/кг/сутки. В еще одном из вариантов осуществления настоящего изобретения дозы приводят к концентрациям релаксина в сыворотке примерно 3, 10, 30 и 75 нг/мл, соответственно. В еще одном из вариантов осуществления настоящего изобретения предпочтительно вводить релаксин в количестве примерно 960 мкг/кг массы тела в сутки. Для какого-либо уровня дозирования релаксин может вводиться на протяжении периода, достаточного для получения терапевтического эффекта.

В некоторых вариантах осуществления настоящего изобретения описанные выше способы могут включать орошение раны для более быстрого заживления. Релаксин может вводиться в комбинации с фармацевтически приемлемым носителем, растворителем или эксципиентом, который может быть комбинирован в форме лосьона, геля, крема и/или раствора. В других вариантах осуществления настоящего изобретения релаксин вводят в комбинации с агентами, повышающими проникновение в рану. Релаксин также может вводиться в комбинации по меньшей мере с одним другим фармацевтически действующим агентом, например, нестероидным противовоспалительным лекарственным средством (НСПВЛС) или антибиотиком. В некоторых других вариантах осуществления настоящего изобретения релаксин вводят на протяжении периода, достаточного для получения терапевтического эффекта.

Другие объекты настоящего изобретения предусматривают способы лечения повреждений, реэпитализации ран, предупреждения или снижения рубцевание при заживлении раны на коже, причем фармацевтически действующий синтетический релаксин человека вводят субъекту. Эти способы включают инъекционный состав в дозах, варьирующих примерно от 10 до примерно 1000 мкг/кг массы тела в сутки, причем релаксин вводят на протяжении периода, достаточного для получения терапевтического эффекта. В одном из вариантов осуществления настоящего изобретения субъектом является человек. В других вариантах осуществления настоящего изобретения повреждение представляет порез, который может быть надрезом эпидермы, или рану, которая может быть открытой или закрытой. К примерам открытых ран относятся, но ими не ограничиваются, порезы, разрывы, ссадины, колотые раны, проникающие раны, огнестрельные раны и/или ножевые раны. В еще одном из вариантов осуществления настоящего изобретения состав является инъекционным.

В других объектах настоящего изобретения предусмотрены способы предупреждения или снижения рубцевания во время заживления ран на коже, причем фармацевтически действующий синтетический релаксин человека вводят субъекту в количестве, варьирующем примерно от 10 до примерно 1000 мкг/кг массы тела в сутки, продолжая введение на протяжении периода, достаточного для получения терапевтического эффекта у субъекта. В одном из вариантов осуществления настоящего изобретения субъектом является человек. В другом варианте осуществления настоящего изобретения рана может быть открытой или закрытой. В еще одном из вариантов осуществления настоящего изобретения к открытым ранам относятся, но ими перечень не ограничивается, порезы, разрывы, ссадины, колотые раны, проникающие раны, огнестрельные раны и/или ножевые раны. В еще одном из вариантов осуществления настоящего изобретения рубцевание включает, но ими перечень не ограничивается, келоидные, гипертрофические, ишемические рубцы и атрофические полосы кожи. В другом варианте осуществления настоящего изобретения ранее существовавший тканевый рубец удаляется в первую очередь. В еще одном из вариантов осуществления настоящего состав является инъекционным.

В настоящем изобретении также предусмотрено применение релаксина для активирования заживления повреждения у человека (в том числе у диабетика); применение релаксина для активирования заживления ран у человека (в том числе у диабетика); применение релаксина для активирования реэпителизации ран у человека (в том числе у диабетика); применение релаксина для снижения рубцевания при заживлении ран у человека (в том числе у диабетика); применение релаксина для предупреждения рубцевания при заживлении ран у человека (в том числе у диабетика); применение релаксина для ингибирования пролиферации TGF-бета коллаген индуцированных фибробластов и выработки коллагена в ране на коже у человека (в том числе у диабетика); применение релаксина для улучшения внешнего вида физического недостатка у человека (в том числе у диабетика), согласно рассматривавшемуся выше.

Настоящее изобретение дополнительно предусматривает способы улучшения косметического внешнего вида ран на коже, включающие: введение фармацевтического состава, включающего фармацевтически действующий релаксин, субъекту с кожной раной в количестве, эффективном для получения заживленной раны с улучшенным косметическим внешним видом по сравнению заживленной раной у субъекта, не подвергавшегося лечении. В некоторых вариантах осуществления настоящего изобретения заживленная рана с улучшенным косметическим внешним видом представляет большее соответствие цвета с цветом окружающей кожи (более ровная структура, сниженное искажение окружающей кожи, больше контур с окружающей кожей и отсутствие общей патологии). В некоторых предпочтительных вариантах осуществления настоящего изобретения заживленная рана с улучшенным косметическим внешним видом дополнительно включает сплетенную организацию коллагеновых волокон. В некоторых предпочтительных вариантах осуществления настоящего изобретения релаксин является очищенным, рекомбинантным или синтетическим релаксином человека. В некоторых предпочтительных вариантах осуществления настоящего изобретения релаксином является релаксин человека H1, H2 или Н3, хотя в других вариантах осуществления настоящего изобретения релаксин является агонистом релаксина. В некоторых предпочтительных вариантах осуществления настоящего изобретения релаксин вводят системно субъекту и/или релаксин вводят местно на кожную рану. Некоторые варианты осуществления настоящего изобретения дополнительно включают орошение кожных ран. Кроме того, в некоторых предпочтительных вариантах осуществления настоящего изобретения фармацевтический состав дополнительно включает антибиотик, нестероидное противовоспалительное лекарственное средство или оба этих агента. В некоторых вариантах осуществления настоящего изобретения субъектом является человек с ослабленной способностью к заживлению (например, диабетик или престарелый).

Кроме того, настоящее изобретение предусматривает способы снижения рубцевания во время заживления ран на коже, включающие: введение фармацевтического состава, содержащего фармацевтически действующий релаксин, субъекту с раной на коже в количестве, эффективном для заживления ран с пониженным рубцеванием по сравнению с заживленной раной у субъекта, не подвергавшегося лечению. В некоторых вариантах осуществления настоящего изобретения рубцевание выбрано из группы, состоящей из келоидных рубцов, гипертрофических рубцов и атрофических полос кожи. В некоторых предпочтительных вариантах осуществления настоящего изобретения способы дополнительно включают санацию раневой полости или удаление ранее существовавшей ткани рубца. В некоторых вариантах осуществления настоящего изобретения релаксин является очищенным, рекомбинантным или синтетическим релаксином человека. В некоторых вариантах осуществления настоящего изобретения релаксином является релаксин H1, H2 или Н3 человека, хотя в других вариантах осуществления настоящего изобретения релаксин является агонистом релаксина. В некоторых предпочтительных вариантах осуществления настоящего изобретения релаксин вводят системно субъекту и/или местно на кожную рану. Некоторые способы дополнительно включают орошение кожной раны. Кроме того, в некоторых вариантах осуществления настоящего изобретения фармацевтический состав дополнительно включает антибиотик, нестероидное противовоспалительное лекарственное средство или оба этих агента. В некоторых вариантах осуществления настоящего изобретения субъектом является человек с ослабленной способностью к заживлению (например, диабетик или престарелый).

Настоящее изобретение также предусматривает способы активирования заживления ран, включающие: введение фармацевтического состава, содержащего фармацевтически действующий релаксин субъекту с раной в количестве, эффективном для активирования заживления ран. В некоторых вариантах осуществления настоящего изобретения рана возникает в результате пластической хирургии. В некоторых вариантах осуществления настоящего изобретения пластическая хирургия является лицевой пластической хирургией, выбранной из группы, включающей косметическую операцию по удалению морщин, блефаропластику, ринопластику, отопластику, ментопластику, подтяжку лица, подтяжку лба, подтяжку бровей, изменение шрамов на лице, удаление шрамов на лице, лазерную хирургию, шлифовку кожи, удаление складок, плазмолифтинг, моделирование контуров лица собственными жировыми трансплантатами, натяжение кожи, удаление татуировок и замещение волос. В других вариантах осуществления настоящего изобретения пластическая хирургия является хирургией всего тела, выбранной из группы, включающей пластику передней брюшной стенки, уменьшение молочной железы, увеличение молочной железы, процедуры бодилифтинга, лечение паутинных сосудистых сеточек, лечение растяжек кожи, липосакцию, хирургическое удаление избытков кожи, уменьшение целлюлита, оконтуривание тела, шлифовка тела и импланты тела. В некоторых вариантах осуществления настоящего изобретения релаксин является очищенным, рекомбинантным или синтетическим релаксином человека. В некоторых предпочтительных вариантах осуществления настоящего изобретения релаксин является релаксином человека H1, H2 или Н3, хотя в других вариантах осуществления настоящего изобретения релаксин является агонистом релаксина. В некоторых предпочтительных вариантах осуществления настоящего изобретения релаксин вводят системно и/или местно. Кроме того, в некоторых вариантах осуществления настоящего изобретения фармацевтический состав дополнительно включает антибиотик, нестероидное противовоспалительное лекарственное средство или оба этих агента. В некоторых вариантах осуществления настоящего изобретения субъектом является человек с ослабленной способностью к заживлению (например, диабетик или престарелый).

Краткое описание фигур

Настоящее изобретение будет понято наилучшим образом, если текст будет сопровождаться фигурами, предназначенными для иллюстрации предпочтительных вариантов осуществления настоящего изобретения. Однако очевидно, что настоящее изобретение не ограничивается специфическими вариантами осуществления настоящего изобретения, изложенными в фигурах.

Фиг.1А показывает пептидный гормон человека релаксин H2, который по размеру и форме напоминает инсулин. Фиг.1Б показывает аминокислотную последовательность цепи В (SEQ ID NO:1) и цепи А (последовательность SEQ ID NO:2, в которой Х обозначает глутаминовую кислоту [Е] или глутамин [Q]) релаксина 2 (H2) человека.

Фиг.2 показывает расположение ран у свиньи, (А) графически и (Б) в виде фотографии живой свиньи.

Фиг.3 показывает места ран на спине молодой свиньи после шести недель лечения релаксином и плацебо. Порез 3 орошают релаксином на протяжении первой недели и затем обрабатывают местно высокой дозой состава релаксина на протяжении 2-6 недель. Порезы 4, 5 и 6 не орошают на протяжении 1 недели. Порез 4 лечат плацебо. Порез 5 обрабатывают низкой дозой состава для местного применения, а порез 6 обрабатывают высокой дозой состава для местного применения.

Фиг.4 показывает изменения внешнего вида ран через 6 суток. (А) Верхняя фотография показывает кожу контрольной свиньи. (Б) Нижняя фотография показывает кожу свиньи, которую лечили системно релаксином. Из фигуры следует, что при лечении релаксином рана заживает быстрее, лучше и внешний вид кожи после лечения более ровный по сравнению с контрольной свиньей.

Фиг.5 показывает зрительное ранжирование косметического вида кожи: (А) показывает косметическую оценку, и (Б) показывает сравнительную оценку цвета с окружающей кожей. Обе оценки получены на четвертой и шестой неделях.

Фиг.6 показывает места ран на молодых свиньях через 6 недель лечения. Область, указанная стрелками, показывает области, в которых (А) нет видимых рубцов, если кожу лечили системно релаксином, и (Б) красный шрам виден, если кожу обрабатывали плацебо. Черные отметины по краям рисунка показывают первоначальный размер раны. Видимые на рисунках струпья указывают, где брали образцы на биопсию во время проведения исследования.

Фиг.7 представляет гистопатологический препарат, который изображает место раны после лечения релаксином.

Фиг.8 показывает два гистопатологических препарата места раны молодой свиньи, сравнивающих ткань с грануляцией при лечении и без лечения релаксином. Тяжелое рубцевание установлено на левом препарате (без лечения релаксином) и умеренное рубцевание установлено на правом препарате (лечение релаксином). Препараты показывают широкий диапазон грануляции ткани, который можно наблюдать через шесть недель после нанесения раны. Препараты также показывают эффект релаксина в виде снижения степени грануляции ткани (справа) и в результате восстановления ткани в нормальное состояние.

Фиг.9 показывает оценку количества гранулированной ткани (слева) и воспаления (справа) в местах ран через шесть недель (оценка слепым методом). В ранах при системном лечении релаксином (красный цвет) существенно снижено гранулирование ткани или воспаление по сравнению с ранами, которые не лечили системно релаксином (синий цвет). Это означает, что места ран восстанавливаются лучше при лечении релаксином системным способом.

Фиг.10 показывает препараты восстановления коллагена, используемые для оценки заживления ран. (А) Вверху показан относительно неправильно организованный коллаген. (Б) Внизу показан коллаген при хорошем заживлении.

Фиг.11 показывает графически, что смешанная оценка заживления раны существенно лучше для ран после системного лечения релаксином (справа) по сравнению с ранами, которые не лечили системно релаксином (слева). Раны оценивают по трехбалльной шкале, основанной на субъективной оценке образования коллагена в местах ран, и больший номер означает лучшее заживление. При оценке «1» больше волокон собрано в параллельные тяжи или в одну плоскость, они меньше в размере и более плотно упакованы. Оценка «2» - переходное состояние сборки и картины коллагеновых волокон. Оценка «3» означает переплетенную сборку коллагеновых волокон, напоминающую норму, но меньше по размеру по сравнению с нормальной собственно кожей, указывающую на наилучшее заживление.

Фиг.12 показывает микроснимки, которые отражают новую систему оценки рубцов для классификации рубцов. Нормальная кожа представлена на (А), слабо измененная на (Б), сильно измененная на (В) и рубцевание на (Г). Ориентация пучков коллагена указана цветом: синим, белым и желто-оранжевым. В шрамах умеренного проявлением все еще присутствует более тонкий коллаген. В тяжелых шрамах имеются пучки чрезвычайно тонкого коллагена, в основном ориентированные в одной плоскости. Масштаб составляет 100 мкм, краситель конго красный, поляризованный свет, 20×.

Фиг.13 показывает систему количественной оценки коллагена. Подсчет степени «покраснения» сопровождается применением компьютерной программы Photoshop Software. Прослеживают периметр шрама и подсчитывают среднее число красных пикселей. Соседнюю нормальную область оконтуривают и подсчитывают среднее число красных пикселей.

Фиг.14 показывает результаты применявшейся в настоящем исследовании системы объективной оценки коллагена. Раны, которые системно получали релаксин (справа), имеют существенно лучшую организацию коллагена по сравнению с ранами, которые системно не получали релаксина (слева).

Фиг.15 показывает концентрацию релаксина Н2 (Н2 RLX), обнаруженного в деснах собак после лечения на расстоянии 0,5 см, 1,0 см и 2,0 см от места инъекции, через 1 ч, 2 ч и 4 ч после инъекции. Оценка десен собак, подвергнутых лечению, показала, что релаксин (RLX) присутствует во всех трех временных точках, но концентрация уверенно снижается через 1, 2 и 4 ч. Установлены концентрации 90 нМ, 78 нМ и 21 нМ Н2 RLX, соответственно. Установлено, что RLX ограниченно мигрирует сквозь десну. Через 1 ч RLX обнаруживают на расстоянии 0,5 см от места инъекции, но не обнаруживают на расстоянии 1,0 и 2,0 см от места инъекции. В оставшееся время RLX обнаруживают только в месте инъекции. Таким образом, эта фигура четко показывает, что релаксин остается близко расположенным к месту инъекции.

Подробное описание изобретения

Настоящее изобретение относится к способам активирования заживления повреждений или ран. Настоящее изобретение предусматривает способы лечения повреждений, активирования реэпитализации ран, а также снижения и предупреждения рубцевания во время процесса заживления. Настоящее изобретение дополнительно предусматривает способы подавления пролиферации TGF-бета коллаген индуцированных фибробластов и выработки коллагена, а также улучшения внешнего вида повреждения кожи. В некоторых вариантах осуществления настоящего изобретения способы по настоящему изобретению особенно применимы для ускорения заживления ран и укрепления области раны, например, у пациентов, у которых заживление протекает слабо после операции или повреждения, например, возрастного, а также у пациентов с сопутствующими медицинскими состояниями, например, с диабетом или ослабленным иммунитетом. В других вариантах осуществления настоящего изобретения способы настоящего изобретения находят применение в косметической хирургии.

Настоящее изобретение обеспечивает существенное улучшение в заживлении ран и предупреждении рубцов. Добавление релаксина к ранам в клинических и предклинических исследованиях повышает процесс заживления, особенно степень реэпитализации. Лечение релаксином также терапевтически эффективно для снижения и предупреждения рубцевания. Полагают, что связывание релаксина со специфическими G-белок-соединенными рецепторами релаксина, например, LGR7 и LGR8, приводит к лучшему заживлению ран и предупреждению формирования рубцов, поскольку релаксин способен модулировать эти рецепторы.

Релаксин также активирует рост новых кровеносных сосудов (ангиогенез) в местах ран через индукцию ангиогенных цитокинов, например, ростового фактора эндотелия сосудов (vascular endothelial growth factor - VEGF) и факторов роста фибробластов (fibroblast growth factors - FGF). Стимуляция высвобождения VEGF активирует митотическое и/или мигрирующее действие клеток эндотелия. Также крайне важно для репарации ткани установить опору для поддержки клеточной миграции и/или пролиферации. Стимуляция высвобождения факторов FGF из какого-либо числа клеточных типов активирует пролиферацию и миграцию фибробластов, которые участвуют в выработке внеклеточного материала матрикса (ВКМ), например, коллагена. Неожиданно в настоящем изобретении было установлено, что релаксин приводит к общему уменьшению кровеносных сосудов в месте раны после примерно шести недель лечения, т.е., установлено, что покраснение в месте раны существенно меньше в результате лечения релаксином. Это новые сведения, которые чрезвычайно интересны в связи с тем, что релаксин сначала активирует рост новых сосудов в месте свежей раны, а затем уменьшает число таких новых кровеносных сосудов после примерно шести недель лечения, приводящего к более тонкой, гладкой и более нормально выглядящей коже.

Определения

Понятие «релаксин» относится к пептидному гормону, хорошо известному в данной области (см. фиг.1). Понятие «релаксин» в контексте настоящего изобретения охватывает релаксин человека, включая неизмененный релаксин полной длины или часть молекулы релаксина, которая сохраняет биологическое действие. Понятие «релаксин» также охватывает синтетический релаксин человека и рекомбинантный релаксин человека, включая синтетический релаксин человека Н2 и рекомбинантный релаксин человека Н2. Это понятие также охватывает действующие агенты с релаксин-подобным действием, например, аналоги релаксина и их части, которые сохраняют биологическое действие, а также агенты, которые конкурентно смещают связанный релаксин с рецепторов релаксина, например, с рецептора LGR7 или LGR8. Кроме того, последовательность нуклеиновой кислоты релаксина человека в контексте настоящего изобретения не должна быть на 100% идентична последовательности нуклеиновой кислоты релаксина человека Н2, но может быть по меньшей мере примерно на 40%, 50%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична последовательности нуклеиновой кислоты релаксина человека Н2. В контексте настоящего изобретения релаксин может быть получен каким-либо способом, известным специалистам в данной области. Примеры таких способов описаны, например, в US 5759807, а также в статье Bullesbach и др., J Biol Chem, 266, 1991, cc.10754-10761. Примеры молекул релаксина и его аналогов описаны, например, в US 5166191.

Понятие «рана» обычно относится и к открытым, и к закрытым ранам, согласно описанному ниже. Рана может быть дополнительно классифицирована в качестве острой или хронической. Острой называется рана, которая не имеет лежащих в основе дефектов процесса заживления и обычно возникает вторично по отношению к хирургическому вмешательству или травме у здорового индивидуума, заживляется быстро и полностью. Напротив, хронической является рана, которая имеет нарушение целостности ткани, полученное в результате удара или травмы, которые представляют увеличенную длительность или частый рецидив. В контексте настоящего изобретения понятие «рана на коже» относится к разрушению кожи.

Понятие «открытая рана» обычно классифицируют, ориентируясь на объект, который вызвал рану. К открытым ранам относятся резаные раны, рваные раны, ссадины, колотые раны, проникающие раны, огнестрельные раны и др. Резаные раны или порезы могут вызываться чистым, имеющим острый край объектом, например, ножом, бритвой или осколком стекла. Резаные раны, затрагивающие только эпидермис, могут классифицироваться в качестве порезов. Рваные раны являются неровными, вызванными воздействием тупого предмета на мягкие ткани, расположенные поверх твердых тканей (например, на кожу поверх черепа), или разрывом кожи и других тканей (например, вызванным с рождением ребенка). Разрывы могут показывать шунтирование, поскольку соединительная ткань или кровеносные сосуды уплощены относительно лежащей ниже плотной поверхности. Царапины (ссадины) являются поверхностными ранами, в которых содран самый верхний слой кожи, и которые часто вызваны скольжением по неровной поверхности. Колотые раны могут быть вызваны объектом, прокалывающим кожу, например, гвоздем или иглой. Проникающие раны могут быть вызваны объектом, например, ножом, проникающим в тело. Огнестрельные раны вызываются пулей или другим снарядом, проникающим вовнутрь или сквозь тело. При этом может быть две раны - одна в месте входа и другая в месте выхода, такое повреждение называется сквозной раной.

Понятие «закрытая рана» относится к контузиям, обычно называемым ушибами и кровоподтеками, которые вызваны тупым ударом, разрушающим ткань под кожей; гематомам, также называемым кровяными опухолями, вызванным повреждением кровеносных сосудов, что в свою очередь приводит к скоплению крови под кожей; и сдавленным ранам, которые могут быть вызваны высокой или чрезвычайной приложенной силой на протяжении длительного периода времени.

Понятие «рубец» относится к нарушенной морфологической структуре, возникающей из ранее произошедшего повреждения или ранения (например, надрезы, иссечения или травмы). Рубцы состоят из соединительной ткани, которая преимущественно представляет матрикс из коллагенов типов 1 и 3 и фибронектина. Рубец может состоять из коллагеновых волокон нарушенной ориентации (наблюдаемых в нормальных рубцах кожи) или может представлять нарушенное накопление соединительной ткани (наблюдаемое в рубцах в центральной нервной системе или при патологическом рубцевании кожи). К типам рубцов относятся, но ими не ограничиваются, атрофические, гипертрофические и келоидные рубцы, а также стягивающие рубцы. Атрофические рубцы плоские и расположены ниже окружающей ткани, подобно лощине или дырке. Гипертрофические рубцы являются возвышающимися рубцами, которые сохраняются внутри границ первоначального повреждения и часто содержат избыток коллагена, собранного отличным от нормы образом. Келоидные рубцы представляют рубцы, которые распространяются за пределы первоначальной раны и вторгаются в окружающую нормальную кожу способом, специфичным для данного места раны, и часто содержат витки коллагена, собранные измененным образом. Рубцовые контрактуры являются рубцами, которые пересекают суставы или складки кожи под прямыми углами, и предрасположены к развитию укорочения или сокращения. Рубцовые контрактуры образуются, когда рубец еще не полностью сформирован, и часто проявляют тенденцию к гипертрофии, что обычно приводит к потере трудоспособности и функциональности.

Понятие «введение» относится к получению или применению субъектом фармацевтического лекарственного средства или состава через определенный путь, включая, но ими не ограничиваясь, местное, внутривенное, системное, подкожное, внутримышечное, подъязычное и ингаляционное или инъекционное введение, а также орошение или осмотический насос.

Релаксин

Релаксин является пептидным гормоном, сходным по размеру и форме с инсулином (см. фиг.1). Более конкретно, релаксин является эндокринным и аутокринным/паракринным гормоном, который принадлежит к надсемейству гена инсулина. Действующая форма кодируемого белка состоит из цепи А и цепи В, связанных вместе дисульфидными связями, двух внутренних цепей и одной внешней цепи. Таким образом, структура имеет тесное сходство с инсулином по положению дисульфидных связей. У людей имеется три неаллельных гена релаксина, релаксина-1 (RLN-1 или H1), релаксина-2 (RLN-2 или Н2) и релаксина-3 (RLN-3 или Н3). H1 и Н2 разделяют высокую степень гомологии последовательностей. Имеется два разных варианта сплайсинга транскриптов, кодирующих разные изоформы, описанные для этого гена. Экспрессия H1 у людей является неоднозначной. Н2 экспрессируется репродуктивным органами, хотя Н3 обнаруживают преимущественно в мозге. Эволюция семейства пептидов релаксина по его рецепторам известна в данной области (Wilkinson и др., ВМС Evolutionary Biology, 5, 2005, cc.1-17; Wilkinson, Bathgate в кн.: «Relaxin и Related Peptides», глава 1, изд-во Landes Bioscience и Springer Science + Business Media, 2007).

Релаксин активирует два специфических рецептора релаксина, т.е. LGR7 (RXFP1) и LGR8 (RXFP2). LGR7 и LGR8 являются обогащенными лейцином повторами, G белок-связанными рецепторами (G protein-coupled receptor - LGR), которые представляют уникальную подгруппу G белок-связанных рецепторов. Они содержат трансмембранный домен из семи спиралей и крупный гликозилированный эктодомен, отдаленно связанные с рецепторами гликопротеогормонов, например, LH-рецептором или FSH-рецептором. Эти рецепторы релаксина обнаружены в сердце, гладких мышцах, соединительной ткани и в центральной и автономной нервной системе. Мощные релаксины, например, релаксины H1 и Н2 свиньи и кита, имеют общую последовательность, т.е. последовательность Arg-Glu-Leu-Val-Arg-X-X-Ile или связывающую кассету. Релаксины, которые имеют отличия по гомологии последовательности, например, релаксины крысы, акулы, собаки и лошади, проявляют снижение биологической активности через рецепторы LGR7 и LGR8 (см. Bathgate и др., Ann. N.Y. Acad. Sci. 1041, 2005, cc.61-76).

Релаксин обнаружен и у женщин, и у мужчин (Tregear и др. в кн. «Relaxin 2000, Proceedings of the Third International Conference on Relaxin & Related Peptides», cc.22-27 октябрь 2000, Broome, Австралия). У женщин релаксин вырабатывается желтым телом (corpus luteum) яичника, грудью и во время беременности также плацентой, хорионом отпадающей оболочкой матки. У мужчин релаксин вырабатывается семенниками. У людей релаксин действует при беременности, повышает подвижность сперматозоидов, регулирует давление крови, контролирует частоту сердечных сокращений и высвобождает окситоцин и вазопрессин. У животных релаксин также влияет на метаболизм коллагена, ингибируя синтез коллагена и повышая его разрушение за счет повышения металлопротеиназ матрикса. Релаксин также повышает ангиогенез и является почечным вазодилатором.

Основным свойством релаксина является его принадлежность к ростовым факторам, и он может изменять природу соединительной ткани и влиять на сокращение гладких мышц. Известно, что Н2 преимущественно экспрессируется в репродуктивной ткани (см. US 5023321). Однако в ходе создания настоящего изобретения установлено, что Н2 играет важную роль в улучшении заживления ран и в менее выраженном формировании рубца.

Агонисты релаксина

В некоторых вариантах осуществления настоящего изобретения в описании предусматривают способы, включающие введение агониста релаксина. В некоторых способах агонист релаксина активирует один или несколько близких релаксину связанных с G-белком рецепторов (G-protein coupled receptors - GPCR), выбранных из RXFP1, RXFP2, RXFP3, RXFP4, FSHR (LGR1), LHCGR (LGR2), TSHR (LGR3), LGR4, LGR5, LGR6, LGR7 (RXFP1) и LGR8 (RXFP2), но ими перечень не ограничивается. В некоторых вариантах осуществления настоящего изобретения агонист релаксина включает последовательность формулы I из патентной заявки WO 2009/007848 фирмы Compugen (включенной в настоящее изобретение в виде ссылки для представления последовательностей агонистов релаксина).

Пептиды формулы I содержат предпочтительно 7-100 аминокислот в длину и включают аминокислотную последовательность: X1-Х2-Х3-Х4-Х5-Х6-Х7-Х8-Х9-Х10-X11-Х12-Х13-Х14-Х15-Х16-Х17-Х18-Х19-Х20-Х21-Х22-Х23-Х24-Х25-Х26-Х27-Х28-Х29-Х30-Х31-Х32-Х33; где X1 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; Х2 отсутствует или означает Q или полярную природную или неприродную аминокислоту; Х3 отсутствует или означает К или основную природную или неприродную аминокислоту; Х4 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; Х5 отсутствует или означает Q или S полярную природную или неприродную аминокислоту; Х6 отсутствует или означает V, или А, или Р, или М, или полярную природную или неприродную аминокислоту; Х7 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; Х8 отсутствует или означает Р, или L, или А, природную или неприродную аминокислоту; Х9 отсутствует или означает Р или Q, природную или неприродную аминокислоту; Х10 отсутствует или означает G или низкомолекулярную природную или неприродную аминокислоту; X11 отсутствует или означает А, или Н, или Е, или D, или гидрофобную или низкомолекулярную или кислую природную или неприродную аминокислоту; Х12 отсутствует или означает А, или Р, или Q, или S, или R, или Н, или гидрофобную или низкомолекулярную природную или неприродную аминокислоту; Х13 отсутствует или означает С, или V, или гидрофобную природную или неприродную аминокислоту; Х14 отсутствует или означает R, или K, или Q, или Р, или основную иди полярную природную или неприродную аминокислоту; Х15 отсутствует или означает R, или Q, или S, или основную или полярную природную или неприродную аминокислоту; Х16 отсутствует или означает А, или L, или Н, или Q, или гидрофобную или низкомолекулярную природную или неприродную аминокислоту; Х17 отсутствует или означает Y или гидрофобную или ароматическую природную или неприродную аминокислоту; X18 отсутствует или означает А или гидрофобную или низкомолекулярную природную или неприродную аминокислоту; X19 отсутствует или означает А или гидрофобную низкомолекулярную природную или неприродную аминокислоту; Х20 отсутствует или означает F или гидрофобную или ароматическую природную или неприродную аминокислоту; Х21 отсутствует или означает S, или Т, или полярную природную или неприродную аминокислоту; Х22 отсутствует или означает V, или гидрофобную природную или неприродную аминокислоту; Х23 отсутствует или означает G, или гидрофобную, или низкомолекулярную неприродную аминокислоту, или замещен амидом; Х24 отсутствует, или означает R, или основную природную, или неприродную аминокислоту; Х25 отсутствует, или означает R, или основную природную, или неприродную аминокислоту; Х26 означает А, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту; Х27 означает Y, или гидрофобную, или ароматическую природную или неприродную аминокислоту; Х28 означает А, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту; Х29 означает А, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту; Х30 означает F, или гидрофобную природную или неприродную аминокислоту; Х31 означает S, или Т, или полярную природную или неприродную аминокислоту; Х32 означает V, или гидрофобную природную или неприродную аминокислоту; Х33 отсутствует или означает G, или гидрофобную, или низкомолекулярную природную или неприродную аминокислоту, или замещен на амид; или его фармацевтически приемлемую соль (SEQ ID NO:4). В некоторых вариантах осуществления настоящего изобретения агонист релаксина представляет последовательность пептида P59C13V (свободная кислота) GQKGQVGPPGAA VRRA Y AAFSV (SEQ ID NO:5). В другом предпочтительном варианте осуществления настоящего изобретения агонист релаксина представляет последовательность пептида P74C13V (свободная кислота) GQKGQVGPPGAA VRRA Y AAFS VGRRA Y AAFS V (SEQ DD NO:6). Другие производные комплемент C1Q фактор некроза опухоли-родственного белка 8 (CTRP8 или C1QT8), например, пептид P59-G (свободная кислота Gly) GQKGQVGPPGAACRRA Y AAFSVG (SEQ ID NO:7), также могут быть пригодны для применения в способах по настоящему изобретению. Аминокислотная последовательность C1QT8 представлена далее в виде последовательности SEQ ID NO:8

MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSGHLVKPAAEL.

Настоящее изобретение также охватывает гомологи этих полипептидом, такие гомологи могут быть по меньшей мере на 50%, по меньшей мере на 55%, по меньшей мере на 60%, по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или на 100% идентичны аминокислотной последовательности типичного агониста релаксина (например, SEQ ID NO:5 или SEQ ID NO:6), что можно определить, используя программное обеспечение BlastP Национального центра биотехнологической информации (National Center of Biotechnology Information - NCBI), используя параметры по умолчанию, необязательно и предпочтительно включая следующие: фильтрация (эта опция фильтрует повторяющиеся или мало отличающиеся последовательности по запросу, используя программу Seg (белок)), матрицей оценки является BLOSUM62 для белков, размер слова равен 3, величина Е составляет 10, цены гэпов составляют 11,1 (инициализация и (инициализация и удлинение). Необязательно и предпочтительно идентичность/гомологию последовательности нуклеиновой кислоты определяют с помощью программного обеспечения BlastN Национального центра биотехнологической информации (NCBI), используя параметры по умолчанию, которые предпочтительно включают применение фильтрующей программы DUST, а также предпочтительно включают наличие величины Е, равной 10, фильтрацию мало усложненных последовательностей и размер слова 11. В заключении, настоящее изобретение также предусматривает фрагменты описанных выше полипептидов и полипептиды с мутациями, например, делениями, инсерциями или замещениями одной или нескольких аминокислот, полученными естественным или искусственным путем, случайно или направленно.

Лечение релаксином активирует лечение ран

При повреждении кожи, например, из-за пореза, образуется влажная рана и возникает естественный для тела процесс регенерации собственно кожной и эпидермальный ткани для репарации повреждения, состоящей из серии сложных биохимических событий. Релаксин повышает и ускоряет этот процесс. На ранних стадиях заживления раны, если бактерии и инородные вещества или остатки органических веществ удалены из раны, новые кровеносные сосуды формируются из клеток эндотелия в результате процесса ангиогенеза. Кроме того, фибробласты растут и формируют новый внеклеточный матрикс (ВКМ) за счет экскреции коллагена и фибронектина. Настоящее изобретение предусматривает способы ускорения природного процесса заживления ран и повышает прочность в месте раны за счет повышения формирования грануляции ткани, в итоге уменьшая число кровеносных сосудов, возникающих в результате ангиогенеза, повышая отложение коллагена, способствуя формированию лучше организованного коллагенового матрикса и активируя реэпитализацию раны. В некоторых случаях, если раны не заживают должным образом (например, у диабетиков и индивидуумов с кожным расстройствами), лечение релаксином не просто повышает заживление ран, а делает его возможным.

Более конкретно, в настоящем изобретении установлено, что преимуществом релаксина является его способность активировать заживление раны в ходе двухстадийного процесса. Во-первых, релаксин активирует фибробласты и стимулирует ангиогенез для лучшего заживления путем быстрого закрытия раны. Во-вторых, релаксин обладает анти-фибротическим и анти-ангиогенным эффектами для достижения гладкого заживления, тем самым, снижая формирование рубцов. То обстоятельство, что релаксин обладает анти-ангиогенными эффектами, является новым фактом, который противоположен устоявшемуся мнению, что релаксин только стимулирует рост кровеносных сосудов и тем самым повышает ангиогенез.

Фибробласты играют важнейшую роль в поддержании структурной целостности соединительных тканей за счет непрерывно секретируемых предшественников ВКМ. При нормальных условиях фибробласты находятся в состоянии покоя. Однако при активировании фибробластов во влажной ране они секретируют больше коллагена. Релаксин участвует в активировании фибробластов, что приводит к повышенной секреции коллагена. Фибробласты также секретируют матриксные металлопротеиназы (ММП), которые способствуют разрушению коллагена. Релаксин также может ингибировать пролиферацию TGF-бета коллаген индуцированных фибробластов и выработку коллагена. Таким образом, такая комбинация повышенной секреции коллагена и повышенного метаболизма коллагена приводит к более организованному и сильному коллагеновому матриксу, что активирует заживление ран и снижает формирование рубцов.

Ангиогенез происходит очень рано в процессе заживления ран. Хотя макрофаги и лимфоциты рекрутируются в место раны, новые кровеносные сосуды формируются для обеспечения раны достаточным кровоснабжением. Конкретно макрофаги высвобождают фактор VEGF, который стимулирует формирование новых кровеносных сосудов. Если релаксин используют для лечения, количество VEGF повышается, приводя к увеличению числа кровеносных сосудов и, таким образом, больше крови поступает к ране.

Весь процесс рекрутинга иммунной системы, формирования новых кровеносных сосудов (ангиогенеза) и активирования фибробластов вместе рассматриваются в качестве процесса грануляции - т.е. процесса, в результате которого ткань формируется. В некоторый момент такая грануляция должна быть растворена для окончательного достижения желательной структуры коллагена, собранного наподобие плетенки, свойственной нормальной здоровой гладкой коже. Это вызывает медленное снижение количества фибробластов, поскольку дополнительного коллагена не требуется, и медленное понижение действия иммунной системы, поскольку воспаление должно понизиться и красные пятна в коже могут исчезнуть. Кроме того, процесс ангиогенеза должен измениться на противоположный, т.е. кровеносные сосуды и капилляры, которые были нужны для того, чтобы сначала вылечить рану, теперь должны исчезнуть, чтобы предупредить образование уродливого постоянного красного шрама. Неожиданно релаксин не только повышает и ускоряет разрушение грануляции, но он также способствует исчезновению новых кровеносных сосудов, оставляя кожу гладкой и без красных отметин. Следует отметить, что лечение релаксином резко снижает формирование рубцов и повышает здоровый внешний вид кожи со структурой коллагена, собранного наподобие плетенки.

Кроме того, релаксин может активировать заживление ран при кровоподтеках и язвах. Такие раны предпочтительно лечат системно, поскольку при местном лечении релаксин не поступает в закрытые раны с той же легкостью, что и в открытые или влажные раны. Однако открытые и влажные раны предпочтительно лечат местно через орошение и/или прямые инъекции (что показано в примере 1 по исследованию кожи свиней).

Лечение релаксином предупреждает и снижает формирование рубцов

Рубцы включают фиброзную ткань и замещают нормальную ткань после повреждения или раны. Рубцевание является нормальной частью процесса заживления ран, и шрамы возникают после практически ежедневного повреждения кожи. Каждый год в развитых странах у 100 миллионов человек возникают шрамы, некоторые из которых существенно влияют на здоровье и создают психологические проблемы, в результате 55 миллионов плановых операций и 25 миллионов операций после травм. Подсчитано, что имеется 11 миллионов келоидных рубцов и 4 миллиона Ожеговых рубцов, 70% из которых имеются у детей. Люди с нарушенным рубцеванием кожи могут соприкоснуться с физическими, эстетическими, психологическими и социальными последствиями, которые могут быть связаны с большими эмоциональными и финансовыми затратами. Хотя шрамы часто считают незначительными нарушениями, они могут уродовать и выглядеть эстетически неприятно, вызывать тяжелый зуд, болезненность, боль, нарушение сна, беспокойство, депрессию и нарушение дневной активности. Другие психологические последствия включают развитие реакций посттравматического стресса, утрату собственного «я», стигматизацию, приводят к ухудшенному качеству жизни. Физическое обезображивание в результате появления шрамов может приводить к потере трудоспособности. Несмотря на то, что средства массовой информации говорят об обратном, шрамы нельзя удалить с легкостью из-за сложной и непрогнозируемой природы ткани шрама (Bayat и др., Clinical Review - BMJ, 326, 2003, с.88). Релаксин предоставляет способ лечения таких шрамов не только за счет ускорения процесса заживления ран, но также за счет снижения формирования шрамов до начала их формирования.

Обычно шрамы формируются в результате лицевой пластической хирургии, к которой относятся, но которыми перечень не ограничивается, косметическая операция по удалению морщин, блефаропластика, ринопластика, отопластика, ментопластика, подтяжка лица, подтяжка лба, подтяжка бровей, изменение шрамов на лице, удаление шрамов на лице, лазерная хирургия, шлифовка кожи, удаление складок, плазмолифтинг, моделирование контуров лица собственными жировыми трансплантатами, натяжение кожи, удаление татуировок и замещение волос. Кроме того, лицевая пластическая хирургия часто может приводить к набуханиям, кровоизлияниям и рубцеванию. При этом релаксин особенно применим в пластической и реконструктивной хирургии. Опухание - нормальная реакция лица на повреждение, которая может снижаться по мере самоизлечения лица и которая может длиться несколько дней после хирургического вмешательства и поддерживаться до нескольких недель или больше. Кровоизлияние также является естественным последствием лицевой хирургии, поскольку лицо реагирует на изменения, и обычно наиболее выражено в течение нескольких первых суток восстановления после хирургического вмешательства. Хотя большинство кровоизлияний может исчезнуть за несколько недель, полное выздоровление может занять месяцы или более, в зависимости от индивидуума. Рубцевание представляет другой нежелательный побочный эффект лицевой пластической хирургии, поскольку шрамы обычно сохраняют розовый цвет в течение нескольких месяцев, прежде чем они становятся незаметными. Таким образом, настоящее изобретение полезно для пациентов, которые подвергаются лицевой пластической хирургии, особенно чтобы содействовать лечению при рубцевании и кровоизлиянии за счет ускорения процесса лечения и снижения формирования рубцов.

Рубцы также обычно формируются в результате пластической хирургии всего тела, которая включает, но ими не ограничивается, пластику передней брюшной стенки, уменьшение молочной железы, увеличение молочной железы, процедуры бодилифтинга, лечение паутинных сеточек сосудов, лечение растяжек кожи, липосакция, хирургическое удаление избытков кожи, уменьшение целлюлита, оконтуривание тела, шлифовка тела и импланты тела. Пластическая хирургия всего тела часто также приводит к опуханию, кровоподтекам и рубцеванию. Опухание - реакция организма на повреждение, которая обычно исчезает по мере самоизлечения и может быть только несколько суток после операции или длиться до нескольких недель или более. Кровоподтеки в норме являются результатом хирургического вмешательства на всем организме, поскольку тело реагирует на изменения. Кровоподтеки обычно наиболее выражены в первые несколько суток восстановления после операции, но могут сохраняться дольше. Хотя большинство кровоподтеков может обесцветиться за пару недель, полное заживление может занять месяцы или даже годы. Рубцевание также является неприятным побочным эффектом хирургического вмешательства на всем теле, поскольку рубцы обычно остаются розовыми в течение нескольких месяцев прежде, чем они становятся мало заметными. Таким образом, настоящее изобретение также полезно для пациентов, перенесших пластическую хирургию на всем теле, особенно это выражается в воздействии на рубцевание и кровоподтеки за счет заживления ран и понижения формирования рубцов.

Рубцевание и покраснение также являются распространенными побочными эффектами удаления татуировок. К другим побочным эффектам относятся волдыри, инфекции и изменение цвета кожи. Таким образом, настоящее изобретение предусматривает способ минимизации некоторых побочных эффектов от удаления татуировок, особенно понижая красноту кожи (т.е. анти-ангиогенный эффект релаксина, обсуждавшийся выше) и понижая какие-либо рубцы, которые могут возникнуть из-за процедуры удаления татуировок.

Композиции и составы с релаксином

Релаксин и аналоги релаксина перерабатывают в фармацевтические средства для применения в способах по настоящему изобретению. Какая-либо композиция или соединение, которые могут стимулировать биологический ответ, ассоциированный со связыванием биологически или фармацевтически действующего релаксина (например, синтетического релаксина, рекомбинантного релаксина) или агониста релаксина (например, аналога релаксина или релаксин-подобного модулятора) с рецепторами релаксина, могут применяться в качестве фармацевтических средств в настоящем изобретении. Основные детали по методам, составам и введению описаны в научной литературе (см. кн.: «Remington's Pharmaceutical Sciences», изд-во Maack Publishing Co, Easton, Пенсильвания). Фармацевтические составы, содержащие фармацевтически действующий релаксин, могут быть получены методом, известным в данной области для получения фармацевтических средств. Составы, содержащие фармацевтически действующий релаксин или агонист релаксина, используемые в способах настоящего изобретения, могут быть переработаны для введения каким-либо обычным приемлемым способом, включая, но ими не ограничиваясь, местное, внутривенное, системное, подкожное, внутримышечное, подъязычное введение и введение путем ингаляции или инъекции, орошения или осмотического насоса. Ниже приводятся в качестве иллюстрации примеры осуществления настоящего изобретения.

В одном предпочтительном варианте осуществления настоящего изобретения релаксин может применяться для орошения открытой раны, в качестве местного нанесения на затянувшуюся рану и/или системно на протяжении какой-либо стадии восстановления раны. Полагают, что состав может быть введен инъекцией около места раны или шрама, или может быть в виде крема, который наносят на место раны или рубца для увеличения места пребывания и проникновения. Лечение через орошение включает, например, медленное капельное вливание в место раны 0,5 мл раствора релаксина в концентрации 1,0 мг/мл в натрий ацетате. В других вариантах осуществления настоящего изобретения диапазоны для капельного вливания растворов релаксина в раны могут варьировать примерно от 0,5 мл до примерно 5,0 мл или выше растворов релаксина в концентрации примерно от 1,0 до примерно 5,0 мг/мл релаксина в место раны. Раны орошают, например, раз в сутки в течение семи суток после возникновения повреждения. В другом варианте осуществления настоящего изобретения раны орошают, например, два раза в сутки или чаще в течение примерно семи суток после возникновения повреждения. В еще одном из вариантов осуществления настоящего изобретения после возникновения повреждения раны орошают еженедельно или раз в месяц в течение более длительного или более краткого периода. Дозы введения релаксина следует устанавливать в зависимости от тяжести повреждений и состояния пациента.

В еще одном из вариантов осуществления настоящего изобретения релаксин может применяться местно, например, для высвобождения 0,5 мл раствора релаксина в концентрации 0,5 или 2,5 мг/мл в составе, содержащем 76,5% 20 мМ натрий ацетатного буфера, 0,17% метилпарабена, 0,03% пропилпарабена, 5% пропиленгликоля, 5% этанола, 1% HED 250HX и 12,285% релаксина в натрий ацетатном буфере. Раны обрабатывают, например, дважды в сутки в течение 2 недель с последующим лечением раз в сутки в течение 3 недель. Если лекарственные средства доставляются местно, состав включает пропиленгликоль и этанол. Кроме того, в настоящем изобретении установлено, что эффективность релаксина повышается, если в состав включены агенты повышения проницаемости, которые могут присоединиться к влажной ране. К агентам повышения проницаемости относятся, но ими перечень не ограничивается, физические факторы (например, наборы микроигл), химические агенты (например, этанол, глицерилмоноэтиловый эфир, моноглицериды, изопропилмиристат и др.) или комбинации физических и химических усилителей. Например, в настоящем изобретении установлено, что добавление усилителей мукоадгезивного проникновения, например, хитозана, повышает проникновение релаксина сквозь ткани десны (см. Squier и др. в кн.: «Mucoadhesive vehicles for the delivery of relaxin across oral mucosa», Международная Ассоциация Стоматологов, 28 июня - 1 июля, 2006, Brisbane, Австралия).

В еще одном предпочтительном варианте осуществления настоящего изобретения при системном подходе релаксин высвобождается непосредственно в рану осмотическим инфузионным насосом с интенсивностью 5,3 мкг/кг/ч для достижения системных концентраций примерно 20 нг/мл.

В еще одном предпочтительном варианте осуществления настоящего изобретения релаксин может быть доставлен к месту раны внутривенной инъекцией, причем составы содержат фармацевтически действующий релаксин или агонист релаксина и могут быть в форме стерильного инъекционного препарата, например, стерильной инъекционной водной или масляной суспензии. Эта суспензия может быть переработана в соответствии с известными в данной области методами, используя такие соответствующие разрыхляющие или увлажняющие агенты и суспендирующие агенты, указанные выше. Стерильный инъекционный препарат также может быть стерильным инъекционным раствором или суспензией в нетоксичном пригодном для парентерального применения разбавителя или растворителя. К приемлемым растворителям и разбавителям, которые могут применяться, относятся вода и раствор Рингера, изотонический раствор хлорида натрия. Кроме того, стерильные нелетучие масла обычно могут применяться в качестве растворителя или суспендирующей среды. Для этого может применяться какое-либо нелетучее масло, в том числе синтетические моноглицериды или диглицериды. Кроме того, жирные кислоты, например олеиновая кислота, также может использоваться при получении инъекционных препаратов.

Водные суспензии по настоящему изобретению содержат релаксин в смеси с эксципиентами, пригодными для получения водных суспензий. К таким эксципиентами относится суспендирующий агент, например, натриевая соль карбоксиметилцеллюлозы, метилцеллюлоза, гидроксипропилметилцеллюлоза, альгинат натрия, поливинилпирролидон, трагакант и камедь акации аравийской, а также разрыхляющие или увлажняющие агенты, например, природные фосфатиды (например, лецитин), продукт конденсации оксида алкилена с жирной кислотой (например, стеарат полиоксиэтилена), продукт конденсации оксида этилена с длинноцепочечным алифатическим спиртом (например, гептадекаэтиленоксицетанолом), продукт конденсации оксида этилена с неполным сложным эфиром, производным жирной кислоты и гекситола (например, плиоксиэтиленсорбитолмоноолеат), или продукт конденсации оксида этилена с неполным сложным эфиром, производным жирной кислоты и ангидридом гекситола (например, полиоксиэтиленсорбитанмоноолеат). Водная суспензия также может содержать один или несколько консервантов, например, этил или n-пропил p-гидроксибензоат, один или несколько окрашивающих агентов, один или несколько ароматизирующих агентов и один или несколько подсластителей, например, сахарозу, аспартам или сахарин. Составы могут быть отрегулированы по осмолярности.

Масляные суспензии могут быть переработаны путем суспендирования релаксина в растительном масле, например, арахисовом масле, оливковом масле, кунжутном масле или кокосовом масле или минеральном масле, например, жидком парафине. Масляные суспензии могут содержать загуститель, например, пчелиный воск, твердый парафин или цетиловый спирт. Подсластители могут быть добавлены для получения перорального препарата приятного вкуса. Эти составы могут быть сохранены добавлением антиоксиданта, например, аскорбиновой кислоты.

Дисперсные порошки и гранулы по настоящему изобретению, пригодные для получения водной суспензии добавлением воды, могут быть переработаны из релаксина в смеси с диспергирующим, суспендирующим и/или увлажняющим агентом с одним или несколькими консервантами. Соответствующие диспергирующие или увлажняющие агенты и суспендирующие агенты представлены указанными выше примерами. Также могут содержаться дополнительные эксципиенты, например, подсластители, ароматизаторы и красители.

Фармацевтические составы по настоящему изобретению также могут быть в форме эмульсий масло в воде. Фаза масла может быть представлена растительным маслом, например, оливковым маслом или арахисовым маслом, минеральным маслом, например, жидким парафином или их смесью. К соответствующим эмульгирующим агентам относятся природные камеди, например, гуммиарабик и трагакант, природные фосфатиды, например, соевый лецитин, сложные эфиры или неполные сложные эфиры, производные жирной кислоты и ангидридгекситола, например, сорбитанмоноолеат, и продукты конденсации неполных сложных эфиров с оксидом этилена, например, полиоксиэтиленсорбитанмоноолеат. Эмульсия также может содержать подсластители и ароматизаторы. Сиропы и эликсиры могут быть переработаны с подсластителями, например, с глицерином, сорбитом или сахарозой. Такие составы также могут содержать смягчающий агент, консервант, ароматизатор или краситель.

Введение и режимы дозирования составов с релаксином

Составы, содержащие фармацевтически действующий релаксин и используемые в способах по настоящему описанию, могут вводиться каким-либо приемлемым способом, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное, подъязычное, местное, пероральное и ингаляционное введение. Введение может варьировать в зависимости от фармакокинетических и других свойств лекарственных средств и состояния здоровья пациентов. Общие рекомендации приведены ниже.

Способы по настоящему изобретению активируют заживление ран и повреждений, а также снижают формирование рубца. Количество релаксина, одного или в комбинации с другим фармацевтически действующим агентом (например, нестероидным противовоспалительным лекарственным средством (НСПВЛС) или антибиотиком), которое соответствует осуществлению этих эффектов, расценивают в качестве терапевтически эффективной дозы (например, в качестве фармацевтически приемлемого количества для активации заживления).

Состояние в настоящей области позволяет клиницистам определить режим дозирования релаксина для каждого отдельного животного или человека. В качестве иллюстрации представленные ниже рекомендации для релаксина могут применяться в качестве руководства по определению режима дозирования, т.е. схемы дозирования и уровней доз, для составов, содержащих фармацевтически действующий релаксин, введенный при осуществлении способов по настоящему изобретению. В частности, такие субъекты получают фармацевтически действующий релаксин человека Н2 (например, синтетический, рекомбинантный) в количестве примерно 10-1000 мкг/кг массы тела субъекта в сутки. В одном из вариантов осуществления настоящего изобретения дозы релаксина составляют 10, 30, 100 и 250 мкг/кг/сутки. В еще одном из вариантов осуществления настоящего изобретения указанные дозы приводят к концентрациям в сыворотке релаксина примерно 3, 10, 30 и 75 нг/мл, соответственно. В другом варианте осуществления настоящего изобретения введение релаксина продолжают поддерживать концентрацию релаксина в сыворотке примерно от 0,5 до примерно 500 нг/мл, более предпочтительно примерно от 0,5 до примерно 300 нг/мл, и наиболее предпочтительно примерно от 3 до примерно 75 нг/мл. Допустимый диапазон составляет примерно от 1 до примерно 50 нг/мл, причем предпочтительная концентрация в сыворотке составляет 20 нг/мл.

Исходя из общих рекомендаций, предполагают, что суточная доза фармацевтически действующего релаксина Н2 человека (например, синтетического, рекомбинантного) обычно находится в диапазоне примерно 10-1000 мкг/кг массы тела субъекта в сутки, наиболее предпочтительно примерно 960 мкг/кг массы тела субъекта в сутки. В зависимости от субъекта введение релаксина поддерживается на протяжении определенного периода или на протяжении времени, достаточного для достижения стабильности у субъекта.

Примеры

Приводимые конкретные примеры предназначены проиллюстрировать настоящее изобретение, и их не следует рассматривать в качестве вариантов, ограничивающих область охвата настоящего изобретения, изложенную в формуле изобретения.

Пример 1

Исследование ран на коже свиней

Общая схема исследования животных. При отборе соответствующего животного для настоящего исследования выбирают свиней, поскольку их шкура анатомически схожа с кожей человека. В самом деле, заживление ран у свиней используют в многочисленных исследованиях для имитации кожи человека (Sullivan и др., Wound Repair Regen. 9, 2001, cc.66-76). Результаты этого исследования означают, что в коже свиней релаксин снижает гранулирование ткани, а также хроническое воспаление, тем самым, приводя в целом к более быстрому процессу заживления и гладкому состоянию кожи.

Схема эксперимента. В настоящем исследовании молодым особям свиней наносят по 12 ран на каждое животное - 20×6 мм резаных ран на спине - на протяжении курса исследования длительностью шесть недель (см. фиг.2). Системный релаксин доставляют с помощью мини-насосов для достижения концентрации в сыворотке 20 нг/мл. Составы местного применения получают от фирмы Dow Pharma, они включают пропиленгликоль и этанол, которые влияют на хорошую длительную стабильность терапевтического агента. Получают дозы, состоящие из плацебо, 0,5 мг/мл (низкая доза) и 2,5 мг/мл (высокая доза). Цели настоящего изобретения заключаются в проведении оценки безопасности местно применяемого релаксина при заживлении ран и для определения эффективности релаксина в качестве лечащего средства для заживления ран и/или формирования рубца. На протяжении первой недели орошение проводят ежедневно. На протяжении 2-3 недель местный состав применяют дважды в сутки, а на протяжении 3-6 недель местный состав применяют раз в сутки.

Разработка лекарственного средства. Исследуемым лекарственным средством является релаксин (получаемый методом рекомбинации). Рекомбинантный релаксин идентичен нативному гормону человека релаксину Н2, получаемому с применением процесса рекомбинации одной цепи. Тестируемое на активность соединение может быть асептически разведено до требуемой концентрации ацетатным растворителем (20 мМ натрий ацетат, рН 5,0).

Стадии исследования. Из фиг.3, показывающей расположение на спине свиней резаных ран, произведенных согласно указанному выше, к концу шестой недели следует, что рану пореза 3 орошают конструкцией релаксина на протяжении первой недели и затем лечат высокой дозой местно применяемого состава релаксина на протяжении 2-6 недель согласно описанному выше. В порезах 4, 5 и 6 не производят орошения на протяжении 1 недели. В порезе 4 лечат плацебо. В порезе 5 лечат низкой дозой местно применяемого состава, и в порезе 6 лечат высокой дозой местно применяемого состава.

Сравнение пореза 4 с каждым из порезов 5 и 6 четко показывает улучшение заживление ран только при местном лечении релаксином по сравнению с плацебо. Еще более существенно сравнение с порезом 3, где получают лечение орошением релаксином дополнительно к местному лечению. Эксперимент показывает поразительное действие релаксина по активации лечения ран и по снижению и/или предупреждению рубцевания по сравнению с плацебо. Результаты также показывают, что орошение конструкцией релаксина особенно эффективно.

Косметическое состояние кожи. Визуальную оценку ран проводят независимые наблюдатели, которые оценивают струпья при раннем заживлении ран (5-7 сутки) и рубцы в конце исследования (см. фиг.4). Состояние ран для оценки проводят эксперты, которые не являются дерматологами. Экспертам не объясняют суть лечения и просят оценить картину по их собственным критериям, выбирая и ранжируя лучшие три группы из шести групп (каждая с 8 фотографиями), из которых в трех группах получали релаксин, а в трех группах не получали. Результаты такой визуальной оценки ран показывают, что на протяжении 89% времени группу лечения релаксином выбирают в лучшие три группы. Только на протяжении 11% времени группу, в которой не лечили релаксином, выбирают в число лучших трех. Независимые наблюдатели выбирают раны, обработанные релаксином, в качестве «лучших». Эти данные четко означают, что релаксин может помочь раннему закрытию ран.

Через 2, 4 и 6 недель также проводит косметическую оценку профессиональный дерматолог. Косметическая оценка включает пять компонентов: (1) цвет - типирование относительно окружающей ткани; (2) структуру ткани - без уплотнений; (3) искажение - отсутствует искажение окружающей ткани; (4) конфигурация - покраснение окружающей кожи; (5) общее состояние раны - отсутствует гипертрофия или формирование коллоида. Во время дерматологической оценки через 2 недели рубцы трудно оценить четко, поэтому данные по косметическим оценкам получают только по результатам оценки через 4 и 6 недель (см. фиг.5). Фиг.6 показывает разницу между местами ран через 6 недель. На верхнем профиле (лечение релаксином) рубец невидим. На нижнем профиле рубец виден. Области ран/рубцов, которые орошали релаксином, получали более высокую оценку по сравнению с ранами/рубцами, которые лечили релаксином только местно.

Гистологическая оценка. Профессиональный гистопатолог оценивает патологию лечения по следующим показателям: грануляция, воспаление и некроз. При рассмотрении гранулированной ткани сделан вывод, что ранняя реакция на рану включает инвазию места раны фибробластами, воспалительными клетками и новыми кровеносным сосудами. По прошествии времени это приводит к более нормальной ткани в месте лечения. Хроническое воспаление отличается по наличию макрофагов, гигантских клеток, лимфоцитов и полиморфоядерных нейтрофилов, указывающих на побочную реакцию. Также рассматриваются минорные факторы, например, кератоз (формирование кератинового слоя с внешней стороны эпидермиса) и акантоз (истончение эпидермального слоя).

Фиг.7 и 8 показывают, что отсутствуют побочные эффекты, связанные с лечением релаксином. Грануляция ткани становится меньше при системном лечении релаксином (т.е. это показатель быстрого рассасывания раны под действием релаксина). В итоге снижается хроническое воспаление под действием системно введенного релаксина, что еще раз свидетельствует об активировании за счет лечения релаксином более быстрого заживления (см. фиг.9, 10).

При оценке излечивания ран профессиональный гистолог использует гистологическую оценку, которая учитывает систему оценки состояния ран, организацию коллагена, определенную по подсчетам красных пикселей (подсчитанных компьютерной программой - соотношение красных пикселей в области рубца к окружающей ткани показывает относительную организацию коллагена) и кровеносных сосудов по окрашиванию фактора viii (см. фиг.12, 13). Оценку заживления ран проводят следующим образом: 3 балла - переплетенная сборка коллагеновых волокон (наилучшее излечение); 2 балла - переходное состояние сборки и структуры коллагеновых волокон; и 1 балл - коллагеновые волокна собраны в параллельные тяжи или в одну плоскость (наихудшее заживление). Наилучшее заживление подтверждается переплетенной сборкой коллагеновых волокон, сходной с нормой, но меньше по размеру по сравнению со здоровой собственно кожей (см. фиг.11).

Таким образом, было установлено, что при каком-либо лечении релаксином отсутствуют побочные эффекты (т.е., при орошении или местном введении). Кроме того, с лечением релаксином не было связано случаев некроза или воспаления. Есть свидетельства, что лучшее заживление ран происходит при системном лечении релаксином по сравнению с его местным введением.

Результаты и обсуждение. Настоящее экспериментальное исследование является первым, в котором использовано применение релаксина на коже животных. Главная цель, выдвигавшаяся в настоящем изобретении, заключается в установлении безопасности местного нанесения релаксина на рану для их заживления. Вторая цель настоящего исследования - показать эффективность релаксина в лечении ран и/или формировании рубцов. В настоящем изобретении установлено следующее: (1) в широком диапазоне доз (10-960 мкг/кг/сутки) лекарственное средство не показывает побочных эффектов и хорошо переносится. (2) Релаксин оказывает лечебные воздействия в виде ускорения природного процесса заживления ран и повышения прочности в месте раны за счет повышения формирования грануляции ткани, снижения количества кровеносных сосудов, образуемых в результате ангиогенеза, повышения отложения коллагена, добавления в формирование более организованного матрикса коллагена и активизации реэпитализации раны.

Пример 2

Исследование десен у собак

Общая схема исследования собак. Релаксин человека 2 (Н2 RLX) исследуют в качестве возможного средства лечения в ортодонтии из-за его способности моделировать мягкую ткань. Предшествующие исследования на собаках, взятых в качестве модельных объектов, показали, что применение RLX в виде инъекций в десну может ускорить перемещение зубов и предупредить рецидив.

Цель настоящего исследования заключается в определении скорости миграции RLX и степени разрушения после инъекций в десну. Это исследование показывает, что RLX продолжает сосредотачиваться близко от места инъекции. Применяя собак в качестве модельных животных, вводят RLX и отбирают пункции ткани для проведения биопсии в месте инъекции и на расстоянии 0,5, 1 и 2 см от места инъекции. Ткань берут на анализ в разное время, включая 1, 2 и 4 ч после инъекции. Белок экстрагируют из взятых на биопсию образцов десны и анализируют методом ProteinChip (времяпролетная масс-спектрометрия с усиливаемой поверхностью лазерной десорбцией-ионизацией - surface-enhanced laser desorption/ionization-time of flight-mass spectrometry - SELDI-TOF-MS), который комбинируют с двумя апробированными методами твердофазной хроматографии и TOF-MS на единой платформе. Матрицы ProteinChip покрывают анти-Н2 RLX антителом, создавая специфическую ловушку для RLX и ассоциированных разрушенных/модифицированных продуктов.

RLX четко выявляют во всех трех образцах, взятых в разное время, но установлено снижение концентрации: через 1, 2 и 4 ч обнаружено 90 нМ, 78 нМ и 21 нМ Н2 RLX, соответственно. Движение RLX сквозь десну также представляется ограниченным. RLX обнаруживают на расстоянии 0,5 см от места инъекции, но не выявляют дальше, на расстоянии 1 и 2 см.

Разработка лекарственного средства. Осуществляют инъекции в десну (25 мкг Н2 RLX/100 мкл, 41 мкМ) и образцы ткани берут в разных местах, в том числе в месте инъекции и на расстоянии 0,5, 1 и 2 см от места инъекции. Ткань берут на анализ через 1, 2 и 3 ч после инъекции. Образцы ткани для биопсии берут также от контрольных животных, которые не подвергались лечению RLX.

Порядок исследования

а) Экстракция белка и количественная оценка. Замороженные образцы для биопсии десны гомогенизируют в буфере для экстракции (10 мкл/мг ткани), содержащем 10 мМ Tris-HCl, 10 мМ NaCl, 0,1% TFA и ингибитор протеазы (полный минимальный буфер, фирма Roche). Экстракт центрифугируют (6000×g) в течение 10 мин и собирают супернатант, фасуют и хранят при -80°С. Концентрацию общего белка определяют, используя анализ Bradford. Концентрации белка варьируют от 1,4 мг/мл до 2,8 мг/мл, все образцы стандартизируют до концентрации 1,4 мг/мл в экстрагирующем буфере.

б) Анализ SELDI-TOF MS - анализ десны, обработанной RLX, по матрицам PG20. Анти-Н2 RLX антитело (2 мкл/ 0,25 мг/мл; фирма Genentech) или контрольный IgG (фирма Ciphergen Biosystems) применяют для каждого пятна матрицы PS20 с предварительно нанесенным покрытием из белка G (фирма Ciphergen Biosystems). После связывания антитела чип промывают однократно ФСБ/0,5% Triton Х-100 в течение 5 мин при перемешивании (5 мкл на пятно) и затем дважды промывают ФСБ. Экстракты десны собаки (3 мкл/1,4 мг/мл) наносят на каждое пятно и инкубируют в течение 4 ч. Неспецифически связанные белки удаляют последовательным промыванием ФСБ/0,5% Triton X-100, ФСБ и 1 мМ HEPES, рН 7,2. Чипы подсушивают на воздухе и 1 мкл 50% насыщенной синапиновой кислоты в 50 об.% ацетонитриле, 0,5% трифторуксусной кислоте наносят дважды на каждое пятно, матрицы подсушивают на воздухе каждый раз между применениями. Чипы последовательно анализируют с помощью SELDI-TOF MS (фирма Ciphergen Biosystems), используя следующие наборы, лазер 220 и чувствительность 9.

в) Получение кривой Н2 RLX Std по матрицам PG20. Н2 RLX (номер партии 11835-89) закалывают в десну контрольной собаки (1,4 мг/мл) в разных концентрациях, включая 100 нМ, 50 нМ, 12,5 нМ, 6,25 нМ, 3,125 нМ и 1,56 нМ, и анализируют согласно описанному выше.

г) Оценка Н2 RLX по матрицам NP20. Исследуют Н2 RLX по матрице нормальной фазы (NP20) для оценки чистоты. Н2 RLX (1 мкл/500 нМ) нагружают на пятно, матрицу подсушивают на воздухе и дважды 50% SPA наносят на каждое пятно согласно описанному выше.

Результаты. Для подсчета уровней RLX в образцах десны после лечения получают стандартную кривую Н2 RLX. Устанавливают линейный динамический диапазон в два порядка с величиной R2=0,9495.

Оценка лечения десен собак показывает, что RLX присутствует во всех трех временных точках, но наблюдают четкое снижение концентрации; через 1, 2 и 4 ч устанавливают содержание Н2 RLX, составляющее 90 нМ, 78 нМ и 21 нМ, соответственно. Показано, что RLX ограниченно мигрирует через десну. Через 1 ч RLX обнаруживают на расстоянии 0,5 см от места инъекции, но не выявляют на расстоянии 1 см и 2 см от места инъекции. В остающиеся временные точки RLX определяют только в месте инъекции (см. фиг.15).

Заключение. Таким образом, настоящее изобретение, включающее обработку релаксином десен собак, четко показывает, что релаксин сосредоточен близко к месту инъекции, достигая местного нацеливания без необходимости инъекции релаксина в разных точках вдоль рубца.

Пример 3

Исследование частично заживленных открытых кожных ран у людей

Частично заживленные открытые кожные раны обычно содержат сгустки, причем предварительный слой внеклеточного матрикса и фибрина укладывается для того, чтобы связать сгусток и ткань. Цель настоящего исследования заключается в определении безопасности релаксина для частично заживленных ран, эффективности в заживлении ран у людей и/или формировании рубцов, и наиболее эффективного способа доставки релаксина к частично заживленной ране для активирования требуемых результатов.

Релаксин вводят в комбинации по меньшей мере с одним другим фармацевтически действующим агентом, который может быть нестероидным противовоспалительным лекарственным средством (НСПВЛС) или антибиотиком. В первой серии экспериментов релаксин вводят инъекцией в место раны. Во второй серии экспериментов частично заживленную рану заново вскрывают хирургически путем удаления тонкого слоя уже отложившегося коллагенового матрикса и релаксин вводят орошением, которое включает медленное прокалывание 0,5 мл 1,05 мг/мл раствора релаксина в ацетате натрия в место раны. В третьей серии экспериментов частично заживленную рану хирургически заново вскрывают путем удаления тонкого слоя уже отложившегося коллагенового матрикса и релаксин вводят местно, что означает нанесение релаксина непосредственно на место раны. Местная доставка представляет 0,5 мл или 0,5 мг/мл (низкая доза), или 2,5 мг/мл (высокая доза) релаксина в составе, включающем 0,5 мл или 0,5 мг/мл, или 2,5 мг/мл релаксина в составе, включающем 76,5% 20 мМ натрий ацетатный буфер, 0,17% метилпарабен, 0,03% пропилпарабен, 5% пропиленгликоль, 5% этанол, 1% HED 250НХ и 12,285% релаксин в буфере натрия ацетата. В четвертой серии экспериментов частично заживленную рану еще раз хирургически вскрывают путем удаления тонкого слоя матрикса из коллагена, и релаксин вводят системно с помощью осмотического инфузионного насоса в количестве 5,3 мкг/кг/ч для достижения системных концентраций примерно 20 нг/мл. Рану лечат примерно дважды в сутки на протяжении двух недель, затем один раз в сутки на протяжении трех недель.

Лечение ран для каждого указанного выше способа доставки лекарственного средства сравнивают с плацебо. Визуальное ранжирование внешнего вида ран проводят с привлечением независимых наблюдателей, которые оценивают струпья на ранней стадии заживления (5-7 сутки) и рубцы в конце исследования. Состояние ран для оценки показывают экспертам, которые не являются дерматологами. Экспертам не объясняют суть лечения и просят оценить картину по их собственным критериям, выбирая и ранжируя лучшие три группы из шести групп (каждая с 8 фотографиями), из которых в трех группах получали релаксин, а в трех группах не получали.

Каждую неделю профессиональный дерматолог также проводит косметическую оценку. Косметическая оценка включает пять компонентов: (1) цвет - сравнение с окружающей ткани; (2) структуру ткани - без уплотнений; (3) искажение - отсутствует искажение окружающей ткани; (4) конфигурация - покраснение окружающей кожи; (5) общее состояние раны - отсутствует гипертрофия или формирование коллоида.

Кроме того, профессиональный гистопатолог оценивает патологию лечения по следующим показателям: грануляция, воспаление и некроз. При оценке излечивания ран гистопатолог использует гистологическую оценку, которая учитывает систему оценки состояния ран, организацию коллагена, определенную по подсчетам красных пикселей (подсчитанных компьютерной программой - соотношение красных пикселей в области рубца к окружающей ткани показывает относительную организацию коллагена) и кровеносных сосудов по окрашиванию фактора viii. Наилучшее лечение подтверждается сплетенной организацией коллагеновых волокон, сходной с нормальным образцом, но меньше по размеру по сравнению с нормальной собственно кожей. Эта оценка важна для определения, имеются ли какие-либо побочные эффекты, связанные с каким-либо лечением релаксина.

Пример 4

Исследование открытых свежих кожных ран человека

Свежие открытые раны и повреждения кожи человека лечат в течение двух или трех часов с помощью релаксина. Цель настоящего изобретения заключается в определении безопасности лечения релаксином открытых ран у людей, эффективности лечения ран человека и/или формирования рубцов и наиболее эффективного способа высвобождения релаксина в открытую рану для активирования требуемых результатов. Повреждение может быть порезом, который может быть рассечением эпителия или раной (открытой или закрытой). К открытым ранам могут относиться, но ими перечень не ограничивается, резаные раны, рваные раны, ссадины, колотые раны, проникающие раны, огнестрельные раны и колотые раны.

Релаксин вводят в комбинации по меньшей мере с одним другим фармацевтически действующим агентом, который может быть нестероидным противовоспалительным лекарственным средством (НСПВЛС) или антибиотиком. Способы доставки к открытой ране могут включать ее промывание, местное применение, системное применение и инъекцию.

В первой серии экспериментов релаксин вводят путем промывания раны, которое включает слабое проникновение 0,5 мл раствора, содержащего 1,05 мг/мл релаксина в натрий ацетате в место раны. Во второй серии экспериментов релаксин вводят местно, что включает применение релаксина непосредственно в место раны. Местная доставка содержит 0,5 мл раствора 0,5 мг/мл (низкая доза) или 2,5 мг/мл (высокая доза) релаксина в составе, содержащем 0,5 мл раствора 0,5 мг/мл или 2,5 мг/мл релаксина в составе, включающем 76,5% 20 мМ буфера натрий ацетата, 0,17% метилпарабена, 0,03% пропилпарабена, 5% пропиленгликоля, 5% этанола, 1% HED 250HX и 12,285% релаксина в натрий ацетатном буфере. В третьей серии экспериментов релаксин вводят системно через осмотический инфузионный насос при нагрузке 5,3 мкг/кг/ч для достижения концентраций в организме примерно 20 нг/мл. В четвертой серии экспериментов релаксин вводят инъекцией в место ранения или близко к нему. Свежую рану обрабатывают дважды в сутки в течение двух недель, затем один раз в сутки в течение трех недель.

Лечение ран для каждого указанного выше способа доставки лекарственного средства сравнивают с плацебо. Визуальное ранжирование внешнего вида ран проводят с привлечением независимых наблюдателей, которые оценивают струпья на ранней стадии заживления (5-7 сутки) и рубцы в конце исследования. Состояние ран для оценки показывают экспертам, но не дерматологам. Экспертам не объясняют сути лечения и их просят оценить картину по их собственным критериям, выбирая и ранжируя лучшие три группы из шести групп (каждая с 8 фотографиями), из которых в трех группах получали релаксин, а в трех группах не получали.

Каждую неделю профессиональный дерматолог также проводит косметическую оценку. Косметическая оценка включает пять компонентов: (1) цвет - сравнение с окружающей тканью; (2) структуру ткани - без уплотнений; (3) искажение - отсутствует искажение окружающей ткани; (4) конфигурация - покраснение окружающей кожи; (5) общее состояние раны - отсутствует гипертрофия или формирование коллоида.

Кроме того, профессиональный гистопатолог оценивает патологию лечения по следующим показателям: грануляция, воспаление и некроз. При оценке излечивания ран гистопатолог использует гистологическую оценку, которая учитывает систему оценки состояния ран, организацию коллагена, определенную по подсчетам красных пикселей (подсчитанных компьютерной программой - соотношение красных пикселей в области рубца к окружающей нормальной здоровой ткани показывает относительную организацию коллагена) и кровеносных сосудов по окрашиванию фактора viii. Наилучшее лечение подтверждается сплетенной организацией коллагеновых волокон, сходной с нормальным образцом, но меньше по размеру по сравнению с нормальной собственно кожей. Эта оценка важна для определения, имеются ли какие-либо побочные эффекты, связанные с каким-либо лечением релаксином.

Пример 5

Исследование ран человека, полученных в результате пластической хирургии

Открытые раны, возникающие при проведении пластической хирургии, включая пластическую хирургию и лица и всего тела, лечат в конце хирургического вмешательства релаксином для активации заживления ран и минимизации формирования шрамов. Цель настоящего изобретения заключается в определении безопасности лечения релаксином ран, эффективности лечения ран человека и/или формирования рубцов, которые возникают из-за пластической хирургии лица или всего тела, и наиболее эффективного способа доставки релаксина в рану, полученную при пластической хирургии, для активирования требуемых результатов.

Релаксин благотворен для лечения ран, которые возникают в результате лицевой пластической хирургии, к которой относятся, но которыми перечень не ограничивается, косметическая операция по удалению морщин, блефаропластика, ринопластика, отопластика, ментопластика, подтяжка лица, подтяжка лба, подтяжка бровей, изменение шрамов на лице, удаление шрамов на лице, лазерная хирургия, шлифовка кожи, удаление складок, плазмолифтинг, моделирование контуров лица собственными жировыми трансплантатами, натяжение кожи, удаление татуировок и замещение волос. Кроме того, релаксин целебен для лечения ран, которые возникают в результате пластической хирургии тела, к которой относятся, но которыми не ограничиваются, пластика передней брюшной стенки, уменьшение молочной железы, увеличение молочной железы, процедуры бодилифтинга, лечение паутинных сеточек сосудов, лечение растяжек кожи, липосакция, хирургическое удаление избытков кожи, уменьшение целлюлита, оконтуривание тела, шлифовка тела и импланты тела.

Релаксин вводят в комбинации по меньшей мере с одним фармацевтически действующим агентом, который может быть нестероидным противовоспалительным лекарственным средством (НСПВЛС) или антибиотиком. Первую дозу релаксина вводят в конце хирургического вмешательства путем орошения, которое включает медленное просачивание 0,5 мл 1,05 мг/мл раствора релаксина в натрий ацетате в место открытой раны. Впоследствии релаксин вводят местно дважды в сутки в течение двух недель и затем раз в сутки в течение трех недель. Местное введение включает применение релаксина непосредственно в месте раны. Местное высвобождение содержит 0,5 мл или 0,5 мг/мл (низкая доза), или 2,5 мг/мл (высокая доза) релаксина в составе, включающем 0,5 мл или 0,5 мг/мл, или 2,5 мг/мл релаксин в составе, включающем 76,5% буфера 20 мМ натрия ацетата, 0,17% метилпарабена, 0,03% пропилпарабена, 5% пропиленгликоля, 5% этанола, 1% HED 250HX и 12,285% релаксина в буфере натрия ацетата.

Лечение ран для каждого указанного выше способа доставки лекарственного средства сравнивают с плацебо. Визуальное ранжирование внешнего вида ран проводят с привлечением независимых наблюдателей, которые оценивают струпья на ранней стадии заживления (5-7 сутки) и рубцы в конце исследования. Состояние ран для оценки показывают экспертам, но не дерматологам. Экспертам не объясняют сути лечения и просят оценить картину по их собственным критериям, выбирая и ранжируя лучшие три группы из шести групп (каждая с 8 фотографиями), из которых в трех группах получали релаксин, а в трех группах не получали.

Каждую неделю профессиональный дерматолог также проводит косметическую оценку. Косметическая оценка включает пять компонентов: (1) цвет - сравнение с окружающей тканью; (2) структуру ткани - без уплотнений; (3) искажение - отсутствует искажение окружающей ткани; (4) конфигурация - покраснение окружающей кожи; (5) общее состояние раны - отсутствует гипертрофия или формирование коллоида.

Кроме того, профессиональный гистопатолог оценивает патологию лечения по следующим показателям: грануляция, воспаление и некроз. При оценке излечивания ран гистопатолог использует гистологическую оценку, которая учитывает систему оценки состояния ран, организацию коллагена, определенную по подсчетам красных пикселей (подсчитанных компьютерной программой - соотношение красных пикселей в области рубца к окружающей ткани показывает относительную организацию коллагена) и кровеносных сосудов по окрашиванию фактора viii. Наилучшее лечение подтверждается сплетенной организацией коллагеновых волокон, сходной с нормальным образцом, но меньше по размеру по сравнению с нормальной собственно кожей. Эта оценка важна для определения, имеются ли какие-либо побочные эффекты, связанные с каким-либо лечением релаксина.

Различные модификации и вариации настоящего описания очевидны для специалистов в данной области без отклонения от оценки и духа настоящего описания. Хотя настоящее описание приводит определенные предпочтительные варианты осуществления настоящего изобретения, можно понять, что описание, заявленное в формуле изобретения, не следует ограничивать этими предпочтительными вариантами его осуществления. В самом деле, разные модификации описанных способов осуществления настоящего изобретения, очевидные для специалистов в данной области, находятся в рамках охвата настоящего изобретения.

1. Способ улучшения косметического внешнего вида раны на коже, включающий введение фармацевтического состава, содержащего фармацевтически активный релаксин, субъекту с раной на коже в количестве, эффективном для заживления раны с улучшенным косметическим внешним видом по сравнению с заживленной раной у субъекта, не подвергавшегося лечению.

2. Способ по п.1, в котором заживленная рана по цвету больше соответствует окружающей коже.

3. Способ по п.2, в котором заживленная рана дополнительно включает переплетенную сборку коллагеновых волокон.

4. Способ по п.1, в котором указанный релаксин является очищенным, рекомбинантным или синтетическим релаксином человека H1, H2 или Н3, или агонистом релаксина.

5. Способ по п.1, в котором релаксин вводят системно субъекту и/или местно в рану на коже.

6. Способ по п.1, в котором фармацевтический состав дополнительно включает один или оба следующих лекарственных средств: антибиотик и нестероидное противовоспалительное лекарственное средство.

7. Способ снижения рубцевания при заживлении ран на коже, включающий введение фармацевтического состава, содержащего фармацевтически активный релаксин, субъекту с раной на коже в количестве, эффективном для заживления раны при пониженном рубцевании, по сравнению с заживленной раной субъекта, не подвергавшегося лечению.

8. Способ по п.7, в котором рубец выбирают из группы, состоящей из келоида, гипертрофического шрама и атрофических полосок кожи.

9. Способ по п.7, дополнительно включающий санацию раневой полости или удаление ранее имевшейся ткани рубца.

10. Способ по п.7, в котором релаксин является очищенным, рекомбинантным или синтетическим релаксином человека H1, H2 или Н3, или агонистом релаксина.

11. Способ по п.7, в котором релаксин вводят субъекту системно и/или местно в рану на коже.

12. Способ по п.7, в котором фармацевтический состав дополнительно включает одно или оба следующих лекарственных средств: антибиотик и нестероидное противовоспалительное лекарственное средство.

13. Способ по п.7, в котором субъект является человеком с ослабленной способностью к излечению.

14. Способ активации заживления ран, включающий введение фармацевтического состава, содержащего фармацевтически активный релаксин, субъекту с раной в количестве, эффективном для активации заживления раны.

15. Способ по п.14, в котором рана возникла в результате пластической хирургии.

16. Способ по п.15, в котором указанная пластическая хирургия является пластической хирургией лица или пластической хирургией всего тела, выбранной из группы, состоящей из косметической операции по удалению морщин, блефаропластики, ринопластики, отопластики, ментопластики, подтяжки лица, подтяжки лба, подтяжки бровей, изменения шрамов на лице, удаления шрамов на лице, лазерной хирургии, шлифовки кожи, удаления складок, плазмолифтинга кожи, моделирования контуров лица собственными жировыми трансплантатами, натяжения кожи, удаления татуировок, замещения волос, пластики передней брюшной стенки, уменьшения молочной железы, увеличения молочной железы, процедуры бодилифтинга, лечения паутинных сосудистых сеточек, лечения растяжек кожи, липосакции, хирургического удаления избытков кожи, уменьшения целлюлита, оконтуривания тела, шлифовки тела и имплантов тела.

17. Способ по п.14, в котором указанный релаксин является очищенным, рекомбинантным или синтетическим релаксином человека H1, H2 или Н3 или агонистом релаксина.

18. Способ по п.14, в котором релаксин вводят субъекту системно и/или местно в рану на коже.

19. Способ по п.14, в котором фармацевтический состав дополнительно включает один или оба следующих лекарственных средств: антибиотик и нестероидное противовоспалительное лекарственное средство.

20. Способ по п.14, в котором субъект является человеком с ослабленной способностью к излечению.



 

Похожие патенты:
Изобретение относится к фармацевтической промышленности и представляет собой композицию для лечения ран, язв, эрозий, ожогов, обморожений, рубцов, а также инфекций, вызываемых грамположительными и грамотрицательными бактериями Staphylococcus spp., Streptococcus spp., Enterococcus spp., Shigella spp., Escherichia spp., Salmonella spp., Proteus spp., Acinetobacter spp., Citrobacter spp., Pseudomonas spp., Serratia spp., Klebsiella spp., Antracoides spp., Cryptococcus spp., патогенными грибами рода Microsporum, Trichophyton, Nocardia, Aspergillus, дрожжеподобными грибами рода Candida (в т.ч.
Изобретение относится к фармацевтической композиции в виде пасты для защиты кожи. Композиция включает пленкообразователь, представляющий собой сополимер бутилметакрилата с метилметакрилатом, гидроколлоид, наполнитель, пластификатор и спиртовой разбавитель при определенном содержании компонентов.

Изобретение относится к области биотехнологии, конкретно к получению коротких пептидов - стимуляторов продукции белков внеклеточного матрикса в коже, и может быть использовано в медицине.
Изобретение относится к медицине, а именно к ветеринарии, и может быть использовано для лечения кожных заболеваний у овец. Для этого осуществляют подготовку пораженных участков кожного покрова.

Изобретение относится к фармацевтической промышленности и представляет собой фармацевтическую композицию для профилактики образования послеоперационных шрамов, спаек и келоидов в связи с хирургическим вмешательством, включающую биологически активный пептид, содержащий аминокислотную последовательность SEQ ID NO:56, где пептид присутствует в концентрации от 0,1 мг/мл до 100 мг/мл; и гиалуроновую кислоту с высокой молекулярной массой или фармацевтически приемлемую соль гиалуроновой кислоты с высокой молекулярной массой, где гиалуроновая кислота с высокой молекулярной массой имеет среднюю молекулярную массу свыше 300000 Да и где гиалуроновая кислота присутствует в концентрации от 0,1 до 10% (масс./масс.).

Изобретение относится к медицине, а именно к фармацевтической промышленности, касается получения концентрата хлорофиллов из ламинарии сахаристой. Способ получения концентрата хлорофиллов из измельченной ламинарии сахаристой путем ее экстракции этиловым спиртом в защищенном от света месте трехкратно, далее отделяют экстракт от шрота, извлечения объединяют, отгоняют экстрагент, к полученному остатку добавляют воду, фильтруют через бумажный фильтр, остаток на фильтре промывают двумя порциями воды, растворяют в 96% этиловом спирте, сумму хлорофиллов растворяют в стерильном оливковом масле до получения 25% концентрации суммы хлорофиллов, остаток 96% спирта этилового отгоняют под вакуумом, способ проводят при определенных условиях.
Изобретение относится к фармацевтической и косметической промышленности, а именно к лечебно-косметическому средству для кожи. Лечебно-косметическое средство для кожи, содержащее сухую плазму крови пантовых оленей, мумие, Д-пантенол, облепиховое масло и вспомогательные вещества при определенном соотношении компонентов.
Изобретение относится к медицине и может быть использовано для лечения глубоких ожогов на ранних этапах. Для этого берут трансплантат из здоровых тканей пациента.
Изобретение относится к области фармакологии и дерматологии и представляет собой композицию для применения при профилактике и лечении гипертрофических рубцов и/или келоидов, для ингибирования любых фибросклеротических процессов с целью улучшения биомеханических свойств кожи и ограничения стягивания при рубцевании; характеризующуюся тем, что содержит в качестве активного ингредиента по крайней мере два активных компонента, выбранных из фукозы, диметилсульфона и ацетилглюкозамина.
Изобретение относится к фармацевтической промышленности и представляет собой состав в форме геля для лечения ран и ожогов различной этиологии, обеспечивающий условия для эпителизации, содержащий действующие вещества, основу и воду, отличающийся тем, что в качестве действующего вещества он содержит рекомбинантный интерферон, выбранный из группы: рекомбинантный интерферон-альфа, рекомбинантный интерферон-бета, рекомбинантный интерферон-гамма, борную кислоту и лидокаина гидрохлорид, а в качестве основы - гидроксипропилметилцеллюлозу, причем компоненты в составе находятся в определенном соотношении в масс.%.

Группа изобретений относится к медицине и фармакологии и касается способа введения полипептида, содержащего подобный эпидермальному фактору роста (EGF-подобный) домен, включающий введение указанного полипептида по меньшей мере через двое суток после неврологического повреждения, а также после достижения млекопитающим полного объема гибели клеток ишемического очага после повреждения.
Изобретение относится к области фармацевтики и представляет собой питательную композицию для младенца или ребенка, содержащую липид или жир; источник белка; источник полиненасыщенных жирных кислот с длинной цепью, который содержит докозагексаеновую кислоту; до 2,5 вес.% источника дополнительного кальция, причем по меньшей мере 20% источника дополнительного кальция представляет собой глюконат кальция, и от 0,015 до 0,1 миллионных долей (пг/мкг) ТРФ-β.

Настоящее изобретение относится к медицине и описывает комплекс, образованный из полисахарида, в частности из декстрана, и из гепаринсвязывающего белка, причем вышеуказанный полисахарид образован за счет гликозидных связей типа (1,6), и/или (1,4), и/или (1,3), и/или (1,2) и функционализирован с помощью по меньшей мере одного солеобразующего или превращенного в соль производного триптофана.
Изобретение относится к экспериментальной медицине и может быть использовано для лечения смоделированной ишемии спинного мозга биологического объекта. Способ включает трехкратное введение внутрибрюшинно рекомбинантного эритропоэтина человека через 4-6 часов, 24 и 48 часов после действия, приведшего к возникновению ишемии спинного мозга.
Изобретение относится к экспериментальной медицине и может быть использовано для разработки приемов лечения ишемии головного мозга. Для этого моделируют ишемию головного мозга у крыс.

Изобретение относится к ветеринарии и может быть использовано для стимуляции роста и повышения резистентности организма сельскохозяйственных животных. Для этого животному вводят средство, состоящее из лизата лейкоцитов периферической крови и стволовых и/или прогениторных клеток животных, а также кондиционированной среды, полученной путем совместного их культивирования.
Изобретение относится к фармацевтической промышленности, а именно к полимеру крови для регенерации травмированной ткани или дефектных костных или хрящевых структур.

Изобретение относится к области биотехнологии, конкретно к средствам, ингибирующим ангиогенез, и может быть использовано в медицине. .

Изобретение относится к области биотехнологии, конкретно к получению аналогов панкреатического полипептида человека, и может быть использовано в медицине. Предложенные аналоги отличаются от нативного панкреатического полипептида человека заменами аминокислот по одному или более остатков, причем в положении 0 снабжены дополнительной аминокислотой, представляющей собой Gly. Полученные аналоги позволяют эффективно лечить и предупреждать ожирение или диабет у пациента, а также могут быть эффективны при снижении аппетита, снижении поглощения пищи или при снижении потребления калорий у пациента. 8 н. и 18 з.п.ф-лы, 2 ил., 2 табл., 1206 пр.
Наверх