Рекомбинантная плазмида phistevtsib0821, трансформированный ею штамм escherichia coli rosetta(de3)/phistevtsib0821 и способ получения рекомбинантной пролидазы tsib_0821


 


Владельцы патента RU 2509154:

Федеральное государственное бюджетное учреждение "Национальный исследовательский центр "Курчатовский институт" (RU)

Изобретение относится к области биотехнологии и генной инженерии и представляет собой рекомбинантную плазмиду pHisTevTSIB0821 для экспрессии в клетках Escherichia coli пролидазы TSIB_0821 из археи Thermococcus sibiricus. Заявленная плазмида включает NdeI/SalI-фрагмент плазмиды pET-22b(+) (Novagen) и фрагмент ДНК размером 1196 пар оснований, содержащий слитый ген, состоящий из следующих структурных элементов: нуклеотидная последовательность, кодирующая шестигистидиновый таг, нуклеотидная последовательность, кодирующая сайт узнавания/расщепления протеазы TEV, и нуклеотидная последовательность гена TSIB_0821, соединенных так, чтобы при их биосинтезе в клетках Е. coli сохранялась непрерывная рамка считывания. Получен штамм Е. coli Rosetta(DE3), трансформированный указанной плазмидой, - продуцент химерного белка, включающего аминокислотную последовательность пролидазы TSIB_0821 слитую на N-конце с шестигистидиновым тагом и сайтом узнавания/расщепления протеазы TEV. Разработан способ выращивания и индукции штамма-продуцента и метод выделения и очистки из полученной биомассы функционально-активной рекомбинантной пролидазы TSIB_0821, включающий следующие технологические процессы: две металлоаффинные хроматографии, гель-фильтрацию, обработку TEV протеазой, диализ, концентрирование. Изобретение позволяет получить рекомбинантную пролидазу, максимально приближенную по структуре к ее природному аналогу с высоким и стабильным выходом, уровнем очистки и функциональной активности. 3 н.п. ф-лы, 3 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к биотехнологии, в частности к генетической инженерии, и касается способа получения функционально активной рекомбинантной пролидазы термостабильной археи Thermococcus sibiricus (TSIB_0821), а также рекомбинантной плазмиды и трансформированного ею штамма Escherichia coli для наработки рекомбинантной пролидазы TSIB_0821. Изобретение позволяет производить функционально активную рекомбинантную пролидазу для использования в биотехнологических процессах, в том числе проводимых при повышенных температурах и рН, а также как модель для изучения молекулярных механизмов термоустойчивости.

Уровень техники

Пролидаза (пролинспецифическая дипептидаза, имидодипептидаза, Е.С. 3.4.13.9., далее именуемая пролидаза) - фермент, гидролизующий дипептиды, в которых пролин находится в С-концевой позиции (Хаа-Рго или X-Pro) [Cunningham, D. & O'connor, В. Proline specific peptidases // Biochim Biophys Acta. -1997. -Vol. 1343. -P. 160-186. и Lowther, W. & Matthews, B. Metalloaminopeptidases: common functional themes in disparate structural surroundings // Chem Rev. -2002. -Vol. 102. - P. 4581-4608]. Пролидазы встречаются в эукариотах, бактериях и археях и являются исключительно перспективными ферментами для использования в медицине и биотехнологии.

У млекопитающих пролидазы участвуют на заключительных этапах катаболизма при расщеплении молекул, богатых пролином, в первую очередь коллагена [Surazynski, A., Miltyk, W., Palka, J. & Phang, J. M. Prolidase-dependent regulation of collagen biosynthesis // Amino Acids. -2008. -Vol. 35. -P. 731-738]. У человека дефицит пролидаз вызывает развитие ряда заболеваний соединительных тканей [Viglio, S., Annovazzi, L., Conti, В., Genta, I., Perugini, P., Zanone, C., Casado, В., Cetta, G. & ladarola, P. The role of emerging techniques in the investigation ofprolidase deficiency: from diagnosis to,the development of a possible therapeutical approach // J Chromatogr В Analyt Technol Biomed Life Sci. -2006. -Vol. 832. -P. 1-8], для борьбы с которыми в качестве заместительной терапии используют рекомбинантные ферменты [Патент № W002067967. -2002, Патент № KR20050090120. - 2005, Патент № US2006134088. -2006, Патент № W02007110767. -2007., Colonna C., Conti, B„ Perugini, P., Pavanetto, F., Modena, Т., Dorati, R., ladarola, P. & Genta, I. Ex vivo evaluation ofprolidase loaded chitosan nanoparticles for the enzyme replacement therapy // Eur J Pharm. Biopharm. -2008. -Vol. 70. -P. 58-65. и Colonna, С., Conti, В., Perugini, P., Pavanetto, F., Modena, Т., Dorati, R., ladarola, P. & Genta, I. Site-directed PEGylation as successful approach to improve the enzyme replacement in the case ofprolidase // Int J Pharm. -2008. -Vol. 358. -P. 230-237]. В то же время повышенный уровень пролидазной активности является диагностическим маркером ряда онкологических заболеваний [Kama, E., Surazynski, А. & Palka, J. Collagen metabolism disturbances are accompanied by an increase in prolidase activity in lung carcinoma planoepitheliale // Int J Exp Pathol. -2000. -Vol. 81. -P. 341-347], для таргетной терапии которых создают пролинсодержащие инактивированные формы препаратов, которые превращаются в активные противораковые лекарства после расщепления пролидазами [Патент W09745117. -1997, Mittal, S, Song, X., Vig, В. S. & Amidon, G. L. Proline prodrug of melphalan targeted to prolidase, a prodrug activating enzyme overexpressed in melanoma // Pharm Res. -2007. -Vol. 24.-P.1290-1298].

Пролидазы бактерий и архей также участвуют в деградации белков и пептидов, регулируя рециклинг пролина [Gonzales, Т. & Robert-Baudouy, J. Bacterial aminopeptidases:

properties and functions // FEMS Microbiol. Rev. -1996. -Vol. 18. -P. 319-344. и Ghosh, M., Grunden, A. M., Dunn, D. M., Weiss, R. & Adams, M. W. Characterization of native and recombinant forms of an unusual cobalt-dependent proline dipeptidase (prolidase) from the hyperthermophilic archaeon Pyrococcus furiosus // J Bacteriol. -1998. -Vol. 180. -P. 4781-4789]. Они используются для удаления горечи при ферментации сыров и в других отраслях пищевой промышленности [Courtin, P., Nardi, M., Wegmann, U, Joutsjoki, V., Ogier, J. C., Gripon, J. C, Palva, A., Henrich, B. & Monnet, V. Accelerating cheese proteolysis by enriching Lactococcus lactis proteolytic system with lactobacilli peptidases // International Dairy Journal. -2002. -P. 447-454, Патент № JP2008I78393. -2008, Патент № US2010317736. -2010.J. Кроме того, большинство изученных на сегодня пролидаз, в первую очередь пролидазы из термофильных архей, активны в отношении токсических фосфорорганических молекул, входящих в состав нервно-паралитических газов и пестицидов [Vyas, N.K, Nickitenko, A., Rastogi, V. К., Shah, S. S. & Quiocho, F. A. Structural insights into the dual activities of the nerve agent degrading organophosphate anhydrolase/prolidase // Biochemistry. -2010. -Vol. 49. -P. 547-559. и Theriot, C.M., Tove, S. R. & Grunden, A. M. (eds.) Biotechnological Applications of Recombinant Microbial Prolidases // New York Academic Press. -2009], поэтому высокая исследовательская активность наблюдается в области разработки технологий, нацеленных на использование пролидаз в качестве биосенсоров для детекции токсических веществ данного класса [Simonian, A. L., Grimsley, J. К., Flounders, A. W, Shoeniger, J. S., Cheng, Т.-С., DeFrank, J. J. & Wild, J. R. Enzyme-based biosensor for the direct detection of fluorine-containing organophosphates // Analytica Chimica Acta. -2001. -P. 15-23], средств биодеконтаминации [Cheng, T.C. & DeFrank, J. J. (eds.) Hydrolysis of organophosphorus compounds by bacterial prolidases // Dordrecht: Kluwer Academic Publishers. -2000] или компонентов антидотов [Petrikovics, I., Mcguinn, W. D., Sylvester, D., Yuzapavik, P., Jiang, J., Way, J. L., Papahadjopoulos, D., Hong, K., Yin, R., Cheng, T. C. & DeFrank, J. J. In vitro studies on sterically stabilized liposomes (SL) as enzyme carriers in organophosphorus (OP) antagonism // Drug Deliv. -2000. -Vol. 7. -P. 83-89].

На сегодняшний день охарактеризовано немногим более 10 пролидаз из различных организмов, которые перечислены в обзоре [R. Semcer and A. Grunden. Prolidase function in proline metabolism and its medical and biotechnological applications // J. Appl. Microbiol. -2012. doi: 10.1111/j.1365-2672.2012.05310]. Перспективность поиска и всестороннего изучения новых ферментов данного класса, особенно из экстремофильных архей, а также клонирование соответствующих генов и получение рекомбинантных протеаз, в том числе с направленно-измененными методами генетической инженерии свойствами, подтверждается публикациями как в периодических научных журналах, так и в патентной литературе:

Патент № US6309868. Cloning of the prolyl-dipeptidyl-peptidase from Aspergillus oryzae.-2001.

Патент № US2003186420. Prolidase and its gene and method for producing prolidase. -2003.

Maher, M. J., Ghosh, M., Grunden, A. M., Menon, A. L., Adams, M. W., Freeman, H. C. & Guss, J. M. Structure of the prolidase from Pyrococcus furiosus // Biochemistry. -2004. -Vol. 43, -P. 2771-2783.

Патент № JP2004105091. Heat-resistant proline-containing dipeptidase. -2004. Du, X., Tove, S., Kast-Hutcheson, K. & Grunden, A. M. Characterization of the dinuclear

metal center of Pyrococcus furiosus prolidase by analysis of targeted mutants // FEBS Lett. -

2005. -Vol. 579. -P. 6140-6146.

Lupi, A., Delia Torie, S„ Campari, E., Tenni, R., Cetta, G, Rossi, A. & Forlino, A. Human recombinant prolidase from eukaryotic and prokaryotic sources. Expression, purification, characterization and long-term stability studies // FEBS J. -2006. -Vol. 273. -P. 5466-5478.

Патент № JP3819454. New proline dipeptidase and hydrolysis of protein and peptide using the proline dipeptidase. -2006.

Yang, S.I. & Tanaka, T. Characterization of recombinant prolidase from Lactococcus lactis changes in substrate specificity by metal cations, and allosteric behavior of the peptidase //

FEBS J. -2008. -Vol. 275. -P. 271-280.

Besio, R., Alleva, S., Forlino, A., Lupi, A., Meneghini, C., Minicozzi, V., Profumo, A., Stellato, F., Tenni, R. & Morante, S. Identifying the structure of the active sites of human recombinant prolidase // Eur Biophys J. -2010. -Vol. 39. -P. 935-945.

Theriot, C. M., Tove, S. R. & Grunden, A. M. Characterization of two proline dipeptidases (prolidases) from the hyperthermophilic archaeon Pyrococcus horikoshii // Appi Microbiol Biotechnol. -2010. -Vol. 86. -P. 177-188.

Theriot, C. M., Du, X., Tove, S. R. & Grunden, A. M. Improving the catalytic activity of hyperthermophilic Pyrococcus prolidases for detoxification of organophosphorus nerve agents over a broad range of temperatures // Appi Microbiol Biotechnol, -2010. -Vol. 87. -P. 1715-1726.

Theriot, C. M., Semcer, R. L., Shah, S. S. & Grunden, A. M. Improving the Catalytic Activity of Hyperthermophilic Pyrococcus horikoshii Prolidase for Detoxification of Organophosphorus Nerve Agents over a Broad Range of Temperatures // Archaea. -2011. -Vol. 565127.

Приведенные выше работы демонстрируют, что для более полного использования биотехнологического потенциала пролидаз необходимо комбинировать две стратегии: во первых, изучать новые ферменты, во вторых, направленно оптимизировать свойства природных ферментов согласно требованиям технологического процесса. Особый интерес в этом плане представляют пролидазы из экстремофильных микроорганизмов, так как они обладают широким спектром уникальных свойств, а именно способны работать в экстремальных условиях: повышенная температура, кислый или щелочной рН, высокая ионная сила, присутствие высоких концентраций детергентов. Поэтому для поиска генов, кодирующих новые пролидазы, выбран геном гипертермофильной археи Thermococcus Sibiricus MM739, обитающей в гидротермальных источниках и подземных нефтяных резервуарах Западной Сибири при температуре от 40°С до 88°С. Анализ расшифрованного генома Т. Sibiricus показывает наличие в нем гена TSIB 0821 (GenBank accession number ACS89882.1), кодирующего белок, похожий на ранее изученную термофильную протеазу из Pyrococcus horikoshii OT3 (52% гомологии).

В качестве прототипа выбран способ получения пролидазы TSIB_0821, слитой на N-конце с последовательностью MRGSHHHHHHGS [Trofimov, A. A., Slutskaya, E. А., Polyakov, К. М., Dorovatovskiic, P. V., Gumerov, V. М., Popov, V. О. Influence of intermolecular contacts on the structure ofrecombinant prolidase from Thermococcus sibiricus // Acta Crystallogr Sect F Struct Biol Cryst Commun. -2012]. Данный способ включает в себя амплификацию гена TSIB_0821 (GenBank accession number ACS89882.1) на матрице геномной ДНК Т. Sibiricus с помощью полимеразной цепной реакции, его клонирование в экспрессирующий вектор pQE80L (Qiagen), получение штамма Escherichia coli Rosetta-gami (DE3) (Novagen), трансформированного плазмидой pQE80L_TSIB0821, наращивание клеток штамма-продуцента, индукцию экспрессии и выделение из полученной биомассы рекомбинантного белка. Недостатком данного способа является невозможность удаления с N-конца рекомбинантной пролидазы TSIB_0821 аминокислотной последовательности шестигистидинового тага, которая, согласно данным рентгеноструктурного анализа слитого белка MRGSHHHHHHGS-TSIB_0821, активно участвует в формировании пространственной укладки полипептида, отрицательно влияя на его функциональную активность и устойчивость к механическим и температурным воздействиям, что делает рекомбинантную пролидазу TSIB_0821, полученную данным способом, непригодной для использования в биотехнологических процессах.

Раскрытие изобретения

Технической задачей и, соответственно, техническим результатом изобретения является разработка простого и экологически чистого способа получения функционально активной рекомбинантной пролидазы TSIB_0821, максимально приближенной по структуре к ее природному аналогу.

Поставленная задача решается предлагаемым способом, предусматривающим конструирование плазмиды pHisTevTSIB0821, кодирующей синтез рекомбинантной пролидазы TSIB_0821, слитой на N-конце с последовательностью шестигистидинового тага и сайтом узнавания/расщепления протеазы TEV, создание на основе данной плазмиды штамма Е. coli Rosetta(DE3)/pHisTevTSIB0821 - продуцента рекомбинантной пролидазы TSIB_0821 в виде слитого белка и разработку способа выделения и очистки рекомбинантной пролидазы TSIB_0821, обеспечивающего отделение N-концевой аминокислотной последовательности шестигистидинового тага от целевого полипептида.

Технический результат заявленного изобретения - получение рекомбинантной пролидазы TSIB_0821, максимально приближенной по структуре к ее природному аналогу с высоким и стабильным выходом, уровнем очистки и функциональной активности.

Реализация технической задачи и получение технического результата обеспечено использованием следующей совокупности существенных признаков:

- плазмида pHisTevTSIB0821, определяющая синтез рекомбинантной пролидазы TSIB_0821, характеризуется наличием следующих фрагментов: NdeI/SalI-фрагмента плазмиды pET-22b(+) (Novagen) размером 5365 п.о., NdeI/NcoI-фрагмента, кодирующего шестигистидиновый таг и сайт узнавания/расщепления протеазы TEV (Seq. 1), и NcoI/SalI-фрагмента, содержащего структурную часть гена TSIB_0821, соответствующую открытой рамке считывания 749419-750516 полного геномного сиквенса археи Thermococcus sibiricus MM 739 (gi:2423 97997), адаптированную по 5'- и 3'-концам сайтами рестриказ Ncol и Sail (Seq. 2), соединенных так, чтобы при их биосинтезе в клетках E.coli сохранялась непрерывная рамка считывания;

- штамм Е. coli Rosetta(DE3), трансформированный плазмидой pHisTevTSIB0821 по п.1 является индуцибельным продуцентом химерного белка, включающего аминокислотную последовательность пролидазы TSIB_0821, слитую на N-конце с шестигистидиновым тагом и сайтом узнавания/расщепления протеазы TEV;

- способ получения рекомбинантной пролидазы TSIB_0821, характеризуется тем, что после добавления индуктора экспрессии штамм-продуцент по п.2 инкубируют в жидкой питательной среде LB в течение 20 ч при 18°С, затем бактериальные клетки осаждают центрифугированием, суспензию клеток дезинтегрируют в буферном растворе, экстракт центрифугируют, а надосадочную жидкость помещают на колонку с металлоаффинной смолой, с которой, после удаления продуктов неспецифического связывания, элюируют целевой белок, который инкубируют с протеазой TEV, которую вместе отщепленной ею аминокислотной последовательностью удаляют повторной металлохелатной хроматографией, далее целевой продукт концентрируют и финально доочищают гель-фильтрацией.

Предложение поясняется следующим.

Рекомбинантная плазмида pHisTevTSIB0821 представляет собой кольцевую двухцепочечную ДНК размером 6561 п.о.

Рекомбинантный штамм Е. coli Rosetta(DE3)/pHisTevTSIB0821 характеризуется следующими признаками:

Культурально-морфологические признаки.

Клетки штамма образуют крупные круглые с ровными краями, выпуклые колонии до 5 мм в диаметре, поверхность колоний гладкая, консистенция слизистая. Пигмент не накапливается. Грамотрицательны, спор не образуют, капсулы не имеют. Колонии хорошо растут на простых питательных средах (LB). При росте в жидких средах образуют интенсивную ровную муть.

Физико-биологические признаки.

Штамм Е. coli Rosetta(DE3)/pHisTevTSIB0821 видотипичен по своим биохимическим свойствам. Штамм не обладает желатиназной активностью, не ферментирует лизин, расщепляет глюкозу, лактозу, маннит, сахарозу до кислоты и газа. Имеет мутацию в гене lac, обеспечивающую контроль уровня экспрессии, а также трансляцию шести редких кодонов. Оптимальной для роста является температура 37°С, а для продукции TSIB_0821 - 20°С.

Устойчивость к антибиотикам

Клетки штамма характеризуются устойчивостью к хлорамфениколу (34 мкг/мл) и ампициллину (до 200 мкг/мл).

Патогенность и токсичность

Рекомбинантный штамм Е. coli Rosetta(DE3)/ pHisTevTSIB0821 не патогенен и не токсичен для теплокровных животных.

Штамм хранится обычным способом в суспензии с глицерином (25%) при -70°С.

Заявляемый способ получения рекомбинантной пролидазы TSIB_0821 заключается в культивировании клеток Е. coli штамма Rosetta(DE3)/pHisTevTSIB0821 в питательной среде LB, содержащей ампициллин и IPTG, отделении биомассы от культуральной жидкости, разрушении микробных клеток с последующим выделением целевого продукта из фракции растворимых клеточных белков с помощью следующих технологических процессов: две металлоаффинные хроматографии, гель-фильтрация, обработка TEV протеазой, диализ, концентрирование. Выход рекомбинантного белка в результате применения предлагаемого способа выделения и очистки составляет не менее 1 мг с 1 л культуры при чистоте более 97%.

Рекомбинантная пролидаза TSIB_0821, выделенная и очищенная заявленным способом, характеризуется следующими признаками: молекулярная масса 41 кДа;

оптимальные условия работы фермента: температура 85-100°С, рН 7.5-9.5, 1 мМ Мn2+ в инкубационной среде; удельная активность не менее 400 ед/мг белка, при условии проведения гидролиза при 90°С в реакционной смеси, содержащей 50 мМ MOPS, pH 8.2, 100 мМ NaCI, 1 мМ МnСl2, 5 мМ пептидный субстрат Met-Pro и 1 мкг фермента. Данные по физико-химической характеристике и определению ферментативной активности рекомбинантной пролидазы TSIB_0821 свидетельствуют о наличие у исследуемого полипептида дипептидил-пролидазной активности, присущей его природному аналогу. Рекомбинантная пролидаза TSIB_0821 может быть успешно использована в биотехнологических процессах, проводимых при повышенных температурах и pH, a также как модель для изучения молекулярных механизмов термоустойчивости.

Преимуществами заявляемого способа получения пролидазы TSIB 0821 являются:

- использование слитого гена, состоящего из следующих структурных элементов:

- нуклеотидная последовательность, кодирующая шестигистидиновый таг, нуклеотидная последовательность, кодирующая сайт узнавания/расщепления протеазы TEV, и нуклеотидная последовательность гена TSIB_0821, соединенных так, чтобы при их биосинтезе в клетках E.coli сохранялась непрерывная рамка считывания, что позволяет после выделения слитого рекомбинантного белка методом металлоаффинной хроматографии удалять дополнительные аминокислотные последовательности с помощью сайт-специфической TEV протеазы;

- использование штамма-продуцента на основе штамма E.coli Rosetta(DE3), обеспечивающего трансляцию шести редких кодонов, что позволяет увеличить эффективность биосинтеза и получать полноразмерный рекомбинантный белок;

- использование минимального числа стадий хроматографической очистки, что позволяет получать чистый рекомбинантный белок за короткое время с минимальными потерями самого белка и его функциональной активности.

Осуществление изобретения

Способ получения функционально-активной пролидазы на основе использования гена TSIB_0821 термофильной археи Thermococcus sibiricus, слитого на N-конце с нуклеотидной последовательностью, кодирующей шестигистидиновый таг и сайт узнавания/расщепления протеазы TEV, иллюстрируется следующими примерами.

Пример 1. Конструирование плазмиды pHisTevTSIB0821.

Рекомбинантную плазмиду pHisTevTSIB0821, содержащую собранные в единую рамку считывания нуклеотидные последовательности, кодирующие шестигистидиновый , слитый с сайтом узнавания/расщепления протеазы TEV? и структурный ген TSIB_0821, конструируют на основе коммерческой плазмиды pET-22b(+) (Novagen), в которой фрагмент NdeI/Ncol, кодирующий лидерный пептид ре1В, заменен на фрагмент NdeI/Ncol, кодирующий шестигистидиновый таг, слитый с сайтом узнавания/расщепления протеазы TEV.

2 мкг плазмидной ДНК рЕТ-22Ь(+) обрабатывают рестриктазами Ndel и Sail (Fermentas) в рекомендуемом буфере в течение 1 часа, векторную часть плазмиды размером 5365 п.о. выделяют электрофоретически из 1% агарозного геля с помощью набора для выделения ДНК (Fermentas) в соответствии с рекомендациями производителя.

Фрагмент ДНК NdeI/Ncol, кодирующий шестигистидиновый таг, слитый с сайтом узнавания/расщепления протеазы TEV, получают путем 30 мин отжига при 75°С с последующим охлаждением во льду олигонуклеотидов NdeHisTev For и NcoHisTev_Rev, смешанных в эквимолярных количествах (100 pMol каждого):

NdeHisTev_For 5'-TATGTCGTACTACCATCACCATCACCATCACGATTACGATATCCC

AACGACCGAAAACCTGTATTTTCAGGGCGC-3'

NcoHisTev_Rev 5'-CATGGCGCCCTGAAAATACAGGTTTTCGGTCGTTGGGATATCGTAA

TCGTGATGGTGATGGTGATGGTAGTACGACA-3'

Фрагмент ДНК, содержащий полноразмерный структурный ген TSIB_0821, получают при помощи полимеразной цепной реакции с использованием в качестве матрицы плазмиды pQE80L_TSIB0821, принятой за прототип [Trofimov A.A. et al., Acta Crystallogr Sect F Struct Biol Cryst Commun. -2012], и праймеров XaaP_For и XaaP_Rev, где XaaP_For - праймер, специфичный по отношению к 5'-концу структурной части гена TSIB_0821 и содержащий сайт рестриктазы Ncol, XaaP_Rev - обратный праймер, специфичный по отношению к 3'-концу структурной части гена TSIB_0821 и содержащий сайт рестриктазы Sail:

XaaPJFor: 5'- GC CC ATG GAT TAC AAG AGA AGG ATT CAT AAG -3' XaaP_Rev: 5'-TTT GTC GAC СТА TAG CGT GAT CAA TTC CCT ATC-3' Данную реакцию проводят в следующих условиях: 10х Encycio буфер, 50х смесь полимераз Encycio ("Encycio PCR kit", Евроген, Москва), 50х смесь 10mM dNTP, 100 нг геномной ДНК Thermococcus sibiricus MM 739. Процесс амплификации состоит из следующих стадий: прогревание при 94°С - 3 мин, 30 циклов ПЦР (20 с - 95°С, 30 с - 58°С, 1 мин - 72°С) и инкубация 10 мин при 72°С. Продукт амплификации очищают электрофоретически в 1% агарозном геле с последующим выделением из агарозы с помощью набора для выделения ДНК из геля (Fermentas). Фрагмент (1 мкг) обрабатывают рестриктазами Ncol и Sail (Fermentas) в рекомендуемом буфере в течение 1 часа, а продукт рестрикции очищают электрофоретически, как описано выше.

Полученные фрагменты и векторную часть плазмиды рЕТ-22Ь(+) сшивают при помощи лигазной реакции, проводимой в объеме 20 мкл с использованнием реакционного буфера и фермента Т4 ДНК лигазы фирмы (Fermentas) согласно инструкции производителя. 10 мкл лигазной смеси используют для трансформации компетентных клеток E.coli Match 1. Трансформанты высевают на LB-агар, содержащий 125 мкг/мл ампициллина. Выросшие после инкубирования в течение 16 ч при 37°С одиночные колонии отсевают в жидкую среду LB. содержащую 125 мкг/мл ампициллина, и выращивают в течение 16 ч при 37°С в орбитальной качалке при интенсивности качания 200 об/мин. Выделенную из полученной биомассы плазмидную ДНК проверяют на отсутствие мутаций, возникших при клонировании при помощи автоматического секвенирования.

Пример 2. Получение штамма Е. coli Rosetta(DE3)/pHisTevTSIB0821

Штамм-продуцент получают путем трансформации клеток штамма Е. coli Rosetta(DES) рекомбинантной плазмидой pHisTevTSIB0821 с использованием традиционной генно-инженерной технологии [Sambrook J., Fritsch E.F., Maniatis T. // Molecular Cloning. A. Laboratory Manual. 2bd ed. Cold Spring Harbor, NY, 1989]. Трансформанты высевают на LB-агар, содержащий 34 мкг/мл хлорамфеникола и 125 мкг/мл ампициллина. Выросшую после инкубирования в течение 16 ч при 37°С одиночную колонию отсевают в 0.5 мл жидкой среды LB, содержащей 34 мкг/мл хлорамфеникола и 125 мкг/мл ампициллина и выращивают в течение 16 ч при 37°С, а затем переносят в 500 мл колбу с 100 мл жидкой среды LB, содержащей 1 г бактотриптона, 0.5 г бактодрожжевого экстракта и 1 г Nad в 10 мм Трис НС1 рН 7.0, в присутствии 125 мг/мл ампициллина, и выращивают на шейкере при 200 об/мин и температуре 37°С до оптической плотности 0,7 (ОD600), затем добавляют индуктор экспрессии IPTG до конечной концентрации 0,2 мМ и инкубируют далее при 18°С в течение 20 часов.

Для определения продуктивности штамма водные экстракты клеток анализируют электрофорезом в 10% полиакриламидном геле с додецилсульфатом натрия. Гель окрашивают Кумасси R-250 по стандартной методике и определяют относительное количество белка в полосе целевого продукта. Содержание рекомбинантного белка составляет не менее 1% от всех белков растворимой фракции.

Пример 3. Выделение, очистка и характеристика рекомбинантной пролидазы TSIB_0821

Ночную культуру объемом 10 мл с посевным материалом штамма продуцента стерильно переносят в предварительно подготовленный ферментер RALF PLUS (Bioengineering) с 5 л жидкой среды LB, содержащей на литр 10 г бактотриптона, 5 г бактодрожжевого экстракта и 10 г NaCI в 10 мм Трис НС1, рН 7.0, в присутствии 125 мг/мл ампициллина и противопенного реагента Antifoam 0-60 (Sigma). Культивирование проводят в условиях: температура среды 37±0.1°С, рН 7.0±0.1, аэрация 30 л/ч, частота оборотов мешалки 600 об/мин. Контроль плотности клеток в культуре осуществляют методом выносной пробы на спектрофотометре SmartspectPlus (BioRad) при 600 нм. При достижении оптической плотности 0.7 (ODeoo) проводят индукцию путем добавления IPTG до 0.2 мМ с последующей инкубацией в течение 20 часов при 18°С. Клетки осаждают на центрифуге Beckman при 6000 об/мин в течение 20 мин и замораживают клеточные осадки на -70°С.

Замороженную биомассу (около 40 г), полученную из 5 л бактериальной культуры, лизируют в 100 мл охлажденного буферного раствора А (400 мМ NaCI, 50 мМ Хепес рН 7.4, 5 мМ имидазол), содержащего также 0.2% Тритон Х-100, 5% глицерол и игибиторы протеаз (Sigma), и обрабатывают ультразвуком с помощью ультразвукового дезинтегратора "Ultrasonic Processor" (Cole Parmer) в течение 5×30 с, охлаждая во льду. Нерастворимые компоненты лизата осаждают центрифугированием при 20000 об/мин, 20 мин, 4°С. Надосадочную жидкость собирают и помещают на колонку с металлоаффинной смолой Ni-NTA Superflow (Quigen), предварительно уравновешенную буфером А. Металлохелатную аффинную хроматографию проводят с использованием хроматографической системы АКТА Prime (GE Healthcare). Элюцию белка проводят буферным раствором А, содержащим 500 мМ имидазол. Фракции, содержащие целевой белок, объединяют и инкубируют с протеазой TEV (Invitrogen) при комнатной температуре в течение 2 часов с последующим диализом против трех литров буферного раствора А в течении 16 часов при 4°С. Для освобождения от шестигистидинового тага и препарата TEV протеазы проводят повторную металлохелатную хроматографию. Фракцию целевого белка, не связавшегося со смолой, концентрируют на центрифужных концентраторах Amicon Ultra 10k (Millipore) и доочищают гель-фильтрацией на колонке Superdex G-75 (GE Healtcare), уравновешенной буферным раствором (200 мМ NaCI, 20 мМ Трис-НСl, рН 8.0, 5% глицерол, 2 мМ Р-меркаптоэтанол и 0.1% b-октилглюкопиранозид). Выход рекомбинантного белка составляет 1 мг с 1 литра культуры при чистоте не менее 97%, определенной с помощью электрофореза в 10% полиакриламидном геле с додецилсульфатом натрия с последующим окрашиванием Кумасси R-250 по стандартной методике. Соответствие полученного рекомбинантного белка его природному аналогу также подтверждают с помощью Maldi-TOF-масс-спектрометрии пептидного фингерпринта.

Активность пролидазы определяют по расщеплению различных дипептидных субстратов с остатком пролина в С-концевом положении. Условия проведения реакции:

температура 90°, инкубационная смесь в объеме 500 мкл содержит 50 мМ MOPS, pH 8.2, 100 мМ NaCI, pH 8.2, 1мМ МnСl2 и 5мМ субстрата, 0.1-2 мкг фермента. Протекание реакции контролируют спектрофотометрически при 515 нм по образованию комплекса нингидрин-пролин с коэффициентом экстинкции 4,570 M-1·cм-1, для чего реакцию останавливают добавлением равного объема ледяной уксусной кислоты, затем добавляют 500 мкл нингидринового реагента, содержащего 3% нингидрина вес./об, 60% уксусной кислоты и 40% фосфорной кислоты, и инкубируют 10 мин при 90°С. Для перевода оптических единиц в количество образующегося пролина используют калибровочную кривую. За единицу активности пролидазы принимают количество фермента, катализирующего гидролиз 1 мкмоль пептидного субстрата за 1 мин. Удельную активность выражают в единицах активности фермента на 1 мг белка.

Как следует из приведенных примеров, заявляемое изобретение позволяет получать препаративные количества активной рекомбинантной пролидазы при использовании относительно простых и надежных технологий культивирования клеток штамма-продуцента и выделения белка.

1. Плазмида pHisTevTSIB0821, определяющая синтез рекомбинантной пролидазы TSIB_0821, характеризующаяся наличием следующих фрагментов: NdeI/SalI-фрагмента, плазмиды pET-22b(+) (Novagen) размером 5365 п.о., NdeI/NcoI-фрагмента, кодирующего шестигистидиновый таг и сайт узнавания/расщепления протеазы TEV (Seq. 1), и NcoI/SalI-фрагмента, содержащего структурную часть гена TSIB_0821, соответствующую открытой рамке считывания 749419-750516 полного геномного сиквенса археи Thermococcus sibiricus MM 739 (gi:242397997), адаптированную по 5'- и 3'-концам сайтами рестриказ Ncol и Sail (Seq. 2), соединенных так, чтобы при их биосинтезе в клетках E.coli сохранялась непрерывная рамка считывания.

2. Штамм Е. coli Rosetta(DE3), трансформированный плазмидой pHisTevTSIB0821 по п.1, - индуцибельный продуцент химерного белка, включающего аминокислотную последовательность пролидазы TSIB_0821, слитую на N-конце с шестигистидиновым тагом и сайтом узнавания/расщепления протеазы TEV.

3. Способ получения рекомбинантной пролидазы TSIB_0821, характеризующийся тем, что после добавления индуктора экспрессии штамм-продуцент по п.2 инкубируют в жидкой питательной среде LB в течение 20 ч при 18°С, затем бактериальные клетки осаждают центрифугированием, суспензию клеток дезинтегрируют в буферном растворе, экстракт центрифугируют, а надосадочную жидкость помещают на колонку с металлоаффинной смолой, с которой после удаления продуктов неспецифического связывания элюируют целевой белок, который инкубируют с протеазой TEV, которую вместе c отщепленной ею аминокислотной последовательностью удаляют повторной металлохелатной хроматографией, далее целевой продукт концентрируют и финально доочищают гель-фильтрацией.



 

Похожие патенты:

Изобретение относится к биотехнологии, а именно к рекомбинантной плазмидной ДНК, кодирующей ферментативно-активную часть полипептида липазы, белка пищеварительного тракта пчелиной огневки длиной в 504 аминокислотных остатков.

Изобретение относится к области биотехнологии и касается рекомбинантных векторов, используемых для производства противогриппозных вакцин. Охарактеризованы рекомбинантная псевдоаденовирусная частица на основе генома аденовируса человека 5 серотипа и способ ее использования.

Изобретение относится к области биотехнологии и касается рекомбинантных векторов, которые могут быть использованы для противогриппозных вакцин. Охарактеризованы рекомбинантная псевдоаденовирусная частица на основе генома аденовируса человека 5 серотипа и способ ее использования в качестве компонента для создания вакцины против вируса гриппа А субтипа H1N1.

Настоящее изобретение относится к области биохимии, и представляет собой способ получения 2S,4R-монатина или его соли, предусматривающий контактирование 4R-IHOG с аминотрансферазой L-аминокислоты в присутствии L-аминокислоты, и способ получения 2R,4R-монатина или его соли, предусматривающий изомеризацию 2S,4R-монатина.

Изобретение относится к области биохимии, в частности к вариантам антител против рецептора IL-6, вариабельные области тяжелой и легкой цепи которых модифицированы путем введения аминокислотных замен.

Изобретение относится к области биотехнологии и касается способа синтеза целевого секретируемого белка человека в клетках дрожжей Saccharomyces cerevisiae. Способ включает культивирование в подходящих условиях дрожжей Saccharomyces cerevisiae и секрецию целевого белка, причем секреция направлена лидерным полипептидом, имеющим аминокислотную последовательность SEQ ID NO1 и представляющим собой вариант про-области лидерного полипептида белка PpPIR1 Pichia pastoris.

Изобретение относится к области биотехнологии. Описана модифицированная липидами двухцепочечная РНК, включающая антисмысловую нить, нуклеотидная последовательность которой комплементарна целевой последовательности в целевом гене, и смысловую нить, нуклеотидная последовательность которой комплементарна антисмысловой нити.

Изобретение относится к биотехнологии, в частности к новым глицерол-3-фосфатацилтрансферазам и полинуклеотидам, их кодирующим. Настоящее изобретение относится также к вектору экспрессии и трансформанту, содержащему полинуклеотид, а также способу получения липидной композиции или композиции на основе жирных кислот с использованием трансформанта.

Изобретение относится к области биотехнологии, а именно к рекомбинантному гибридному ингибитору ангиогенеза и к способу его получения. Рекомбинантный гибридный ингибитор ангиогенеза представляет собой белок, указанный на фиг.1.

Изобретение относится к области генной инженерии, молекулярной и клеточной биологии и биотехнологии. Получена генетическая конструкция pAd-SM, построенная путем гомологичной рекомбинации вектора pAdEasy-1, содержащего основную часть генома аденовируса и плазмиды pAdTrack-CMV, в которую помещены фрагменты кДНК генов SOX2 и C-MYC человека, соединенные нуклеотидной последовательностью, кодирующей Р2А-пептид.

Изобретение относится к области биотехнологии и касается способа получения рекомбинантного антигена G2 хантавирусов. Представленный способ характеризуется тем, что ДНК конструкции pGHF, кодирующая слитый белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с последовательностью аминокислот SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEWKDPDGMLKDHLNILVTKDIDFDT, а C-концевое - мини-домен фолдон фибритина колифага JS98C3 (фиг.2), вводят в клетки E.coli, культивируют трансформированные данной конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата центрифугированием, продукт экспрессии в форме телец включения солюбилизируют с помощью денатурата, проводят хроматографию и используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом. Представленное решение позволяет улучшить воспроизводимость и чувствительность иммуноферментного анализа при диагностике ГЛПС. 7 ил.

Изобретение относится к области биотехнологии и касается получения генетической конструкции, обеспечивающей синтез в клетках Escherichia coli рекомбинантного белка p35d. Представлены: рекомбинантная плазмидная ДНК pQE-p35d, обеспечивающая синтез рекомбинантного белка p35d вируса оспы коров и содержащая в соответствии с физической и генетической картой плазмиды, приведенной на фиг. 2: плазмидный вектор pQE30, фрагмент, кодирующий олигопептид MRGSHHHHHHG и фрагмент размером 717 п.о., кодирующий фрагмент белка р35 вируса оспы коров с 1 по 239 аминокислотный остаток (фиг.1а); штамм бактерий Escherichia coli XL1Blue/pQE-p35d В-1252 - продуцент рекомбинантного белка p35d вируса оспы коров, содержащий рекомбинантную плазмидную ДНК pQE-p35d, депонированный в Коллекции бактерий, бактериофагов и грибов ФБУН ГНЦ ВБ «Вектор» под регистрационным номером В-1252 и рекомбинантный белок p35d вируса оспы коров. Охарактеризованные решения могут быть использованы для создания тест-систем и конструирования субъединичных вакцин против ортопоксвирусных инфекций. 3 н. п. ф-лы, 7 ил., 5 пр.

Изобретение относится к биотехнологии и представляет собой новую диацилглицерол-ацилтрансферазу. Изобретение относится также к полинуклеотиду, кодирующему диацилглицерол-ацилтрансферазу, вектору экспрессии и трансформанту, такому как дрожжи или грибок, а также к способу получения композиции липидов или жирных кислот с использованием трансформанта. Изобретение позволяет получить новый фермент, пригодный для эффективной продукции липидов и жирных кислот. 6 н. и 7 з.п. ф-лы, 5 ил., 2 табл., 1 пр.

Изобретение относится к области биохимии, в частности к способам направленного изменения дуплексной акцепторной ДНК-последовательности и улучшения эффективности направленного мутагенеза в растительных протопластах. Заявленные способы включают введение в протопласты растительных клеток одноцепочечного мутагенного олигонуклеотида, имеющего в своем составе по меньшей мере один ошибочный нуклеотид по отношению к дуплексной акцепторной ДНК-последовательности, которую необходимо изменить, с использованием ПЭГ-опосредованной трансформации. Изобретение позволяет повысить частоту направленного мутагенеза. 2 н. и 8 з.п. ф-лы, 3 табл.

Изобретение относится к области биотехнологии. Представлен выделенный химерный полинуклеотид для усиления продуцирования представляющего интерес гетерологичного белка, содержащий полинуклеотидную последовательность промотора SigA или SigH, функционально связанную с полинуклеотидом, кодирующим белок YmaH, причем химерный полинуклеотид содержит последовательность, которая по меньшей мере на 90% идентична SEQ ID NO: 1, 2, 3 или 13. Также описаны вектор экспрессии, содержащий указанную нуклеотидную конструкцию, и клетка-хозяин Bacillus для продукции представляющего интерес гетерологичного белка, содержащая указанный вектор. Предложен способ получения модифицированной клетки Bacillus, включающий трансформацию клетки-хозяина Bacillus-продуцента представляющего интерес гетерологичного белка указанным вектором; и выращивание указанной модифицированной клетки в оптимальных условиях. Описан способ получения представляющего интерес белка в модифицированной клетке Bacillus, где способ включает культивирование указанной клетки-хозяина; и выращивание указанной модифицированной клетки Bacillus в оптимальных условиях. Кроме того, раскрыт способ усиления экспрессии представляющего интерес гетерологичного белка из Bacillus, включающий получение указанной модифицированной клетки Bacillus; выращивание модифицированной клетки Bacillus в оптимальных условиях; и экспрессию указанного представляющего интерес белка в модифицированной клетке Bacillus, где экспрессия указанного представляющего интерес гетерологичного белка в модифицированной клетке Bacillus усиливается по сравнению с экспрессией указанного представляющего интерес белка в указанной родительской клетке-хозяине Bacillus. Изобретение позволяет повысить выход целевого белка за счет сверхэкспрессии белка YmaH. 7 н. и 23 з.п. ф-лы, 4 ил., 3 пр.

Изобретение относится к области биотехнологии и пищевой промышленности. Представлено растение ячменя, которое дает зерно и является гомозиготным, по меньшей мере, в двух локусах для введенных генетических вариаций, которые представляют собой: a) аллель, в которой удалена большая часть или все гены, кодирующие В-гордеин в локусе Hor2, и b) мутантную аллель в локусе Lys3 ячменя, так что зерно не содержит ни В-, ни С- гордеинов, и указанные генетические вариации присутствуют в ячмене линий Riso 56 и Riso 1508 соответственно, при этом отсутствие В-гордеинов является обнаружимым по отсутствию амплифицированной ДНК с использованием праймеров: 5'B1hor: 5'-CAACAATGAAGACCTTCCTC-3', 3'B1hor: 5'-TCGCAGGATCCTGTACAACG-3', а отсутствие С-гордеинов является обнаружимым по отсутствию 70 кДа полосы при исследовании спирторастворимого экстракта зерна посредством ДСН-ПААГ. Также представлены: зерно ячменя, полученное от указанного растения; пищевые продукты, не содержащие В- и С-гордеинов, полученные из указанного зерна, такие как мука, солод, пиво. Кроме того, описаны способы получения пищевых продуктов (муки, цельнозерновой муки, крахмала, солода) и напитков с использованием зерна, полученного от растения ячменя, имеющего указанные выше признаки. Предложен способ идентификации ячменного зерна, пригодного для производства пищевого продукта и/или напитка на основе солода, пригодного для употребления лицом с целиакией, включающий: a) получение одного или нескольких материалов: i) образца растения, способного давать указанное зерно, ii) зерна, iii) солода, полученного из зерна, и/или iv) экстракта указанного зерна; b) анализ материала со стадии а) на наличие, по меньшей мере, одного гордеина и/или, по меньшей мере, одного гена, кодирующего гордеин, с выбором зерна, имеющего генный набор указанного выше растения. Изобретение позволяет получать пищевые продукты или напитки на основе солода, которые не содержат В- и С-гордеинов. 14 н. и 13 з.п. ф-лы, 14 ил., 10 табл., 10 пр.

Изобретение относится к области биохимии и представляет собой способ получения L-аминокислоты - L-лизина, L-треонина, L-аспарагина, L-аспарагиновой кислоты, L-метионина или L-изолейцина - предусматривающий культивирование бактерии Escherichia coli в среде для получения и накопления L-аминокислоты и сбор L-аминокислоты. Бактерию модифицируют таким образом, чтобы повысить экспрессию ее гена gltP или гена gltS. Изобретение позволяет повысить выход целевой L-аминокислоты. 11 з.п. ф-лы, 5 табл., 5 пр.

Изобретение относится к химико-фармацевтической промышленности и представляет собой средство для вовлечения мезенхимальной стволовой клетки костного мозга в периферическую кровь из костного мозга, которое вводят в кровеносный сосуд или мышцу и которое содержит любой из компонентов: (a) белок HMGB1; (b) клетка, которая секретирует белок HMGB1; (c) вектор, в который встроена ДНК, кодирующая белок HMGB1; (d) белок HMGB2; (e) клетка, которая секретирует белок HMGB2; (f) вектор, в который встроена ДНК, кодирующая белок HMGB2; (g) белок HMGB3; (h) клетка, которая секретирует белок HMGB3; и (i) вектор, в который встроена ДНК, кодирующая белок HMGB3. 3 н. п. ф-лы, 6 пр., 1 табл., 14 ил.

Изобретение относится к биохимии. Описан способ иммунологического анализа белка CXCL1 человека. Измеряют CXCL1 человека или его фрагмент в образце, используя два или более типов моноклональных антител к CXCL1 человека или их фрагменты. Каждый из двух или более типов моноклональных антител к CXCL1 человека или их фрагментов специфично распознают любой из участков последовательности аминокислотных последовательностей, представленных в SEQ ID NO:1-3, которые представляют собой частичные последовательности аминокислотной последовательности, составляющей белок CXCL1 человека. При этом два или более типов моноклональных антител к CXCL1 человека или их фрагментов специфично распознают участки последовательности, отличающиеся друг от друга. Представлены моноклональные антитела или их фрагменты, каждый из которых специфично распознает любой участок аминокислотной последовательности, представленный в SEQ ID NO:1-3, и имеет новую аминокислотную последовательность. Изобретение позволяет определять с высокой чувствительностью белок CXCL1 человека. 6 н. и 9 з.п. ф-лы, 9 ил., 1 табл., 21 пр.

Изобретение относится к области биотехнологии и касается применения штамма дрожжей Komagataella pastoris ВКПМ Y-727. Охарактеризовано применение штамма дрожжей Komagataella pastoris ВКПМ Y-727 в качестве реципиента для конструирования продуцентов целевого белка, необязательно включающее введение в него мутаций, обеспечивающих использование ауксотрофных селективных маркеров. Представленное решение может быть применимо при получении рекомбинантных белков без использования метанола в качестве индуктора экспрессии генов. 8 ил., 4 табл., 10 пр.
Наверх