Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа



Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа
Новый эпитоп bnp (1-32) и антитела, направленные против указанного эпитопа

 


Владельцы патента RU 2511033:

БИО-РАД ИННОВАСЬОН, (FR)
САНТР НАСЬОНАЛЬ ДЕ ЛЯ РЕШЕРШ СЬЕНТИФИК (С.Н.Р.С.) (FR)

Изобретение относится к области биохимии, в частности к полипептиду, несущему эпитоп BNP(1-32) человека, для получения лигандов, направленных против BNP(1-32) человека или proBNP(1-108) человека, где указанный полипептид имеет формулу a 1 R 1 X 1 F G R K M D R X 2 R 2 a 2 . Раскрыто применение указанного полипептида для получения лигандов, направленных против BNP(1-32) человека или proBNP(1-108) человека и для получения гибридомы, которая секретирует моноклональное антитело, направленное против BNP(1-32) человека или proBNP(1-108) человека. Раскрыт способ получения гибридомы, которая секретирует моноклональное антитело, направленное против BNP(1-32) человека или proBNP(1-108) человека, а также полученная гибридома. Раскрыт лиганд, специфичный к эпитопу с последовательностью FGRKMDR, а также его применение для детектирования в биологическом образце BNP(1-32) человека или proBNP(1-108) человека. Раскрыт способы детектирования в биологическом образце BNP(1-32) человека или производного proBNP(1-108) человека, способ in vitro диагностики, прогноза, стратификации риска или последующего наблюдения отдаленных результатов сердечной и/или сосудистой патологии у индивидуума, а также способ in vitro диагностики инсульта у индивидуума с использованием указанного лиганда. Раскрыт мультиэпитопный калибратор, предназначенный для получения калибровочных кривых для анализов BNP(1-32), proBNP(1-108), а также набор для детектирования BNP(1-32) человека или proBNP(1-108) человека. Изобретение позволяет эффективно детектировать сердечные и/или сосудистые патологии у индивидуума. 12 н. и 3 з.п. ф-лы, 17 ил., 12 табл., 18 пр.

 

Область техники, к которой относится изобретение

Данное изобретение относится к натрийуретическим пептидам головного мозга человека (BNP) и диагностике in vitro застойной сердечной недостаточности у людей. Более конкретно, данное изобретение относится к новому эпитопу, присутствующему в молекуле BNP(1-32), антителам, направленным против указанного эпитопа, в частности моноклональному антителу 20G7, способу для иммунологического анализа BNP(1-32) и proBNP(1-108) и их соответствующих фрагментов с использованием такого антитела и наборам для тестирования для проведения указанных анализов.

Уровень техники

Застойная сердечная недостаточность является обычным клиническим синдромом, в частности, среди пожилых людей. Она обычно проявляется в форме протекающего бессимптомно запускания неспецифических симптомов, таких как кашель после физического напряжения, усталость и появление периферического отека. Диагностика и оценивание тяжести поражения (разделяемые на стадии I-IV NHYA в соответствии с New York Heart Association) основываются на объединенной интерпретации клинических признаков и результатов специфических тестов и испытаний (эхокардиографии, сцинтиграфии, теста на переносимость физической нагрузки и т.д.).

Вследствие тяжести застойной сердечной недостаточности, а также высокой стоимости ухода за пациентом, ранняя диагностика этого синдрома является явно высокожелательной, так как она способствовала бы выполнению лечений, подходящих для избежания или задержки быстрого прогрессирования этого синдрома в тяжелую застойную сердечную недостаточность. Таким образом необходимо идентифицировать людей, находящихся при риске застойной сердечной недостаточности и/или имеющих неблагоприятный прогноз или последующие осложнения. Это позволило бы также предложить одни и те же инструменты для (быстрого, простого и экономичного) терапевтического мониторинга пациентов, подлежащих лечению. В настоящее время такие способы диагностики, прогноза и мониторинга застойной сердечной недостаточности имеются и описаны ниже, но оказалось, что они являются несколько неудовлетворительными и не дающими полной информации.

Острые коронарные синдромы (ACS) являются также основной проблемой здоровья в настоящее время. Они включают в себя следующие сердечные заболевания: Q-инфаркт миокарда, инфаркт миокарда с повышением ST-сегмента или без повышения ST-сегмента, угрозу инфаркта миокарда или нестабильную стенокардию.

Диагностика, прогноз и мониторинг ACS являются также крайне важными в медицинском сообществе. Большой интерес в этих приложениях имеет анализ натрийуретических пептидов (BNP(1-32), NT-proBNP(1-76) и proBNP(1-108)).

То же самое относится к случаям одышки (диспноэ) (болезни, характеризующейся затруднениями дыхания), нарушениям мозгового кровообращения (также известным как "инсульт" или "апоплексия") и ассоциированным патологиям, таким как почечная недостаточность и диабет, ассоциированным с такими патологиями.

В течение длительного времени проводились поиски пресимптоматических маркеров, которые могут предсказывать застойную сердечную недостаточность. В этом отношении было показано, что кардиомиоциты продуцируют и секретируют пептиды с натрийуретической активностью: пептид, происходящий из ушка предсердия, ANP (предсердный натрийуретический пептид), обнаруженный в крысах de Bold et al., Life Scieyces 1981, vol. 28(1): 89-94, и натрийуретический пептид аурикуловентрикулярного происхождения, известный как BNP (натрийуретический пептид головного мозга), обнаруженный авторами патента ЕР 418308 и Sudoh et al. (1988) Nature 332:78-81 в свиньях и в людях.

Предшественник BNP, preproBNP(1-134), является формой запасания этой молекулы внутри кардиомиоцитов. Указанный предшественник расщепляется во время и/или после его секреции с целью высвобождения сигнального пептида и proBNP(1-108). ProBNP(1-108) состоит из полипептида из 108 аминокислот последовательности: H1PLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATE GIRGHRKMVLYTLRAPR76S77PKMVGSGCFGRXMDRISSSSGLGCKVLRRH108 (SEQ ID NO: 1).

Он расщепляется до и/или после секреции между аминокислотами Arg76 и Ser77 на BNP, с одной стороны, известный также как BNP(77-108) или BNP-32 или даже BNP(1-32) (термин, который будет использоваться здесь далее), и N-концевую часть этого прогормона, BNP(1-76), также известную как N-концевой фрагмент proBNP или NT-proBNP(1-76) (термин, который будет использоваться здесь далее).

BNP(1-32), вазоактивная форма этой молекулы, состоит из пептида из 32 аминокислот последовательности: S1PKMVGSGCFGRKMDRISSSSGLGCKVLRRJH32 (SEQ ID NO:2).

17 аминокислот образуют петлю, замкнутую дисульфидной связью между двумя окисленными остатками цистеина (С10 и С26), причем указанная петля окружена слева 9 аминокислотами (которые составляют N-концевую часть) и справа 6 аминокислотами (которые составляют C-концевую часть).

Целостность петли является важной для получения хорошей биологической активности. Из этих 17 остатков, образующих петлю, 11 остатков являются также консервативными в 2 других натрийуретических пептидах, которые являются ANP (натрийуретическим пептидом А-типа) и CNP (натрийуретическим пептидом С-типа).

NT-proBNP(1-76) образован 76 N-концевыми аминокислотами proBNP(1-108) и имеет следующую последовательность:

H1PLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR76 (SEQ ID NO: 3).

Интересно, что эти 3 полипептида, proBNP(1-108), NT-proBNP(1-76) и BNP (1-32), оказались хорошими маркерами застойной сердечной недостаточности, так что были разработаны различные анализы со специфическими комбинациями антител.

Действительно, когда было показано, что proBNP(1-108) циркулирует в крови, с первоначальных исследований Tateyama et al. (1992) Biochemical and Biophysical Research Communications 185: 760-767, были предложены различные иммунологические анализы для детектирования proBNP(1-108). Так, Заявка на патент WO 99/13331 описывает сэндвич-анализ proBNP(1-108) с использованием антитела, которое узнает 1-76-часть proBNP(1-108), и анти-BNP(1-32)-антитела. Этот тип анализа теряет чувствительность вследствие связывания на твердой фазе (т.е. с иммобилизованными антителами) побочными продуктами расщепленного proBNP(1-108), имеющими эпитоп, узнаваемый иммобилизованным антителом, то есть NT-proBNP(1-76) и продуктами, образующимися из его прогрессирующего расщепления.

Заявка WO 2004/14952 описывает детектирование proBNP(1-108) с использованием, с одной стороны, антитела, которое узнает эпитоп с последовательностью RAPRSP, расположенный в шарнирной области NT-proBNP(1-76) и BNP(1-32) (также называемого антителом hinge 76), и, с другой стороны, анти-BNP(1-32)-антитела, так что в этом типе анализа этот анализ является специфическим только в отношении прогормона, т.е. отсутствует перекрестная реактивность с этими двумя формами NT-proBNP(1-76) и BNP (1-32).

Что касается анализа NT-proBNP(1-76), Заявка WO 93/24531 описывает способ диагностики in vitro застойной сердечной недостаточности на основе детектирования NT-proBNP(1-76). Однако способ, описанный в заявке WO 93/24531, по-видимому, нелегко проводить HaNT-proBNP(1-76) в пробах крови. Действительно, единственные показанные примеры проводили не на сыворотках человека, а на диапазонах стандартов, полученных с использованием синтетического пептида, пептида NT-proBNP(47-64). Оказалось, что для преодоления этого недостатка необходима высокоусложненная автоматизированная система.

Наконец, множество анализов BNP(1-32) были разработаны с использованием различных антител. Например, патент Японии JP 2676114 В2 описывает 2 моноклональных антитела (KY-hBNPI и KY-hBNPII), которые узнают циклическую структуру BNP(1-32), без других подробностей.

Кроме того, заявка на патент ЕР 542255 описывает моноклональное антитело, которое узнает гистидин H32, последнюю аминокислоту C-концевого эпитопа K27VLRRH32 BNP(1-32). Известны другие эпитопы, присутствующие на BNP(1-32): описаны также 3 эпитопа последовательности 1SPKMVQGSGC10 (SEQ ID NO: 22), 5VQGSGCFGR13 (SEQ ID NO: 21) и 15MDRISSSSGLG25 (SEQ ID NO: 23) как являющиеся высокоиммуногенными в заявке WO 97/32900 и патенте US 6,162,902. Указанные документы описывают также моноспецифические антитела, направленные против этих эпитопов.

В 2005 году компания HyTest (Turku, Finland) предоставила различные антитела, специфические в отношении BNP(1-32), на рынок. Как описано в статье Sefehan et al. (2007) Clinical Chemistry 53:5, 866-873, некоторые из анти-BNP(1-32)-антител нацелены на район 1-10, 11-22, 17-23 или 26-32 BNP(1-32). Среди 17 антител, полученных иммунизацией мышей Balb/c с использованием пептида 11FGRKIVIDRISSSS22 (SEQ ID NO: 61) BNP (1-32), описаны только моноклональные антитела 24С5 и 26Е2. Однако их эпитопы не охарактеризованы точно: указывается только, что они направлены против вышеупомянутой последовательности аминокислот 11-22 BNP(1-32).

Заявка на патент WO 2006/88700 описывает другой эпитоп, присутствующий на BNP(1-32). Он имеет последовательность аминокислот R13(K14)(M15)D16R17I18 (SEQ ID NO: 24), включенную в аминокислоты 13-20, которые образуют часть циклической структуры BNP(1-32) человека. Эта заявка описывает также моноклональное антитело, названное 3-631-436, которое узнает специфически этот эпитоп. 4 аминокислоты R13, D16, R17 и I18 описаны как являющиеся значимо функциональными в отношении связывания антитела 3-631-436 с этим эпитопом. Аминокислоты, расположенные справа от этого эпитопа (такие, как фенилаланин F11 и глицин G12), не упоминаются. Одним из недостатков гормона BNP(1-32) является то, что он является нестабильным в плазме и в сыворотке. Действительно, ферменты типа протеазы, по-видимому, расщепляют BNP(1-32). Например, Shimizu et al. (2002) Clinica Chimica Acta 316: 129-135 сообщают, что N-концевая часть BNP(1-32), более конкретно связь Pro2-Lys3, могла расщепляться протеазами, так же как и связь Arg30-Arg31 в С-концевом положении. Boerrigter et al. (2007) Am. J. Physiol. Regul. Integr. Comp. Physiol. 292: R897-90 и Hawkridge et al (2005) Proc. Natl. Acad. Sci. USA. 102: 17442-7 описали, в частности, деградацию BNP(1-32) в N-концевом положении.

Подобным образом сообщались некоторые расщепления связей, вызываемые эндопептидазами (Davidson & Struthers (1994) J. Hypertension 13: 329-336). Таким образом, анализ BNP(1-32) требует особых предосторожностей (Davidson et al. (1995) Circulation 91: 1276-7; Gobinet-Georges et al. (2000) Clin. Chem. Lab. Med. 38: 519-23) и предполагает подходящий выбор антител.

Недавно несколько групп исследователей показали, что натроийуретические пептиды могли бы циркулировать в гликозилированной и/или укороченной форме (Schellenberger (2006) Arch. Biochem. Biophys. 451: 160-6; Liang et al. (2007) Journal of the American College of Cardiology 49: 1071-8; Lam et al. (2007) Journal of the American College of Cardiology 49: 1193-292).

Что касается ранней диагностики застойной сердечной недостаточности, ACS, одышки (диспноэ) и других сердечно-сосудистых заболеваний, а также CVA и ассоциированных патологий, таких как диабет и почечная недостаточность, всегда существует потребность в улучшении реагентов и способов для детектирования BNP(1-32) и proBNP(1-108), в частности, с учетом проблемы нестабильности BNP(1-32).

Раскрытие изобретения

Данное изобретение логически вытекает из совершенно неожиданного обнаружения авторами этого изобретения неизвестного и непредполагаемого эпитопа, который существует в молекуле BNP(1-32) человека, и специфического моноклонального антитела, которое узнает указанный эпитоп. Вопреки всем ожиданиям авторы этого изобретения обнаружили, что последовательность F11GRKMDR17 (SEQ ID NO: 51) BNP(1-32) составляет предпочтительный эпитоп для генерирования антител, которые узнают эту циклическую структуру (аминокислоты 10-26) BNP(1-32), и они получили моноклональное антитело, названное 20G7, которое специфически узнает указанный эпитоп F11G12RK14MDR17 (SEQ ID NO: 51). Другими словами, антитело 20G7 является моноклональным антителом, специфическим в отношении эпитопа F11GRKMDR17 (SEQ IDNO: 51) BNP(1-32).

Данное изобретение обеспечивает также способ иммуноанализа для детектирования BNP(1-32) и proBNP(1-108), а также их циркулирующих фрагментов с использованием моноклонального антитела 20G7 и реагентов, содержащих указанное антитело.

Действительно, авторы изобретения заметили, что при синтезе пептидов, локализованных в циклическом районе (аминокислоты 10-26) BNP(1-32) человека, и иммунизации мышей указанными пептидами некоторые полученные антитела реагировали с пептидами этого типа только в том случае, если указанные пептиды содержали остатки фенилаланина F11, лизина K14 и аргинина R17, и что изолейцин I18, который был особенно значимым в эпитопе, описанном в международной заявке WO 2006/88700, не принадлежал к эпитопу в соответствии с данным изобретением.

Например, авторы этого изобретения иммунизировали некоторых мышей пептидом TGCFGRKMDRISTSTAIGCKVL (SEQ ID NO: 4), а других пептидом (SEQ ID NO: 5). Они наблюдали, что иммунная реакция с BNP(1-32) была гораздо большей в мышах, иммунизированных пептидом TGCFGRKMDRISTSTAIGCKVL (SEQ ID NO: 4), чем в мышах, иммунизированных пептидом SGCYGRKMDRISTSTAIGCKVL (SEQ ID NO: 5). Следует отметить, что в обоих случаях цистеины присутствовали в окисленной форме через внутриклеточную дисульфидную связь.

Таким образом, после лимфоцитарного слияния клеток селезенки иммунизированных мышей авторы изобретения были способны получать разные гибридные клоны. В частности, они получали моноклональное антитело, названное 20G7-15/03/2007 (далее здесь называемое "20G7" для удобства), которое узнает только пептиды BNP(1-32) и proBNP(1-108), которые содержат остатки фенилаланина F11, лизина K14 и аргинина R17. Действительно, было доказано, что эти аминокислоты F11, K14 и R17 являются важными для оптимального связывания моноклонального антитела 20G7 с BNP(1-32) и с proBNP(1-108), а также их соответствующими фрагментами.

Гибридому, которая секретирует моноклональное антитело 20G7-15/03/2007 (20G7), депонировали 13 апреля 2007 года Bio-Rad в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75724 Paris Cedex 15, France) под регистрационным номером CNCM I-3746.

Удивительным и неожиданным образом авторы этого изобретения наблюдали с антителом 20G7, что как только остатки F11, K14 и R17 заменяли аланином, отдельно или вместе, наблюдалось существенное действие на антигенную реактивность этого пептида в сравнении с природным пептидом SGCFGRKMDRISSSSGLGCKVL (SEQ ID NO: 6), тогда как замена других аминокислот в этом эпитопе почти не влияла на антигенную реактивность этого пептида. Кроме того, тщательное исследование, проведенное на антителе 20G7, показало, что оно узнает эпитоп F11GRKMDR17 (SEQ ID NO: 51), но не узнает ни последовательность A11GRKMDR17 (SEQ ID NO: 62), ни последовательность GRKMDR17I18(SEQ ID NO: 52), ни последовательность C10F11GRKMD (SEQ ID NO: 50).

Таким образом, моноклональное антитело 20G7 узнает эпитопную последовательность F11GRKMDR17 (SEQ ID NO: 51) BNP(1-32), но по существу не узнает ни один из вышеупомянутых эпитопов VQGSGCFGR (SEQ ID NO: 21), SPKMVQGSGC (SEQ ID NO: 22) и MDRISSSSGLG (SEQ ID NO: 23)) заявки WO 97/32900 и эпитоп R(K)(M)DRI (SEQ ID NO: 24) заявки WO 2006/88700.

Таким образом, данное изобретение относится к полипептиду, несущему эпитоп BNP(1-32) человека, имеющему формулу (I):

a 1 R 1 X 1 F G R K M D R X 2 R 2 a 2 ( I ) ,

где:

- a1 может быть Н или обозначает функциональную группу или химическую группу, выбранную из функциональной тиоловой, спиртовой, аминоксигруппы, группы первичного амина или вторичного амина, аминокарбоксильной группы, биотинильной группы и ацетильной группы;

- а2 может обозначать функциональную группу ОН, NH2 или алкоксильную группу (как будет понятно лицу с квалификацией в данной области, a2, присоединенный к карбонильной (-СО-)-части кислотной функциональной группы последней аминокислоты этого полипептида);

- X1 отсутствует или присутствует и, когда присутствует, выбран из С и GC;

- Х2 отсутствует или присутствует и, когда присутствует, выбран из I и IS;

- R1 и R2, которые могут быть одинаковыми или различными, отсутствующими или присутствующими, обозначают любую аминокислоту или пептидную цепь из 2-15 аминокислот при условии, что указанный полипептид формулы (I) не включает в себя никакую часть BNP (1-32) человека, большую чем 11 аминокислот, включающих в себя последовательность GCFGRKMDRIS (SEQ ID NO: 63).

В качестве эквивалентной альтернативы формула (I) может быть определена следующим образом:

a1-(R1)-(G)-(C)-FGRKMDR-(I)-(S)-(R2)-a2,

где a1, а2, R1 и R2 имеют определенные выше значения.

"Эпитоп" или "эпитопный сайт" обозначает аминокислотную последовательность, которая узнается, по меньшей мере, одним антителом и позволяет этому антителу связываться специфически с указанной аминокислотной последовательностью.

В предпочтительном варианте осуществления R1 и R2 могут быть связаны с молекулами-носителями, реагентами или маркерными молекулами.

В другом предпочтительном варианте осуществления указанный полипептид выбран из группы, состоящей из a1SGCFGRKMDR-a2 (SEQ ID NO: 33), a1-GCFGRKMDRI-a2 (SEQ ID NO: 34), a1CFGRKMDRIS-a2 (SEQ ID NO: 35) и a1FGRKMDRISS-a2 (SEQ ID NO: 36), где a1 и a2 имеют определенные выше значения.

В другом предпочтительном варианте осуществления определенный выше полипептид соответствует формуле (II):

a 1 F G R K M D R a 2 ( I I ) ,

где a1 и а2 имеют определенные выше значения.

Данное изобретение относится также к применению полипептида, определенного здесь выше, для получения лигандов, направленных против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR (SEQ ID NO: 51).

"Фрагмент proBNP(1-108)" в соответствии с этим изобретением обозначает любой фрагмент, который меньше, чем proBNP(1-108), в том числе, в частности, BNP(1-32), например фрагмент proBNP(3-108), описанный в Lam et al. (2007) J. Am. Coll. Cardiol. 49:1193-1202 и полученный расщеплением дипептидазой. Термин "фрагмент proBNP(1-108)" в соответствии с этим изобретением включает в себя также любой полипептид, который был подвергнут, по меньшей мере, одной посттрансляционной модификации proBNP(1-108), такой как фосфорилирование, гликозилирование или т.п. Например, Schellenberger et al. (2006) Arch. Biochem. Biophys. 51: 160-6 показали, что proBNP(1-108) является гликопротеином, который O-гликозилирован полностью или частично.

"Фрагмент BNP(1-32)" в соответствии с этим изобретением обозначает любой фрагмент, меньший, чем BNP(1-32). В этом случае также деградация BNP(1-32) уже сообщалась в литературе: например, фрагмент BNP(3-32) был описан Lam et al. (supra) и Hawkridge et al. (2005) Proc. Natl. Acad. Sci. USA 102: 17442-7.

Термины "proBNP(1-108)" и "BNP(1-32)", а также "фрагмент proBNP(1-108)" и "фрагмент BNP(1-32)" включают в себя также любой полипептид, который был подвергнут, по меньшей мере, одной посттрансляционной модификации proBNP(1-108), такой как фосфорилирование, гликозилирование или т.п. Например, Schellenberger et al. (2006) Arch. Biochem. Biophys. 51: 160-6 показали, что proBNP(1-108) является гликопротеином, который O-гликозилирован полностью или частично.

"Лиганды, направленные против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR", обозначают любую молекулу, способную связываться специфически с BNP(1-32) человека, с proBNP(1-108) человека или с их фрагментами.

Термин "специфический", когда он относится к узнаванию лиганда или связыванию лиганда с мишенью, означает, что этот лиганд взаимодействует с мишенью без взаимодействия по существу с другой мишенью, которая структурно не похожа на эту мишень. "Специфическое" узнавание эпитопа FGRKMDR означает, что взаимодействие этого лиганда с мишенью, содержащей этот эпитоп, по существу не включает в себя антигенных детерминант, в частности аминокислот, других, чем аминокислоты этого эпитопа. В частности, это означает, что этот лиганд способен связывать последовательность аминокислот последовательности BNP(1-32) и/или proBNP(1-108), a также их соответствующих фрагментов, содержащих аминокислоты, содержащие эпитоп FGRKMDR, но неспособны связывать последовательность аминокислот последовательности BNP(1-32) и/или proBNP(1-108), которая не содержит эпитоп FGRKMDR в его полном виде.

Кроме того, аминокислоту, присутствующую в эпитопе, называют "критической", когда ее замена аланином приводит к уменьшению, по меньшей мере, 50% антигенности указанного эпитопа, согласно Laune et al. (2002) Journal of Immunological Methods 267: 53-70.

Кроме того, аминокислоту, присутствующую в эпитопе, называют "незаменимой", когда ее замена аланином приводит к уменьшению, по меньшей мере, 80% антигенности указанного эпитопа.

Предпочтительно, лиганд, который узнает эпитоп FGRKMDR в соответствии с данным изобретением по существу не взаимодействует с пептидами, имеющими последовательность VQGSGCFGR (SEQ ID NO: 21), SPKMVQGSGC (SEQ ID NO: 22), MDRISSSSGLG (SEQ ID NO: 23), RKMDRI (SEQ ID NO: 24) и RKMDRISS (SEQ ID NO: 25).

Выражение "по существу не взаимодействует с пептидами, имеющими последовательность VQGSGCFGR, SPKMVQGSGC, MDRISSSSGLG, RKMDRI и RKMDRISS", означает, что этот лиганд имеет перекрестную реакцию с одной или другой из этих последовательностей, меньшую чем приблизительно 20%, более предпочтительно меньшую, чем 10%, особенно предпочтительно меньшую, чем 2%.

В объеме специфического узнавания мишени предпочтительными являются константы связывания, большие чем 106 М-1, более предпочтительно константы связывания, большие чем 108 М-1, и особенно предпочтительно константы связывания, большие чем 1010 М-1.

Предпочтительно, остатки F11, K14 и R17 являются также незаменимыми для связывания лиганда в соответствии с данным изобретением с эпитопом, так как их замена аланином характеризуется потерей 82, 95 и 85% соответственно связывания моноклонального антитела, продуцируемого гибридомой, депонированной 13 апреля 2007 года в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75 724 Paris Cedex 15, France) под регистрационным номером CNCM I-3746, с эпитопным пептидом.

Предпочтительно, этот лиганд выбран из группы, состоящей из антитела или фрагмента указанного антитела, который узнает этот эпитоп, аптамера и полипептида, который специфически узнает эпитоп, получаемый при помощи фагового дисплея.

В этом контексте термин "антитело" относится к любому поликлональному или моноклональному антителу.

Фрагменты scFv, Fab, Fab', F(ab')2, а также одноцепочечные антитела животных семейства верблюдовых являются примерами фрагментов антител, которые узнают этот эпитоп.

"Аптамеры" хорошо известны квалифицированному в данной области специалисту. Аптамеры являются соединениями нуклеотидного, в частности рибонуклеотидного или дезоксирибонуклеотидного, или пептидного, характера, способными специфически связываться с мишенью, в частности мишенью-белком. Аптамеры нуклеотидного характера описаны, в частности, Ellington et al. (1990) Nature 346: 818-22 and Bock et al. (1992) Nature 355: 564-6. Аптамеры пептидного характера описаны, в частности, Норре-Seyler et al. (2000) J. Mol Med. 78: 426-30.

"Фаговым дисплеем" называют способ отбора полипептидных лигандов, экспрессируемых на капсиде бактериофага и кодируемых последовательностью нуклеиновой кислоты, встроенной в кодирующий капсид ген. Этот способ хорошо известен квалифицированному в данной области специалисту и описан, в частности, Scott & Smith (1990) Science 249: 386-390 и Marks et al. (1991) J. Mol. Biol. 222: 581-597. Предпочтительно, полипептид, получаемый при помощи фагового дисплея, является полипептидом scFv-типа (одноцепочечным вариабельным фрагментом). Этот способ описан, в частности, Winter et al. (1994) Annu. Rev. Immunol. 12: 433-455.

Эти лиганды могут быть также получены химическим синтезом или генетической инженерией.

Предпочтительно, определенные выше полипептиды используют для получения антител, в частности моноклональных антител.

В этом контексте это изобретение относится также к применению полипептида, определенного выше, для получения гибридомы, которая секретирует моноклональное антитело, направленное против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR.

Таким образом, это изобретение относится к способу получения гибридомы, которая секретирует моноклональное антитело, направленное против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR, где:

- образцы лимфоцитов, секретирующих иммуноглобулины, берут из животного, такого как мышь, кролик или крыса, иммунизированного определенным выше полипептидом,

- затем эти лимфоциты сливают с миеломными клетками, такими как клетки миеломы Sp2 (ATCC CRL-1581), для получения гибридомы.

Данное изобретение относится также к гибридоме, получаемой по способу получения гибридомы, определенной выше.

Более конкретно, данное изобретение относится к гибридоме, депонированной 13 апреля 2007 года в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75724 Paris Cedex 15, France) под регистрационным номером CNCM I-3746.

Обычно методология, используемая для получения гибридом и моноклональных антител, может использовать общепринятый способ слияния лимфоцитов и культивирования гибридом, описанный Kohler & Milstein (1975) Nature 256: 495-497. Другие способы получения моноклональных антител также известны (например, Harlow et al., ed. 1988 "Antibodies: a laboratory manual").

Имеются также способы, альтернативные этому общепринятому способу. Моноклональные антитела могут быть получены, например, экспрессией нуклеиновой кислоты, клонированной из гибридомы.

Данное изобретение относится также к лиганду, специфическому в отношении эпитопа с последовательностью FGRKMDR.

Предпочтительно, этот лиганд выбран из группы, состоящей из антитела или фрагмента указанного антитела, который узнает эпитоп, аптамера и полипептида, который специфически узнает эпитоп, полученный при помощи фагового дисплея.

Более предпочтительно, этот лиганд является антителом, которое специфически узнает эпитоп с последовательностью FGRKMDR, или фрагментом указанного антитела, который специфически узнает этот эпитоп. Даже более предпочтительно, этот лиганд является моноклинальным антителом, в частности моноклональным антителом, продуцируемым определенной выше гибридомой.

Таким образом, это изобретение относится, в частности, к лиганду, определенному выше, состоящему из моноклонального антитела, продуцируемого гибридомой, депонированной 13 апреля 2007 года в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75 724 Paris Cedex 15, France) под регистрационным номером 1-3746.

Далее, это изобретение, более конкретно, относится к лиганду, определенному выше, несущему, по меньшей мере, один определяющий комплементарность район (CDR), в частности все эти CDR, определенного выше лиганда, состоящего из моноклонального антитела, продуцируемого гибридомой, депонированной 13 апреля 2007 года в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75 724 Paris Cedex 15, France) под регистрационным номером CNCM I-3746. CDR и способы переноса CDR из одного антитела в лиганд, предпочтительно другое антитело, хорошо известны в данной области и описаны, например, в Nicaise et al. (2004) Protein Science 13: 1882-1891 или Kettleborough et al. (1991) Protein Engineering 4: 773-783.

Кроме того, определенные выше лиганды могут быть связаны с молекулами-носителями, реагентами или мечеными молекулами.

Данное изобретение относится также к лиганду, определенному выше, для детектирования в биологической пробе BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR.

Действительно, данное изобретение относится также к способу детектирования в биологической пробе BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR, предусматривающему:

1) контактирование этой биологической пробы, по меньшей мере, с одним лигандом, определенным выше, предпочтительно при условиях, позволяющих образование комплексов антиген-лиганд;

2) детектирование любых комплексов, которые могли быть образованы.

В контексте этого изобретения "биологическая проба" или даже "проба биологической жидкости" состоит предпочтительно из биологической жидкости, такой как кровь, плазма, сыворотка, цереброспинальная жидкость, слюна, моча и слезы, и т.д. (см., например, Michielsen et al. (2008) Ann Clin Biochem 45: 389-94; Cortes et al., (2006) Eur J Heart Fail 8: 621-7; Kirchhoff et al., (2006) J Neurotrauma 23: 943-9; Kaneko et al., (1993) Brain Res 612: 104-9). Как имеется в виду в этом случае, термин "биологическая проба" включает в себя как пробу в таком виде, в каком она взята, так и пробу, которую подвергали различным обработкам, в частности, для придания ей свойств, подходящих для применения в процессах и способах в соответствии с данным изобретением.

В предпочтительном варианте осуществления вышеуказанный способ детектирования включает в себя, по меньшей мере, одну дополнительную стадию контактирования биологической пробы, по меньшей мере, с одним дополнительным лигандом, специфическим в отношении BNP(1-32) человека или proBNP(1-108) человека и их соответствующих фрагментов, который имеет другую специфичность, отличающуюся от специфичности лиганда по этому изобретению.

Предпочтительно, этот дополнительный лиганд является антителом. Данное изобретение относится также к способу диагностики, прогноза, стратификации риска (распределения факторов риска по степени вероятности) или последующего наблюдения отдаленных результатов, по меньшей мере, одной сердечной и/или сосудистой патологии в индивидууме, предусматривающему стадии:

1) контактирования биологической пробы из индивидуума, по меньшей мере, с одним лигандом, определенным выше, предпочтительно при условиях, позволяющих образование комплексов антиген-лиганд,

2) детектирования любого комплекса, который мог быть образован;

3) на основе результата детектирования в стадии 2, определения диагноза, прогноза, риска развития или терапевтического наблюдения отдаленных результатов этой патологии в этом индивидууме.

В конкретном варианте осуществления способ, определенный выше, включает в себя, по меньшей мере, одну дополнительную стадию контактирования биологической пробы из индивидуума, по меньшей мере, с одним дополнительным лигандом, специфическим в отношении производного BNP(1-32) человека или proBNP(1-108) человека, который имеет другую специфичность, отличающуюся от специфичности лиганда по этому изобретению.

Предпочтительно, этот дополнительный лиганд является антителом.

Предпочтительно, эта патология выбрана из группы, состоящей из:

- застойной сердечной недостаточности,

- острого коронарного синдрома,

- нарушения мозгового кровообращения (инсульта),

- почечной недостаточности,

- одышки (диспноэ),

- высокого кровяного давления,

- разрыва атероматозной бляшки,

- открытого артериального (Боталлова) протока у недоношенных новорожденных и/или

- диабета.

"Застойная сердечная недостаточность" обозначает патологическое состояние, в котором аномалия сердечной функции ответственна за то, что сердце неспособно достаточно накачивать кровь для удовлетворения метаболических потребностей организма, и/или в котором сердце удовлетворяет эти потребности, но при ненормально высоких давлениях наполнения. В частности, этот термин может относиться к декомпенсации левого и/или правого желудочка.

"Острые коронарные синдромы" обозначают, в частности, две категории:

- острую коронарную недостаточность, сопровождаемую стойкой анакротой [т.е. повышением] ST-сегмента, выявляющую образование трансмурального Q-инфаркта миокарда, соответствующую обычно острой общей коронарной окклюзии, и

- острую коронарную недостаточность без анакроты [т.е. без повышения] ST-сегмента, т.е. соответствующую не-Q-инфаркту миокарда, также известную как нестабильные стенокардии, которые соответствуют разрывам бляшек и неполным тромбозам и требуют другого лечения.

"Одышка (диспноэ)" обозначает патологическое состояние, характеризуемое затруднениями дыхания, сопровождаемыми ощущениями обструкции или спазма. Она является чрезвычайно частым симптомом, который может быть обусловлен несколькими причинами. Только методический подход делает возможным подходящее лечение.

Согласно определению Всемирной организации здравоохранения "цереброваскулярный приступ (нарушение мозгового кровообращения)", или "CVA", или "инсульт", или "апоплексия" означает патологическое состояние, характеризуемое быстрым развитием локализованных или глобальных признаков церебральной дисфункции, сопровождаемых симптомами, длящимися более 24 часов, которые могут приводить к смерти без видимой причины, иной, чем причина васкулярного происхождения.

Описанные выше процесс и способ могут проводиться в соответствии с различными форматами, хорошо известными квалифицированному в данной области специалисту, например в твердой или гомогенной фазе, в виде одной или двух стадий, при помощи сэндвич-способа или при помощи конкурентного способа.

Предпочтительно, используют сэндвич-способ в твердой фазе между 2 лигандами (предпочтительно антителами), причем один является иммобилизованным лигандом, а другой является детектирующим лигандом. Этот тип иммуноанализа особенно хорошо известен квалифицированному в данной области специалисту. Например, статья Sefehan et at. (2007) Clin. Chem. 53: 866-873 дает пример сэндвич-иммуноанализа (или иммунометрического анализа в 2 сайтах) для анализа BNP(1-32) и proBNP(1-108), в каждом случае с использованием пары антител (антитела, иммобилизованного в твердой фазе и меченого антитела в детектировании).

"Иммобилизованный лиганд" означает лиганд, способный связывать антиген BNP(1-32) и/или антиген proBNP(1-108), а также их соответствующие фрагменты, присутствующие в биологической пробе.

Присутствие этого антигена в биологической пробе выявляют с использованием средства детектирования, в частности "детектирующего лиганда". Детектирующий лиганд, который является меченым, способен связываться с иммобилизованным антигеном посредством узнавания эпитопного сайта, который является другим, чем эпитопный сайт, узнаваемый иммобилизованным лигандом.

Термин "меченый" относится как к прямому мечению, так и к непрямому мечению (например, посредством других лигандов, которые сами являются мечеными, или с использованием реагентов меченых "аффинных пар", таких как, но не только, парамеченый авидин-биотин, и т.д.).

В случае сэндвич-способа иммобилизованный лиганд предпочтительно выбран таким образом, что он специфически узнает эпитоп на природном антигене пациента, тогда как детектирующий лиганд выбран предпочтительно таким образом, что он специфически узнает другой эпитоп на этом природном антигене пациента.

Предпочтительно, иммобилизованный лиганд иммобилизуют на твердой фазе. В качестве неограничивающих примеров твердой фазы могли бы использоваться микропланшеты, в частности полистироловые микропланшеты, такие как микропланшеты, продаваемые Nunc, Denmark. Могут быть также использованы твердые частицы или гранулы, парамагнитные гранулы, такие как гранулы, производимые Dynal, Merck-Eurolab (France) (под товарным знаком Estapor TM) и Polymer Laboratories, или даже тест-пробирки из полистирола или полипропилена, стеклянные, пластиковые или силиконовые чипы и т.д.

Анализы ELISA, радиоиммуноанализы или любой другой способ детектирования могут быть использованы для выявления присутствия образованных комплексов антиген-антитело. Таким образом возможны различные типы мечения лигандов, в частности антител (радиоактивные, ферментативные, флуоресцентные и т.д.).

Детектирование может также проводиться новыми способами на основе накопления массы, такими как поверхностный плазменный резонанс (SPR), пьезоэлектрическое детектирование, но также детектирование при помощи масс-спектрометрии или любых других способов, определенных как способы, позволяющие исследовать взаимодействие типа лиганд-антиген в отсутствие второго меченого лиганда.

Одно предпочтительное осуществление вышеописанного процесса или способа состоит в использовании лиганда, определенного выше, иммобилизованного на твердой фазе, в комбинации, по меньшей мере, с одним моноклональным или поликлональным антителом, направленным против N-концевой части BNP(1-32), присутствующим в меченой форме.

Другое предпочтительное осуществление вышеописанного процесса или способа состоит в использовании лиганда, определенного выше, иммобилизованного на твердой фазе, в комбинации, по меньшей мере, с одним моноклональным или поликлональным антителом, направленным против C-концевой части BNP(1-32), таким как антитело 50В7 (специфическое в отношении 26-32-пептида BNP(1-32)), доступное из Ну Test, присутствующим в меченой форме.

Альтернативно, согласно еще одному предпочтительному осуществлению вышеописанного процесса или способа может быть использован лиганд, определенный выше, в меченой форме, в комбинации, по меньшей мере, с одним моноклональным или поликлональным антителом, направленным против N-концевой или C-концевой части BNP(1-32), присутствующим в иммобилизованной форме на твердой фазе.

Одно предпочтительное осуществление вышеописанного процесса или способа состоит в использовании лиганда, определенного выше, иммобилизованного на твердой фазе, в комбинации, по меньшей мере, с одним моноклональным или поликлональным антителом, направленным против N-концевой части NT-proBNP (1-108), таким как антитело 16F3 (специфическое в отношении пептида 13-20 NT-proBNP), доступное от Ну Test, присутствующим в меченой форме.

Альтернативно, предпочтительное осуществление вышеописанного процесса или способа состоит в использовании лиганда, определенного выше, в меченой форме в комбинации, по меньшей мере, с одним моноклональным или поликлональным антителом, направленным против N-концевой части NT-proBNP(1-108), таким как антитело 16F3 (специфическое в отношении пептида 13-20 NT-proBNP), доступное из HyTest, присутствующим в иммобилизованной форме на твердой фазе.

Другое предпочтительное осуществление вышеописанного процесса или способа состоит в использовании лиганда, определенного выше, иммобилизованного на твердой фазе, в комбинации с моноклональным антителом, направленным против последовательности RAPR76S77P (SEQ ID NO: 55) proBNP(1-108) (таким, как антитело, описанное в Заявке на патент WO 2004/14952, или Giuliani et al. (2006) Clin. Chem. 52: 1054-1061), присутствующим в меченой форме.

Альтернативно, предпочтительное осуществление вышеописанного процесса или способа состоит в использовании лиганда, определенного выше, в меченой форме в комбинации, по меньшей мере, с одним моноклональным или поликлональным антителом, направленным против последовательности RAPR76S77P (SEQ ID NO: 55) proBNP(1-108) (таким, как антитело, описанное в Заявке на патент WO 2004/14952, или Giuliani et al. (2006) Clin. Chem. 52: 1054-1061), присутствующим в иммобилизованной форме на твердой фазе.

Данное изобретение относится также к мультиэпитопному калибратору, имеющему общую формулу (III):

t 1 E 1 L 1 E 2 [ L k 1 E k ] n t 2 ( I I I ) ,

где:

- n обозначает целое число между 0 и 8;

- k обозначает целое число между 3 и n+2, когда n>0;

- E1, E2 и Ek отличаются друг от друга, причем один обозначает пептидную последовательность R1-X1-FGRKMDR-X2-R2, где X1, X2, R1 и R2 имеют определенные выше значения, а другие обозначают последовательность из 3-15 аминокислот, выбранных из последовательности proBNP(1-108) человека;

- t1 обозначает атом водорода, ацетильную группу, пептидную последовательность из 1-10 аминокислот, пептидную последовательность из 1-10 N-α-ацетилированных аминокислот, биотинильную или биоцитинильную группу, пептидную последовательность из 1-10 аминокислот, несущую биотинильный или биоцитинильный радикал, или линейную аминоалкил-(C1-C10)-карбонильную цепь;

- t2 обозначает гидроксильный радикал, аминорадикал, пептидную последовательность из 1-10 аминокислот, пептидную последовательность из 1-10 аминокислот, несущую концевую аминогруппу или линейную или разветвленную аминоалкил-(С110)-карбонильную цепь (как будет ясно для квалифицированного в данной области специалиста, t2 присоединен к карбонильной (-СО-) части кислотной функциональной группы последней аминокислоты En пептидной цепи;

- L1 и Lk, которые могут быть одинаковыми или различными, обозначают связывающую группу пептидных цепей.

Предпочтительно, вышеупомянутый мультиэпитопный калибратор соответствует следующей общей формуле (IV):

t 1 E 1 L 1 E 2 L 2 E 3 t 2 ( I V ) ,

где Е1, E2, Е3, L1, L2, t1 и t2 имеют определенные выше значения.

Предпочтительно, вышеупомянутый мультиэпитопный калибратор соответствует следующей общей формуле (V):

t 1 E 1 L 1 E 2 t 2 ( V ) ,

где е1, E2, L1, t1 и t2 имеют определенные выше значения.

Приведенные выше стандарты (или калибраторы) используют для получения калибровочных кривых для анализов BNP(1-32), proBNP(1-108) и/или одного из их вышеупомянутых фрагментов. Одним преимуществом указанных калибраторов является, в частности, их стабильность.

Предпочтительно, при использовании для анализа BNP(1-32) биэпитопный стандарт по этому изобретению содержит эпитоп FGRKMDR по этому изобретению и другой отличающийся эпитоп, который выбран из последовательности аминокислот 77-108 proBNP(1-108).

Предпочтительно, при использовании для анализа proBNP(1-108), биэпитопный стандарт по этому изобретению содержит эпитоп FGRKMDR по этому изобретению и другой отличающийся эпитоп, который выбран из последовательности аминокислот 1-76 proBNP(1-108) для гарантии специфичности в отношении proBNP(1-108).

Предпочтительно, при использовании для анализа BNP(1-32) триэпитопный стандарт по этому изобретению содержит эпитоп R1-X1-FGRKMDR-X2-R2 по этому изобретению и два других отличающихся эпитопа, которые выбраны из последовательности аминокислот 77-108 proBNP(1-108).

Предпочтительно, при использовании для анализа proBNP(1-108) триэпитопный стандарт по этому изобретению содержит эпитоп R1-X1-FGRKMDR-X2-R2 по этому изобретению и два других отличающихся эпитопа, которые выбраны из последовательности аминокислот 1-100 proBNP(1-108).

Предпочтительно, в вышеупомянутом калибраторе R1-X1-FGRKMDR-X2-R2 представляет пептидную последовательность, выбранную из группы, состоящей из SGCFGRKMDR (SEQ ID NO: 33), GCFGRKMDRI (SEQ ID NO: 34), CFGRKMDRIS (SEQ ID NO: 35), FGRKMDRISS (SEQ ID NO: 36), FGRKMDR (SEQ ID NO: 8), SFGRKMDRISS (SEQ ID NO: 64) и CFGRKMDRISSSSGLGCK (SEQ ID NO: 65).

Предпочтительно, последовательности, отличающиеся от R1-X1-FGRKMDR-X2-R2, выбраны из группы, состоящей из PRSPKMVQG (SEQ ID NO: 56), APRSPKMV (SEQ ID NO: 57), SGLGCKVL (SEQ ID NO: 58). SPKMVQGSG (SEQ ID NO: 59), YTLRAPRSPKMVG (SEQ ID NO: 60), YTLRAPRSPKMV (SEQ ID NO: 66), YTLRAPRSPKMVQG (SEQ ID NO: 67), SGLGCKVLRRH (SEQ ID NO: 68) и SGLGCKVLR (SEQ ID NO: 69).

Предпочтительно, мультиэпитопные калибраторы по этому изобретению выбраны из группы, состоящей из мультиэпитопных калибраторов, определяемых следующими формулами:

Ac-YTLRAPRSPKMV-L1-SFGRKMDRISS-NH2;

Ac-YTLRAPRSPKMV-L1-CFGRKMDRISSSSGLGCK-NH2;

Ac-YTLRAPRSPKMVQG-L1-FGRKMDR-NH2;

AC-FGRKMDR-L1-SGLGC*KVLRRH-OH;

Ac-FGRKMDR-L1-SGLGCrKVLR-NH2;

Ac-SPKMVQGSG-L1-FGRKMDR-NH2;

Ac-YTLRAPRSPKMV-L1-FGRKMDR-L2-SGLGC*KVLRRH-OH;

и Ac-YTLRAPRSPKMV-L1-FGRKMDR-L2-SGLGC*KVLR-NH2; где Ac представляет ацетильную группу и С представляет ацетамидометил-блокированный цистеин.

Предпочтительно, L1 и L2 представляют: -NH-(CH2)5-CO-.

Эта группа может, в частности, происходить из агента связывания, известного как аминогексановая кислота.

В случае присутствия E1, Е2 и Е3 говорят, что этот калибратор является триэпитопным, в случае присутствия только E1 и E2 говорят, что этот калибратор является биэпитопным.

Кроме того, данное изобретение относится также к набору для детектирования BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность, содержащему, по меньшей мере:

- лиганд, определенный выше;

- мультиэпитопный калибратор, определенный выше, и/или полипептид, определенный выше.

В конкретном варианте осуществления вышеуказанный набор содержит также положительную биологическую контрольную пробу.

Предпочтительно, набор по этому изобретению содержит, по меньшей мере, моноклональное антитело, продуцируемое гибридомой, депонированной 13 апреля 2007 года в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75 724 Paris Cedex 15, France) под регистрационным номером CNCM I-3746.

Следующие примеры и фигуры иллюстрируют это изобретение без его ограничения.

Перечень фигур

Фигура 1 показывает реактивность антитела 20G7 в отношении иммобилизованных пентадекапептидов, представляющих последовательность BNP(1-32) (слева направо, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16 и SEQ ID NO: 17), синтезированных способом Spot.

Фигура 2 показывает результат анализа на основе «аланинового сканирования» связывания антитела 20G7 с эпитопом FGRKMDR (замены каждого остатка этого пептида аланином) и показывает важность остатков F, G, K и R.

Фигура 3 изображает ингибирование связывания антител 20G7 и 24С5 с BNP(1-32) в присутствии увеличивающихся концентраций растворимого пептида с последовательностью SEQ ID NO: 51 ("АА11-АА17", ромбы), SEQ ID NO: 62 ("мутированный АА11-АА17", кружки) или SEQ ID NO: 9 ("делегированный АА11-АА17", треугольники).

Фигура 4 показывает результат анализа на основе «аланинового сканирования» связывания антитела 11А8 с эпитопом FGRKMDR (замены каждого остатка этого пептида аланином) и показывает важность остатков F, G, K и R.

Фигура 5 представляет диапазон стандартов BNP(1-32), детектируемый антителом 20G7.

Фигура 6 представляет диапазон стандартов proBNP(1-108), детектируемый антителом 20G7.

Фигура 7 показывает корреляцию между детектированием BNP(1-32) и proBNP(1-108) антителом 20G7 в пациентах с застойной сердечной недостаточностью.

Фигура 8 показывает корреляцию между детектированием BNP(1-32) и proBNP(1-108) антителом 20G7 в пробах из субъектов с застойной сердечной недостаточностью NYHA класса I (фиг.8А), NYHA класса II (фиг.8В) и NYHA класса III (фиг.8С).

Фигура 9 показывает корреляцию между детектированием BNP(1-32) и proBNP(1-108) антителом 20G7 в пробах из здоровых субъектов.

Фигура 10 показывает корреляцию между детектированием BNP(1-32) и proBNP(1-108) антителом 20G7 в пробах из субъектов с почечной недостаточностью.

Фигура 11 показывает концентрации BioPlex™ 2200 proBNP в образцах плазмы из популяций с ишемическим инсультом и из контрольной цитратной плазмы. Рамка пунктиром показывает минимальные 25-й, 50-й, 75-й процентили и максимальные величины.

Фигура 12 показывает корреляцию между детектированием BNP(1-32) и proBNP(1-108) антителом 20G7 в пробах из субъектов с острым коронарным синдромом.

Фигура 13 показывает корреляцию между анализом гликозилированного proBNP(1-108) и анализом негликозилированного proBNP(1-108) при помощи иммуноанализа, использующего антитело hinge 76, и в обнаружении антителом 20G7 в соответствии с этим изобретением.

Фигуры 14 и 15 показывают диапазон стандартов биэпитопных калибраторов CaliproBNPl и CaliproBNP3 соответственно с использованием устройства Bioplex™ 2200.

Фигура 16 показывает диапазон стандартов биэпитопного калибратора CaliproBNP5, proBNP(1-108) и BNP(1-32) при помощи иммуноанализа с использованием иммобилизованного поликлонального антитела L21016 и в обнаружении антителом 20G7 в соответствии с этим изобретением.

Фигура 17 показывает диапазон стандартов триэпитопного калибратора CaliproBNP6 и proBNP(1-108) в двух форматах иммуноанализа: одном, основанном на иммобилизации антитела hinge 76, и в обнаружении антителом 20G7 в соответствии с этим изобретением (белые и черные кружки), и в обнаружении антителом, направленным против эпитопа, локализованного в C-концевой части BNP(1-32) (белые и черные треугольники).

Осуществление изобретения

Примеры

Пример 1. Синтез пептидов

Материалы и способы

Синтетические пептиды получали стандартными способами, которые хорошо известны квалифицированному в данной области специалисту. Примером этого способа является синтез Меррифилда, который является предпочтительным вследствие того факта, что он может легко выполняться (Merrifield, (1963); R.C.Sheppard (1971); Atherton et al. (1989)). Синтезаторы "Pioneer" из Perspective или синтезатор "433А" из АВ1 могут быть использованы в качестве автоматизированного синтезатора. Эти пептиды могут быть также получены синтезом в гомогенной фазе.

Следующие синтезы проводили в синтезаторе Pioneer с использованием "Fmoc"-химии (9-флуоренилметилоксикарбонил): в каждой стадии реагенты (т.е. защищенную аминокислоту и активаторы связывания (TBTU тетрафторборат (2-(1Н-бензотриазол-1-ил)-1,1,3,3-гетрам етилурония)/HOBt (N-гидроксибензотриазол)) добавляли в избытке (в соотношении = 5 "моли реагента/моли групп, которые могут быть замещены, на этой смоле"). В конце этого процесса синтеза пептид отделяли от смолы раствором трифторуксусной кислоты (реагентом К). Затем этот пептид осаждали в охлажденном растворе эфира, лиофилизировали и затем очищали при помощи ВЖХ.

Таким способом авторы изобретения синтезировали пептиды, содержащие следующие аминокислотные последовательности:

SEQ IDNO: 4: Ac-TGCFGRKMDRISTSTAIGCKVLCys-CONH2,

SEQ IDNO: 5: Ac-SGCYGRKMDRISTSTAIGCKVL-CysCONH2

SEQ ID NO: 6: Ac-SGCFGRKMDRISSSSGLGCKVL-CysCONH2

SEQ ID NO: 7: Ac-SGCFGRKMDRIATSTAIGCKVL-CysCONH2

SEQ ID NO: 8: Ac-FGRKMDR-CONH2

SEQ ID NO: 9: Ac-GRKMDR-CONH2

SEQ ID NO: 10: Ac-FGRKMD-CONH2

SEQ ID N0:11: Ac-RKMDRI-CONH2

Пример 2. Получение иммуногена: связывание пептида с белком-носителем для иммунизации

Для иммунизации мышей этими пептидами необходимо связать указанные пептиды с белком-носителем, таким как KLH (гемоцианин моллюска (блюдечка)), тироглобулин или БСА (бычий сывороточный альбумин), посредством различных функциональных групп (тиоловой группы, аминогруппы, альдегидной группы и т.д.), чтобы сделать этот пептид иммуногенным. Реагент связывания, используемый для связывания этого пептида с белком, может быть гетеробифункциональным или гомобифункциональным. Наиболее часто используемыми реагентами являются BS3, sSMCC, SPDP, глутаровый альдегид и т.д.

Используемый способ связывания включал в себя бифункциональную молекулу sSMCC (Pierce, #22322), имеющую функциональную NHS-эфирную группу и малеимидную группу в качестве агента химического связывания и KLH (Pierce, #77600) в качестве белка-носителя.

2-а. Активация KLH

Способ

20 мг KLH солюбилизировали в 2 мл забуференного фосфатом солевого раствора (20 мМ фосфат, 0,9 М NaCl pH 7,2) для получения конечной концентрации 10 мг/мл (без встряхивания на вортексе). Параллельно 4 мг sSMCC солюбилизировали с использованием 400 мкл воды для инъекций с получением конечной концентрации 10 мг/мл. Затем 2 мл KLH (20 мг) смешивали с 200 мкл sSMCC (2 мг) и эту смесь инкубировали в течение 1 часа при комнатной температуре (20°С) при медленном перемешивании (20 оборотов в минуту).

2-b. Обессоливание активированного KLH

Способ

Колонку PD10 Sephadex TM G-25m (Ge healthcare, USA, кат. номер 17-0851-01) уравновешивали забуференным фосфатом солевым раствором (20 мМ фосфат, 0,9 М NaCl рН 7,2, 100 мМ ЭДТА). 2 мл активированного KLH помещали на эту колонку и затем элюцию начинали с использованием 3,5 мл 20 мМ буфера ЗФР, дополненного 0,9 М NaCl рН 7,2 и 100 мМ ЭДТА; собирали фракции 500 мкл. Оптическую плотность (OD) измеряли при 280 нм для каждой фракции, разбавленной до 1/25, и затем фракции, содержащие активированный KLH, идентифицировали и измеряли в соответствии с правилом Бира-Ламберта: OD=εC|: где OD обозначает оптическую плотность ε=1,499, С обозначает концентрацию и |=1 см, концентрация активированного KLH может быть определена и уменьшена до 7,4 мг/мл в забуференном фосфатом солевом растворе.

2-c. Связывание этого пептида с активированным KLH

Способ

10 мг лиофилизированного пептида солюбилизировали в 1 мл воды MiIIi-Q, которую дегазировали в ультразвуковом дезинтеграторе с получением конечной концентрации 10 мг/мл и затем смешивали с 7,4 мг активированного KLH (т.е. 1 мл раствора, полученного в 2-b.). Эту смесь оставляли инкубироваться в течение 2 часов при комнатной температуре (20°С) при медленном перемешивании (20 об/мин). Затем вводили раствор цистеина при концентрации 5 мг/мл в 20 мМ буфере ЗФР + 0,9 М NaCl рН 7,2 с получением конечной концентрации 1 мМ в растворе пептид/KLH, и всю эту смесь оставляли инкубироваться в течение 20 минут при комнатной температуре (20°С) при медленном перемешивании (20 об/мин).

2-d. Характеристика связанного пептида

Способ

Затем определяли концентрацию связанного пептида по способу Бредфорда (Bradford М., Anal. Biochem., 1976; 72: 248-54) следующим образом: получали диапазон стандартов от 50 до 1000 мкг/мл KLH для определения концентрации KLH пробы из OD при 595 нм. Для получения этого диапазона стандартов и для проведения этого анализа 50 мкл каждой точки этой пробы разбавляли в 1,5 мл красителя Кумасси синего (Bio-Rad, #1856210).

После определения этой концентрации к KLH-связанному пептиду добавляли ЗФР для доведения концентрации связанного пептида до 1 мг/мл.

Пример 3. Иммунизация мышей и получение моноклональных антител

3-а) Иммунизация мышей

Для получения моноклональных антител десять мышей (самок штамма Balb/c, 5-недельных, кат.номер: SIFE055, Charles Rivers, MA, USA) иммунизировали с использованием следующих пептидов:

Ac-TGCFGRKMDRISTSTAIGCKVL-Cys-CONH2, (SEQ ID NO: 4),

Ac-SGCYGRKMDRISTSTAIGCKVL-CysCONH2 (SEQ ID NO: 5),

связанных с KLH в соответствии с примером 2 (5 мышей для каждого пептида). Для первой инъекции готовили эмульсию 100 мкг KLH-связанного пептида (при концентрации 1 мг/мл), разведенную до 1/2 в полном адъюванте Фрейнда (Sigma, #F-5881), и 200 мкл указанной эмульсии (т.е. 100 мкг пептида) инъецировали подкожно в каждую мышь. С интервалами 20 дней три бустер-дозы 200 мкл эмульсии KLH-связанного пептида (т.е. 100 мкг пептида) и неполного адъюванта Фрейнда (Sigma, #F-5506) инъецировали подкожно, затем перитонеально в каждую мышь.

Спустя 20 дней после последней бустер-дозы и после того как полученные антитела оценивали по способу ELISA (в соответствии с примером 4, описанным выше), мышей с наивысшей реакцией против BNP(1-32) оставляли для подвергания гипериммунизации в соответствии со следующим протоколом:

- подкожная инъекция 200 мкл пептид-KLH при 1 мг/мл, разведенных до 1/20 с использованием ЗФР;

- 45-минутное выжидание;

- подкожная инъекция 200 мкл пептид-KLH при 1 мг/мл, разведенных до 1/20 с использованием ЗФР, в месте, другом, чем место первой инъекции;

- 45 минутное выжидание;

- подкожная инъекция 200 мкл пептид-KLH при 1 мг/мл, разведенных до 1/10 с использованием ЗФР, в месте, другом, чем места предыдущих инъекций;

- 30-минутное выжидание;

- внутрибрюшинная инъекция 100 мкл прометазина (2,5% фенерган, инъекционный раствор, UCB), разбавленных до 1 мг/мл с использованием ЗФР;

- 15-минутное выжидание;

- внутрибрюшинная инъекция 200 мкл пептид/KLH при 1 мг/мл, разбавленных до 3/10 с использованием ЗФР, в месте, другом, чем места предыдущих инъекций.

После этих иммунизаций было обнаружено, что мышь S2, иммунизированная пептидом SEQ ID NO: 4, продуцировала антисыворотку, которая была очень реактивной в отношении BNP(1-32) при применении протокола для детектирования антител, описанного ниже в примере 4. Затем лимфоциты из селезенки указанной мыши подвергали лимфоцитному слиянию, проводимому в соответствии с протоколом, описанным ниже в 3b.

3-b) Получение моноклональных антител

Слияние лимфоцитов клеток селезенки иммунизированной мыши S2 с клетками миеломы SP2 (АТСС CRL-1581) проводили в соответствии с хорошо известным протоколом Kohler and Milstein (1975) Nature 56: 495-497.

Таким путем авторам этого изобретения удалось получить различные гибридные клоны. В частности, они получали моноклональное антитело, которому было дано название 20G7 - 15/03/2007 (для удобства называемое здесь далее как "20G7"). Гибридома, которая секретирует моноклональное антитело 20G7 - 15/03/2007 (20G7), была депонирована в CNCM (French National Collection of Cultures of Microorganisms, Institut Pasteur, 25, rue du Docteur Roux, 75724 Paris Cedex 15, France) с регистрационным номером CNCM 1-3746 13 апреля 2007 года.

Само собой разумеется, что могут быть использованы другие протоколы для получения моноклональных антител, которые хорошо известны квалифицированному в данной области специалисту.

Пример 4. Детектирование анти-BNP(1-32)-антител для оценивания реакции мышей во время иммунизации

4.1. Материалы

Использовали следующие реагенты:

- 96-луночный плоскодонный микропланшет Maxisorp (Nunc, Denmark);

- буфер ЗФР (забуференный фосфатом солевой раствор), pH 7,4, таблетки Gibco, кат. номер 18912-014 (Invitrogen);

- BNP(1-32): синтетический пептид (Sigma-Aldrich, USA, #B-5900) или;

- proBNP(1-108) (рекомбинантный белок, продуцируемый в Е. coli, Ну Test, Finland);

- Tween® 20 (Sigma-Aldrich, USA, #P1379);

- вторичное антитело против мышиного IgG, продуцируемое в кролике и связанное с пероксидазой (Sigma, USA, #A9044);

- H2O2 (0,04% в 0,1 М цитратном буфере, pH 4);

- OPD (ортофенилендиамин, Sigma, USA, #P8412);

- серная кислота (H2SO4, 4N);

- сыворотки из мышей, иммунизированных в примере 3.

4.2. Способ и принцип

Тест ELISA проводили на твердом носителе для детектирования присутствия анти-BNP(1-32)-антител в пробе сыворотки мыши.

Некоторое количество этого антигена иммобилизовали адсорбцией в лунках 96-луночного микропланшета. После насыщения и блокирования оставшихся свободных сайтов иммунным сывороткам давали инкубироваться, и антитела («Ас»), которые могли присутствовать, связывались с этим антигеном («Ag») и образовывали комплекс Ag-Ac. Этот комплекс детектировали с использованием иммуноконъюгата (антитела против IgG мыши), связанного с ферментом, которым в этом случае была пероксидаза хрена (HRP), которая превращает бесцветный субстрат в окрашенный продукт, который указывает на присутствие желаемого антитела. Образование этого конечного окрашенного продукта определяли количественно проведением считывания оптической плотности при 490 нм (OD). Согласно этому способу, который хорошо известен квалифицированному в данной области специалисту, полученная OD показывает присутствие (высокая OD) или отсутствие (низкая OD) антител в тестируемой пробе сыворотки мыши. Имеется ряд вариантов этого теста (иммобилизация антигена, конкурентный анализ…), которые хорошо известны квалифицированному в данной области специалисту.

1) Иммобилизация антигена на микропланшете

Каждый антиген, BNP(1-32) или proBNP(1-108), солюбилизировали в ЗФР в конечной концентрации 0,5 мкг/мл и затем иммобилизовали на основе 100 мкл на лунку, на микропланшете Maxisorp инкубированием в течение ночи при 4°С. После 3 промывок ЗФР-0,1% Твин® 20 (ЗФР-Т) микропланшет насыщали раствором (100 мкл на лунку) 0,1% ЗФР-Т, содержащим 1% молоко (полуобезжиренное), и затем оставляли инкубироваться при 37°С в течение 1 часа.

2) Иммунологическое детектирование антител, продуцируемых мышами

Этот микропланшет промывали три раза 0,1% ЗФР-Т. Каждую сыворотку из ранее иммунизированных мышей разбавляли затем в десять раз 0,1% ЗФР-Т, содержащим 0,1% молоко (полуобезжиренное), затем помещали на основе 100 мкл на лунку и оставляли инкубироваться в течение двух часов при 37°С. Этот микропланшет опять промывали три раза 0,1% ЗФР-Т, затем оставляли инкубироваться в течение 1 часа при 37°С в присутствии конъюгата, связанного с пероксидазой, разбавленного до 1/3000 в 0,1% ЗФР-Т, содержащем 0,1% молоко (полуобезжиренное), на основе 100 мкл на лунку. Наконец, этот микропланшет промывали три раза 0,1% ЗФР-Т, затем субстрат пероксидазы вносили на основе 100 мкл на лунку. Этот микропланшет помещали в темноту при комнатной температуре на 20 минут. Ферментную реакцию останавливали добавлением 50 мкл серной кислоты (H2SO4, 4 н.) на лунку и затем в каждой лунке измеряли OD при 400 нм.

С использованием этого способа для детектирования антител авторы этого изобретения обнаружили, что сыворотка из мыши S2 (иммунизированной пептидом SEQ ID NO: 4) была очень реактивной с BNP(1-32) и proBNP(l-108). После слияния лимфоцитов, которое проводили затем между лимфоцитами из указанной гипериммунной мыши и миеломы Sp2, этот способ позволял также идентифицировать гибридому, которая продуцирует важное моноклональное антитело: гибридому 20G7, продуцирующую моноклональное антитело 20G7.

Пример 5. Эпитопная характеристика моноклонального антитела 20G7 5.1. Эпитопная характеристика в соответствии со способом «Spot»

5.1.1. Материалы

Все оборудование и реагенты перечислены в С.Granier, S.Villard, D.Laune (Mapping and Characterization of Epitopes using the SPOT method. Cells/Cell Biology: A Laboratory Handbook, third edition (Volume 1), chapter 62, editor: Julio CeNs, Elsevier, 2005).

5.1.2. Способ

Способ "SPOT" или "картирование эпитопов" использовали для характеристики эпитопа моноклонального антитела 20G7. Этот способ, описанный Frank (Tetrahedron, 1992; 48: 9217-32), делает возможным синтез на целлюлозной мембране большого количества пептидов с заранее заданными последовательностями на функционализированном носителе (аминополиэтиленгликоль-целлюлоза) и тестирование их реактивности в отношении растворимого лиганда, который в данном случае является антителом 20G7.

5.1.2.1. Синтез пептидов

Полный процесс синтеза пептидов (активация аминокислот, химическая реакция и т.д.) подробно описан в Molina et al. (Pept Res. 1996, Vol.9: p.151-5) и в С.Granier, S.Villard, D.Laune (Mapping and Characterization of Epitopes using the SPOT method. Cells/Cell Biology: A Laboratory Handbook, third Edition (Volume 1), chapter 62, Editor: Julio Celis, Elsevier, 2005).

Последовательность BNP(1-32) синтезировали полностью в форме перекрывающихся пентадекапептидов (SEQ ID NO: 12-20) со смещением на 2 аминокислоты:

SEQ ID NO: 12 SPKMVQGSGCFGRKM

SEQ ID NO: 13 KMVQGSGCFGRKMDR

SEQ ID NO: 14 VQGSGCFGRKMDRIS

SEQ ID NO: 15 GSGCFGRKMDRISSS

SEQ ID NO: 16 GCFGRKMDRISSSSG

SEQ ID NO: 17 FGRKMDRISSSSGLG

SEQ ID NO: 18 RKMDRISSSSGLGCK

SEQ ID NO: 19 MDRISSSSGLGCKVL

SEQ ID NO: 20 RISSSSGLGCKVLRR

Синтезировали также следующие другие пептиды:

SEQ ID NO: 21 VQGSGCFGR

SEQ ID NO: 22 SPKMVQGSGC

SEQ ID NO: 23 MDRISSSSGLG

SEQ ID NO: 24 RKMDRI

SEQ ID NO: 25 RKMDRISS

Эту последовательность BNP(1-32) синтезировали также в форме перекрывающихся декапептидов (SEQ ID NO: 26-48) со смещением на 1 аминокислоту:

SEQ ID NO: 26 SPKMVQGSGC

SEQ ID NO: 27 PKMVQGSGCF

SEQ ID NO: 28 KMVQGSGCFG

SEQ ID NO: 29 MVQGSGCFGR

SEQ ID NO: 30 VQGSGCFGRK

SEQ ID NO: 31 QGSGCFGRKM

SEQ ID NO: 32 GSGCFGRKMD

SEQ ID NO: 33 SGCFGRKMDR

SEQ ID NO: 34 GCFGRKMDRI

SEQ ID NO: 35 CFGRKMDRIS

SEQ ID NO: 36 FGRKMDRISS

SEQ ID NO: 37 GRKMDRISSS

SEQ ID NO: 38 RKMDRISSSS

SEQ ID NO: 39 KMDRISSSSG

SEQ ID NO: 40 MDRISSSSGL

SEQ ID NO: 41 DRISSSSGLG

SEQ ID NO: 42 RISSSSGLGC

SEQ ID NO: 43 ISSSSGLGCK

SEQ ID NO: 44 SSSSGLGCKV

SEQ ID NO: 45 SSSGLGCKVL

SEQ ID NO: 46 SSGLGCKVLR

SEQ ID NO: 47 SGLGCKVLRR

SEQ ID NO: 48 GLGCKVLRRH

Синтезировали также выбранные гептапептиды со смещением на одну аминокислоту (SEQ ID NO: 49-53):

SEQ ID NO: 49 GCFGRKM

SEQ ID NO: 50 CFGRKMD

SEQ ID NO: 51 FGRKMDR

SEQ ID NO: 52 GRKMDRI

SEQ ID NO: 53. RKMDRIS

5.1.2.2 Иммунологический тест

Следующий тест на иммунореактивность был описан подробно в Laune et al. (J. Immunol. Methods, 2002, Vol.267(1), p.53-70). Вкратце, этот принцип был следующим. Мембрану повторно гидратировали тремя TBS-банями (забуференный трисом солевой ТВ, pH 7,0) с продолжительностью 10 мин в каждом случае и затем насыщали инкубированием в течение ночи при комнатной температуре при перемешивании в присутствии 15 мл 10% насыщающего буфера ("блокирующего буфера", Roche) и 5% сахарозы в TBS-0,1% Твин® 20 (TBS-T). После промывания этой мембраны три раза в течение 0,1% TBS-T мембрану оставляли инкубироваться в течение 90 минут при 37°С при перемешивании в присутствии тестируемого антитела (в этом случае 20G7) и этот конъюгат, связанный со щелочной фосфатазой, разбавляли насыщающим буфером. После промывки этой мембраны два раза 0,1% TBS-T, затем два раза CBS (забуференным цитратом солевым раствором), причем каждая баня длилась 10 минут, добавляли субстрат щелочной фосфатазы и эту мембрану инкубировали при комнатной температуре в течение 1-30 минут в зависимости от скорости, при которой появляется сигнал.

5.1.2.3. Результаты

В данном случае последовательность BNP(1-32) синтезировали полностью в форме перекрывающихся пентадекапептидов (SEQ ID NO: 12-20) со смещением на две аминокислоты. Как показано на фиг.1, при контактировании этих пептидов с очищенным антителом 20G7 только пять последовательных пептидов реагируют с этим антителом и их общей последовательностью является последовательность F11GRKMDR17 (фиг.1):

SEQ ID N0: 13 KMVQGSGCFGRKMDR

SEQ ID NO: 14 VQGSGCFGRKMDRIS

SEQ ID NO: 15 GSGCFGRKMDRISSS

SEQ ID NO: 16 GCFGRKMDRISSSSG

SEQ ID NO: 17 FGRKMDRISSSSGLG

Для гарантии того, что только этот мотив действительно участвует в связывании этого антитела с BNP(1-32), синтезировали также более короткие пептиды (декапептиды (SEQ ID NO: 26-48) и гептапептиды (SEQ ID NO: 49-53) со смещением только на одну аминокислоту для подтверждения и валидизации этого эпитопа. В каждом эксперименте общей пептидной последовательностью, идентифицированной при помощи 20G7, была последовательность FnGRKMDRp (для декапептидов SEQ ID NO: 33-36 и для гептапептидов SEQ ID NO: 51).

Для определения, какие остатки являются критическими и незаменимыми для узнавания этого эпитопа, каждый остаток этой минимальной последовательности F11GRKMDR17 заменяли последовательно аланином (А) для оценивания участия каждого индивидуального остатка в соответствии со способом "аланинового сканирования", который хорошо известен и описан (Laune et al., выше). Как показано на фиг.2, связывание уменьшалось до 82, 95 и 85%, когда остатки F11, K14 и R17 соответственно заменяли аланином, что указывает на то, что эти остатки являются незаменимыми.

Аминокислоты в положениях 11, 14 и 17 являются незаменимыми для узнавания эпитопа моноклональным антителом 20G7. Эти данные являются средними величинами множества (n=4) повторяемых экспериментов. Таким образом, по этой причине ясно, что эпитоп FnGRKMDRi7, содержащий незаменимые аминокислоты F11, K14 и R17, в соответствии с данным изобретением отличается от эпитопа, узнаваемого в заявке на патент WO 2006/88700, которая описывает другой эпитоп (R13(K14)(M15)D16R17I18), важными аминокислотами для которого являются R13, D156, R17 и I18.

Для достижения лучшего понимания способствующего действия этих остатков в отношении процесса связывания антитела 20G7 эти аминокислоты F11, K14 и R17 заменяли аминокислотами с близкими биохимическими свойствами. Например, F11 заменяли другими ароматическими аминокислотами (триптофаном и тирозином). Тот факт, что последовательность, составленная из этих "гомологичных" аминокислот, узнавалась антителом 20G7, предполагает, что именно ароматический характер этого пептида в положении 11 является существенным для связывания антитела. Что касается K14 и R17, они оба были заменены аргинином и лизином для исследования действия боковой цепи этой аминокислоты, а также присутствия положительного заряда. В этом случае было также обнаружено, что эта замена была эффективно консервативной, так как сохранялось связывание с 20G7, что свидетельствовало о важности положительного заряда.

То же самое неприменимо к антителу 24С5 из HyTest, которое имеет другие незаменимые остатки.

Пептидные последовательности VQGSGCFGR, SPKMVQGSGC, MDRISSSSGLG, R13KMDRI18 и R13KMDRISS20 (SEQ ID NO: 21 - SEQ NO: 25) BNPQ-32) человека, которые также синтезировали на мембране, тестировали с антителом 20G7 с использованием способа Spot. Поскольку остатки, которые являются незаменимыми для связывания с 20G7, отсутствовали, указанное антитело вообще не связывалось с указанными пептидами, что приводило к такому результату, что 20G7 проявляло перекрестную реакцию, меньшую, чем 2%, с этими пептидами.

5.2. Характеристика с использованием растворимых пептидов во второй стадии для гарантии, что пептид F11GRKMDR17 был действительно эпитопом антитела 20G7, эту последовательность синтезировали в растворимой форме для проведения конкурентных анализов между этим пептидом и BNP(1-32). Параллельно для подтверждения высокого вклада остатка F11 в связывание с антителом 20G7 два других дополнительных пептида (один, в котором F был просто делегирован) также синтезировали в растворимой форме. Кроме того, такие же конкурентные анализы проводили с антителом 24С5 от Hytest для демонстрации, что важность этого остатка является специфической для антитела 20G7.

1 - SEQ ID NO 51: последовательность природного эпитопа: F11GRKMDR17

2 - SEQ ID NO 62: мутированная последовательность этого эпитопа: A11GRKMDR17

3 - SEQ ID NO 9: последовательность с делегированным остатком F11:G12RKMDR17

5.2.1 Материалы

- 96-луночный плоскодонный микропланшет Maxisorp (Nunc, Denmark)

- буфер ЗФР (забуференный фосфатом солевой раствор), рН 7,4, таблетки Gibco, кат. номер: 18912-014 (Invitrogen)

- BNP(1-32): синтетический пептид (Sigma-Aldrich, USA, #B-5900)

- Tween® 20 (Sigma-Aldrich, USA, #P1379)

- моноклональное антитело 20G7 (Bio-Rad)

- моноклональное антитело 24С5 (Ну Test, Turku, Finland)

- вторичное антитело против мышиного IgG, продуцируемое в кролике и связанное с пероксидазой (Sigma, USA, #A9044)

- H2O2 (0,04% в 0,1 М цитратном буфере, pH 4)

- OPD (ортофенилендиамин, Sigma, USA, #P8412)

- серная кислота (H2SO4, 4N)

5.2.2. Способы

Принцип этого иммуноанализа был тем же самым, что и принцип, описанный в 4.2. Вкратце, синтетический BNP(1-32) разбавляли в буфере ЗФР для прямой иммобилизации на микропланшете Maxisorp при 0,5 мкг/мл. Диапазон стандартов от 20 до 10000 нг/мл каждого растворимого пептида АА11-АА17 (нативного, мутированного или делегированного) готовили в буфере/сыворотке и смешивали с 100 мкл раствора моноклонального антитела (антитела 20G7 или 24С5, в конечной концентрации 0,5 мкг/мл в ЗФР-0,1% Твин® 20 (ЗФР-Т), содержащем 0,1% молоко (полуобезжиренное). Затем связывание этого антитела детектировали при помощи антимышиного конъюгата, меченого пероксидазой. Интенсивность реакции антитела 20G7 сравнивали с интенсивностью реакции моноклонального антитела от HyTest. Процент ингибирования, соответствующий уменьшению узнавания BNP(1-32) в присутствии растворимого пептида, определяли для каждого растворимого пептида для определения, 1) что последовательность F11GRKMDR17 эффективно представляет эпитоп антитела 20G7 и 2) что остаток F11 был незаменимым для узнавания BNP(1-32) антителом 20G7.

5.2.3. Результаты

Фигура 3 изображает процент ингибирования связывания моноклонального антитела (20G7 или 24С5) с BNP(1-32) в присутствии увеличивающихся концентраций растворимых пептидов (нативного: SEQ ID NO: 51, мутированного: SEQ ID NO: 62, делетированного: SEQ ID NO: 9).

В высшей степени удивительно отметить, что антитело 20G7 данного изобретения ведет себя иным образом, чем антитело 24С5, в узнавании BNP(1-32) в присутствии растворимого пептида АА11-АА17, мутированного (SEQ NO: 62) или делетированного (SEQ NO: 9). Добавление растворимого пептида, мутированного (A11GRKMDR17) или делетированного (G12RKMDR17), не ингибирует узнавание BNP(1-32) антителом 20G7, какой бы ни была концентрация добавленного пептида (до 20 мкг/мл), тогда как наблюдается общее ингибирование при добавлении нативного пептида (F11GRKMDR17, соответствующего последовательности SEQ ID NO: 51). Этот эксперимент подтверждает важность остатка Гц в связывании антитела 20G7 с BNP(1-32) в противоположность антителу 24С5.

Пример 6. Характеристика эпитопов других моноклональных анти-BNP(1-32)-антител. Сравнение с антителом 20G7

6.1. Материалы, способы и протоколы

Для исследования этих антител использовали те же самые нитроцеллюлозные мембраны и те же самые условия, что и мембраны и условия, описанные в примере 5.

6.2. Результаты

Таким образом, авторы изобретения получали ряд следующих охарактеризованных моноклональных антител: 20G7, 11А8, 17F10, Mab1, Mab2 и Mab3. Как показано в таблице 1, другие моноклональные антитела имеют тот же самый эпитоп, что и моноклональное антитело 20G7 данного изобретения, т.е. FGRKMDR, но разные незаменимые аминокислоты в сравнении с 20G7.

Таблица 1
Характеристики этих моноклинальных антител
Моноклональное антитело Иммуноген Эпитоп Незаменимые остатки
20G7 SEQ ID NO: 4 F11GRKMDR17 F, K и R
11А8 SEQ ID NO: 4 F11GRKMDR17 F, G, K и R
17F10 SEQ ID NO: 4 F11GRKMDR17 K, D и R
Mab1 SEQ ID NO: 4 F11GRKMDR17 G ,R и K
Mab2 SEQ ID NO: 4 F11GRKMDR17 F и K
Mab3 SEQ ID NO: 4 F11GRKMDR17 G, R и K

Фигура 4 показывает, например, результат анализа способом «аланинового сканирования» (последовательной замены каждого остатка последовательности F11GRKMDR17 аланином для оценивания индивидуального участия каждого остатка, по способу, описанному выше в 5.1.2.3) для антитела 11А8. Замена этих четырех остатков (F, G, K и R) приводит к значимой потере связывания последовательности F11GRKMDR17, демонстрируя, что они являются незаменимыми для связывания с BNP(1-32).

Пример 7. Характеристика взаимодействия антитело-антиген моноклональных антител при помощи технологии поверхностного плазменного резонанса

7.1. Материалы

- Анализатор BIAcore® 2000 & 3000 (Pharmacia, Uppsala, Sweden)

- BNP(1-32) (синтетический пептид, Sigma, USA, #B-5900)

- proBNP(1-108) (рекомбинантный белок, продуцируемый в Е. coli, HyTest, Finland)

- анти-Fc-фрагмент-антитела (Sigma, USA)

- моноклональные антитела 20G7, 11А8, 17F10 (Bio-Rad, Mames la Coquette, France)

- Буфер ЗФР (забуференный фосфатом солевой раствор), pH 7,4

7.2. Способ

7.2.1. Принцип

Анализатор BIAcore® 2000 & 3000 (принцип которого основан на технологии поверхностного плазменного резонанса (SPR)), использовали для определения кинетики и аффинности взаимодействия моноклонального антитела 20G7 и других моноклональных антител с BNP(1-32) или proBNP(1-108). Авторы этого изобретения использовали инструкции изготовителя.

Способ поверхностного плазмонного резонанса SPR (BIAcore®, Pharmacia) был описан в полном виде в Ferrieres et al. (2000, FEBS Letters, 479(3): 99-105). Моноклональное антитело иммобилизовали на биосенсоре или твердой поверхности с использованием анти-Рс-фрагмент-антитела, тогда как растворимый антиген (BNP(1-32) или proBNP(1-108)) циркулировал при увеличивающихся концентрациях (0,001256-0,125 мкг/мл) в постоянном потоке на поверхности этого биосенсора при комнатной температуре. Угол, при котором детектируется сигнал SPR, является прямо пропорциональным показателю преломления среды, в которой распространяется затухающая волна. Вариации в показателе преломления выражаются в резонансных единицах (RU, где 1000 резонансных единиц соответствуют 1 нг фиксированных белков на мм2 активной зоны). Количественную характеристику взаимодействия и аффинности между антигеном и моноклональным антителом оценивают расчетом константы скорости ассоциации (ka) и константы скорости диссоциации (kd) при помощи глобальной обработки данных с использованием программы изготовителя BIAevaluation (BIAcore®, Pharmacia, Uppsala, Sweden). Равновесная константа диссоциации (KD=kd/ka) в моль/л отражает аффинность антигена BNP(1-32) или proBNP(1-108) в отношении конкретного моноклонального антитела.

7.2.2. Результаты

Таблица 2 показывает характеристики взаимодействия между моноклональными анти-ВМР-антителами (в том числе 20G7) и двумя рекомбинантными антигенами BNP(1-32)иргоВКР(1-108).

Таблица 2
Взаимодействия между различными моноклональными анти-BNP-антителами и антигенами BNP(1-32) и proBNP(1-108).
BNP ka (M-1 с-1) kd (с-1) KA (M-1) KD (M)
20G7 1,40·106 2,38·10-4 5,90·109 1,70·10-10
11А8 8,58·105 2,23·10-3 3.85·108 2,59·10-9
17F10 5,84·105 2,82·10-4 2,07·109 4,83·10-10
ProBNP ka (М-1 с-1) kd (с-1) KA (М-1) KD(M)
20G7 1,02·106 1,74·10-4 5,90·109 1,69·10-10
11А8 7,63·105 1,19·10-3 6,43·108 1,56·10-9
17F10 9,34·105 2,15·10-4 4,35·109 2,30·10-10

Таблица 2 суммирует разные характеристики (величины константы скорости ассоциации (ka) и константы скорости диссоциации (kd), позволяющие рассчитать равновесную константу диссоциации (KD в M) взаимодействия между BNP(1-32) или proBNP(1-108) и моноклональными антителами. Эти результаты в отношении взаимодействия подтверждают данные, полученные анализами BNP(1-32) и proBNP(1-108), поскольку моноклональное антитело 20G7 проявляет отличную константу ассоциации (ka) и низкую константу диссоциации (kd), что позволяет ему иметь отличную константу аффинности 1,70-10 M, идентичную для BNP(1-32) и proBNP(1-108) (таблица 2).

Обеспечены также примеры для других моноклональных антител (11А8 и 17F10), константы аффинности которых находятся в наномолярном диапазоне (2×10-10-9,35×10-10 М, таблица 2).

Пример 8. Анализ BNP(1-32) с использованием моноклонального антитела 20G7

8.1. Материалы

- 96-луночный плоскодонный микропланшет Maxisorp (Nunc, Denmark)

- буфер ЗФР (забуференный фосфатом солевой раствор), pH 7,4, таблетки Gibco, кат. номер: 18912-014 (Invitrogen)

- BNP(1-32): синтетический пептид (Sigma-Aldrich, USA, #B-5900) или

- proBNP(l-108) (рекомбинантный белок, производимый в Е.coli, HyTest, Finland)

- Tween® 20 (Sigma-Aldrich, USA, #P1379)

- поликлональное антитело кролика L21016, полученное иммунизацией кроликов иммуногеном, нацеливающим на район 1-10 BNP(1-32), причем его эпитопом является последовательность SiPKMV5 (SEQ ID NO: 54) BNP(1-32)

- моноклональное антитело 20G7 (Bio-Rad)

- моноклональные антитела 24С5 и 26Е2 (HyTest, Turku, Finland)

- конъюгат антитела против мышиного IgG, продуцируемый в кролике и связанный с пероксидазой (Sigma, USA, #А9044)

- 0,04% H2O2 в 0,1 М нитратном буфере, pH 4

- OPD (ортофенилендиамин, Sigma, USA, #P8412)

- серная кислота (H2SO4, 4 н.)

8.2. Способ и принцип

Сначала готовили диапазон стандартов 20-10000 пг/мл BNP(1-32) в буфере/сыворотке из синтетического BNP(1-32).

Этот анализ основывался на принципе сэндвич-ELISA на микропланшете с использованием кроличьего поликлонального антитела (Bio-Rad) для иммобилизации на твердой фазе, причем его эпитопом является последовательность S1PKMV5 BNP(1-32), фиксированного пассивной адсорбцией с использованием 100 мкл раствора 5 мкг/мл на лунку.

100 мкл раствора моноклонального антитела (антител 20G7, 24С5 или 26Е2) в растворе при концентрации 0,5 мкг/мл в буфере ЗФР-0,1% Твин® 20 (ЗФР-Т), содержащем 0,1% молоко (полуобезжиренное), использовали в качестве детектирующих реагентов. Таким образом, интенсивность реакции 20G7 сравнивали с интенсивностью реакции моноклональных антител 24С5 и 26Е2.

Таблица 3 суммирует результаты этого аналитического анализа BNP(1-32), выраженные в виде оптической плотности (OD) при 490 нм и полученные с указанными антителами в присутствии концентраций стандартов BNP(1-32).

Таблица 3
Величины OD, полученные во время аналитического анализа BNP(1-32) с различными антителами
BNP(1-32) (пг/мл) 20G7 24C5 26E2
10000 3,752 0,077 0,048
5000 3,056 0,068 0,041
2500 1,950 0,067 0,035
1250 1,111 0,056 0,031
625 0,625 0,059 0,029
312,5 0,404 0,063 0,027
156,25 0,180 0,071 0,032
78 0,099 0,052 0,055
39 0,066 0,055 0,032
20 0,031 0,068 0,034
0 0,024 0,071 0,022

В высшей степени удивительно отметить, что эти два антитела 24C5 и 26E2 ведут себя совершенно по-другому, чем антитело 20G7 данного изобретения. Таким образом, эти результаты подтверждают, что в формате последнего анализа 20G7 является гораздо более стабильным, чем антитела 24C5 и 26E2, в отношении анализа BNP(1-32).

Диапазон стандартов, показанный на фиг.5 и полученный с моноклональным антителом 20G7, является линейным от 20 до 10000 пг/мл (r2=0,96). Два коммерческих антитела 24C5 и 26E2 являются не очень эффективными или вообще не являются эффективными в детектировании BNP(1-32), даже при высоких концентрациях аналита (таблица 3).

Пример 9. Исследование комплементарности моноклональных антител в сэндвич-ELISA

9.1. Материалы

- 96-луночный плоскодонный микропланшет Maxisorp (Nunc, Denmark), праймированный кроличьим поликлональным антителом L21016 (Bio-Rad), которое узнает последовательность S1PKMV5 (SEQ ID NO: 54) BNP(1-32)

- буфер ЗФР (забуференный фосфатом солевой раствор), pH 7,4, таблетки Gibco, кат. номер: 18912-014 (Invitrogen)

- Tween® 20 (Sigma-Aldrich, USA, #P1379)

- синтетический пептид BNP(1-32) (Sigma-Aldrich, USA, #B-5900)

- proBNP(1-108) (рекомбинантный белок, продуцируемый в Е.coli, HyTest, Finland)

- антитело 20G7 (направленное против эпитопа F11GRKMDR17 (SEQ ID NO: 8), приготовленное в различных концентрациях от 0,001 до 1 мкг/мл

- моноклональное антитело 50 В7 (HyTest, Finland), которое узнает C-концевую часть BNP(1-32), в единственной концентрации 0,5 мкг/мл

- вторичное антитело против мышиного IgG, продуцируемое в кролике и связанное с пероксидазой (Sigma, USA, #A9044)

- 0,04% H2O2 (в 0,1 М цитратном буфере, рН 4, Sigma, USA)

- OPD (ортофенилендиамин, Sigma, USA, #P8412)

- серная кислота (H2SO4, 4 н.) 9.2.

Способ

9.2.1. Принцип

Этот анализ основывался на принципе сэндвич-ELISA на микропланшете с использованием кроличьего поликлонального антитела L21016 (Bio-Rad) для иммобилизации на твердой фазе, причем его эпитопом является последовательность S1PKMV5 (SEQ ID NO: 54) BNP(1-32), фиксированного пассивной адсорбцией (см. пример 8), и комбинации двух моноклональных антител (моноклонального антитела 20G7, направленного против эпитопа F11GRKMDR17 (SEQ ID NO: 8), и моноклонального антитела 50 В7 (HyTest, Finland), которое нацелено на C-концевую часть BNP(1-32)), для детектирования. Однако антитело 20G7 использовали при варьируемых концентрациях, тогда как моноклональное антитело 50 В7 использовали при постоянной концентрации 0,5 мкг/мл.

Комплементарность эпитопов антител 20G7 и 50 В7 исследовали при вариабельных концентрациях антитела 20G7. Этот формат позволял оценивать кооперативность этих двух моноклональных антител для улучшения детектирования BNP(1-32).

9.2.2. Протокол

100 мкл раствора 5 нг/мл BNP(1-32) добавляли в каждую лунку микропланшета, в котором адсорбировали поликлональное антитело L21016, и оставляли инкубироваться в течение двух часов при 37°С. Этот микропланшет промывали три раза 0,1% ЗФР-Т, затем распределяли на нем 100 мкл смеси, содержащей антитело 50 В7 и одно из разведений антитела 20G7, и этот микропланшет оставляли инкубироваться в течение 2 часов при 37°С. После трех промывок 0,1% ЗФР-Т конъюгат пероксидаза - кроличье антитело против мышиного IgG, разведенный до 1/3000 0,1% ЗФР-Т и содержащий 0,1% молоко (полуобезжиренное) на основе 100 мкл на лунку, оставляли инкубироваться в течение 1 часа при 37°С. Наконец, после 3 промывок 0,1% ЗФР-Т раствор H2O2+OPD помещали на основе 1000 мкл на лунку. Этот микропланшет помещали в темноту при комнатной температуре на 20 минут. Ферментативную реакцию останавливали добавлением 50 мкл серной кислоты (H2SO4, 4 н.) на лунку и затем измеряли OD при 490 нм в каждой лунке.

9.2.3. Результаты

Таблица 4 показывает результаты аналитического анализа BNP с использованием моноклональных антител 20G7 и 50 В7, выраженные в виде оптической плотности при 490 нм.

Таблица 4
Кооперативность двух моноклональных антител для детектирования BNP(1-32)
Диапазон 20G7(мкг/мл) Оптическая плотность 490 нм
0,5 3,792
0,1 3,753
0,05 3,747
0,01 3,531
0,005 3,272
0,001 1,948
0 1,296

Было замечено, что имеется синергизм между этими двумя антителами. Другими словами, было замечено, что эффекты этих двух антител складывались в отсутствие 20G7, сигнал (OD) был ограничен 1,296, и чем больше добавляли 20G7, тем больше увеличивался полученный сигнал (OD).

С использованием как моноклонального антитела 20G7, которое нацелено на эпитоп FiiGRKMDRn (SEQ ID NO: 8) согласно этому изобретению (расположенный в петле BNP(1-32)), так и моноклонального антитела 50В7, которое нацелено на С-концевой район BNP(1-32), детектирование BNP(1-32) значительно улучшается. Это свидетельствует о кумулятивном или кооперативном вкладе этих двух моноклональных антител, используемых в детектировании.

Этот тип комплементарности может также ожидаться между моноклональным антителом 20G7 и другими антителами, которые узнают эпитоп, расположенный в других положениях последовательности BNP(1-32) (главным образом в N-концевом положении, C-концевом положении). Количество антител может быть также большим, чем 2, пока не возникают проблемы стерического несоответствия.

Пример 10. Анализ proBNP(1-108) с использованием моноклонального антитела 20G7

10.1. Материалы

- синтетический пептид BNP(1-32) (Sigma-Aldrich, USA, #B-5900)

- proBNP(1-108) (рекомбинантный белок, продуцируемый в E.coli, Ну Test, Finland)

- 96-луночный плоскодонный микропланшет Maxisorp (Nunc, Denmark), праймированный моноклональными антителами (антителом hinge 76, например, из Bio-Rad, который узнает шарнирную последовательность proBNP(1-108): эпитоп RAPR76S77P (SEQ ID NO: 55) (Giuliani et al., Clin. Chem., 52:6, 1054-1061, 2006)

- моноклональное антитело 20G7 (Bio-Rad), связанное с пероксидазой

- моноклональное антитело 24С5 (HyTest, Finland), связанное с пероксидазой

- моноклональное антитело 26Е2 (HyTest, Finland), связанное с пероксидазой

- буфер ЗФР (забуференный фосфатом солевой раствор), pH 7,4, таблетки Gibco, кат.номер: 18912-014 (Invitrogen)

- Твин® 20 (Sigma-Aldrich, USA, #P1379)

10.2. Способ

10.2.1. Принцип аналитического анализа proBNP(1-108)

Этот анализ основывался на принципе сэндвич-ELISA на микропланшете с использованием для иммобилизации на твердой фазе моноклонального антитела (антитела hinge 76, например, из Bio-Rad), узнающего шарнирную последовательность proBNP(1-108): эпитоп RARJR.76S77P (SEQ ID NO: 55), фиксированного пассивной адсорбцией с использованием 100 мкл раствора 0,5 мкг/мл на лунку.

100 мкл раствора моноклонального антитела (антител 20G7, 24С5 или 26Е2) в растворе при концентрации 0,5 мкг/мл в буфере 0,1% ЗФР-Твин® 20 (ЗФР-Т), содержащем 0,1% молоко (полуобезжиренное), использовали в качестве детектирующих реагентов. Кроме этого технического момента, этот протокол был идентичен протоколу ELISA в примере 8. Таким образом, характеристики детектирования 20G7 сравнивали с характеристиками детектирования моноклональных антител 24С5 и 26Е2.

Таблица 5 суммирует результаты этого аналитического анализа proBNP(1-108), которые выражены в виде оптической плотности (OD) при 490 нм и были получены с использованием указанных антител в присутствии концентраций стандартов proBNP(1-108).

10.3. Результаты

Таблица 5
Аналитический анализ proBNP(1-108) с различными антителами
proBNP(1-108) (пг/мл) 20G7 24С5 26Е2
10000 >4 0,220 0,158
5000 3,845 0,117 0,041
2500 3,272 0,069 0,031
1250 1,955 0,068 0,024
625 0,625 0,059 0,029
312,5 0,997 0,070 0,024
156,25 0,264 0,055 0,027
78 0,126 0,056 0,033
39 0,092 0,056 0,028
20 0,069 0,052 0,028
0 0,045 0,044 0,024

В высшей степени удивительно отметить, что антитело 20G7 данного изобретения детектирует не только BNP(1-32), но также proBNP(1-108). Кроме того, в этом случае также два антитела HyTest ведут себя совершенно по-другому, чем антитело 20G7. Это подтверждает значительное преимущество антитела 20G7 в анализах BNP(1-32) и proBNP(1-108).

Фигура 6 иллюстрирует линейный диапазон стандартов, полученный с использованием моноклонального антитела 20G7, 20-10000 пг/мл proBNP (r2=0,99, фиг.6), тогда как эти два коммерческих антитела от Hytest являются не очень эффективными или вообще неэффективными в детектировании proBNP(1-108), даже при высоких концентрациях proBNP(1-108) (таблица 5).

Пример 11. Анализы proBNP(l-108) и BNP(1-32) с использованием других моноклональных антител, полученных авторами этого изобретения

Таблица 6 показывает результаты, полученные в соответствии с двумя протоколами ELISA из примеров 8 и 10 с моноклональными антителами 11А8 и 17F10.

Эти меченые моноклональные антитела, используемые в детектировании, являются в высокой степени способными детектировать BNP(1-32) и proBNP(1-108) при использовании для иммобилизации кроличьего поликлонального антитела (L21016), которое направлено на район 1SPKMV5, или антитела hinge 76 соответственно.

Таблица 6 показывает результаты аналитических анализов proBNP(l-108) и BNP(1-32), которые выражены в виде оптической плотности и были получены с указанными антителами в присутствии стандартных концентраций proBNP(1-108) и BNP(1-32) соответственно.

Таблица 6
Аналитический анализ proBNP(1-108) и BNP(1-32) с различными моноклональными антителами
proBNP(1-108) BNP(1-32)
В№(1-32) или proBNP(l-108) (пг/мл) 17F10 11А8 17F10 11А8
10000 3,769 3,734 3,717 3,693
5000 3,808 3,779 2,712 2,534
2500 3,453 3,024 1,495 1,481
1250 2,118 1,406 0,828 0,871
625 0,937 0,618 0,341 0,389
3125 0,489 0,259 0,172 0,211
156 0,242 0,130 0,095 0,123
78 0,139 0,088 0,070 0,114
39 0,125 0,087 0,059 0,097
20 0,100 0,078 0.059 0,071
0 0,076 0,063 0,059 0,068

В высокой степени удивительно отметить, что антитела 17F10 и 11А8 данного изобретения детектируют не только BNP(1-32), но также и proBNP(1-108).

Пример 12. Анализ BNP(1-32) и анализ proBNP(1-108) в субъектах с застойной сердечной недостаточностью и в здоровых субъектах

12.1. Пробы

- 55 образцов плазмы с ЭДТА из субъектов с застойной сердечной недостаточностью, которые принадлежали к одному из классов I-III NYHA (New York Heart Association) и подписали форму добровольного согласия, происходили из одного коммерческого источника (ProMedex, NY, USA). Исследованная популяция является следующей: 10 пациентов класса I NYHA, 21 пациент класса II NYHA и 24 пациента класса III NYHA.

- 48 образцов плазмы с ЭДТА из здоровых субъектов (здоровые волонтеры, ProMedex, NY. USA).

12.2. Материалы и способы для анализов BNP(1-32) и proBNP(1-108)

Используемые материалы и способы были идентичны материалам и способам, описанным выше в 8.2 для BNP(1-32), и способам, описанным выше в 10.2 для proBNP(1-108).

12.3. Результаты

12.3.1. Результаты анализов BNP(1-32) и proBNP(1-108) в пациентах с застойной сердечной недостаточностью

Было обнаружено, что величины BNP(1-32), полученные из плазм из пациентов с застойной сердечной недостаточностью, при помощи анализа BNP(1-32), описанного в 8.2, коррелируют с величинами анализа proBNP(1-108) в соответствии с этим изобретением (r2=0,935, фигура 7).

Более подробно, корреляции сохраняются, когда исследуют пациентов в соответствии с их классом NYHA (r2=0,997, r2=0,903, r2=0,832 соответственно для классов NYHA I, II и III, фигура 8 А, В и С соответственно).

Таким образом, эти результаты с антителом 20G7 antibody еще раз подтверждают применимость анализа BNP(1-32) или proBNP(1-108) в качестве маркера застойной сердечной недостаточности.

Эти эксперименты воспроизводили с антителами 24С5 и 26Е2 (HyTest) в меченой форме, но не наблюдали корреляции.

12.3.2. Результаты анализов BNP(1-32) и proBNP(1-108) в здоровых субъектах

Было обнаружено, что величины proBNP(l-108), полученные из плазм здоровых субъектов при помощи анализа proBNP(1-108) с использованием моноклонального антитела hinge 76 в твердой фазе и конъюгата антитело 2007-пероксидаза для детектирования, имели высокую корреляцию r2=0,702 с величинами анализа BNP(1-32) с использованием антитела 20G7 в детектировании (фигура 9).

Таким образом можно сделать вывод, что антитело 20G7 данного изобретения является вполне подходящим для анализов BNP(1-32) и proBNP(1-108) в пациентах, страдающих от застойной сердечной недостаточности, посредством детектирования более высокого количества BNP(1-32) и proBNP(1-108) в пациентах, страдающих от застойной сердечной недостаточности, чем в здоровых субъектах (таблица 7).

Таблица 7
proBNP(1-108) (пг/мл) BNP(1-32) (пг/мл)
Здоровые субъекты 37±32 227±172
Пациенты NYHA 762±839 1716±1754

Пример 13. Анализы BNP(1-32) и proBNP(l-108) в пациентах, страдающих от почечной недостаточности

13.1. Пробы

Образцы плазмы с ЭДТА из 33 пациентов с почечной недостаточностью, которые подписали форму добровольного согласия, происходили из Lapeyronie hospital, Montpellier, France.

13.2. Материалы и способы для анализов BNP(1-32) и proBNP(1-108) Эти материалы и способы были идентичны материалам и способам, описанным выше в 8.2 для BNP(1-32) и в 10.2 для proBNP(1-108).

13.3. Результаты

Было обнаружено, что величины proBNP(1-108), полученные из плазм пациентов, страдающих почечной недостаточностью, при помощи анализа proBNP(1-108) с использованием антитела hinge 76 в твердой фазе и конъюгата антитело 2007-пероксидаза в детектировании, имели высокую корреляцию (r2=0,899) с величинами анализа BNP(1-32) с использованием антитела 20G7 данного изобретения (фигура 10). Антитело 20G7 данного изобретения является в высокой степени подходящим для анализа BNP(1-32) и proBNP(1-108) в пациентах с почечной недостаточностью.

Пример 14. Анализ proBNP(1-108) в пациентах с ишемическим инсультом

14.1. Образцы от пациентов

- Испытывали 32 образца цитратных плазм из пациентов с ишемическим инсультом, поступивших в отделение неотложной помощи в пределах 3 часов после возникновения инсульта. Тяжесть инсульта оценивали по шкале National Institutes of Health Stroke (NIHSS).

- Испытывали 42 образца цитратных плазм из явно здорового донора крови, совпадающего по полу и возрасту с пациентами из популяции с инсультом. Все образцы цитратных плазм хранили при -80°С. Перед анализом образцы оттаивали и центрифугировали при 3000 g в течение 15 минут при 4°С.

14.2. Материал и способ

Все образцы испытывали при помощи анализа BioPlex™ 2200 proBNP (Bio-Rad).

14.2.1. Принцип этой технологии

BioPlex™ 2200 объединяет технологии с применением магнитных гранул и проточной цитометрии для обеспечения мультианалитного детектирования на полностью автоматизированной платформе случайного доступа. Магнитные частицы (диаметр 8 мкм, модифицированная карбоксилом поверхность) окрашивают двумя флуорофорами (классифицирующими красителями, CL1 и CL2), которые испускают различные длины волн и поглощают в основном при 635 нм. Репортерный флуорофор, P-фикоэритрин (РЕ) был выбран из-за его высокого молярного коэффициента экстинкции, квантового выхода, устойчивости к фотообесцвечиванию, отсутствия самогашения и стабильности. Этот детектор одновременно измеряет свет при трех длинах волн: два классифицирующих красителя и репортерный краситель.

14.2.2. Принцип анализа с использованием BioPlex™ 2200 proBNP

Этот анализ BioPlex™ 2200 proBNP является двухстадийным флуоресцентным сэндвич-иммуноанализом. В первой стадии система BioPlex™ 2200 объединяет 50 мкл образцы от пациентов, магнитные окрашенные гранулы, покрытые моноклональным антителом против proBNP(l-108) (моноклональным антителом hinge 76, узнающим эпитоп RAPR76S77P (SEQ ID NO: 58), Bio-Rad), и буфер для анализа в реакционный сосуд. Затем после 11 минут инкубации и циклов промывки добавляют моноклональное антитело 20G7 против BNP человека, конъюгированное с фикоэритрином (РЕ), и инкубируют в течение 2 минут. После удаления избыточного конъюгата эту смесь гранул пропускают через детектор, который идентифицирует окрашенные гранулы и количество антигенов, захваченных на этих гранулах, по флуоресценции РЕ. После калибровки с использованием набора из шести различных калибраторов, трех уровней контроля качества и образцов, взятых у пациентов, результаты выражают в пг/мл.

Гранулы двух контролей качества также тестируют с каждой пробой для увеличения целостности всей этой системы.

14.3. Результаты

Распределения величин BioPlex™ 2200 proBNP для контроля и популяции с ишемическим инсультом показаны в таблице 8 и на фигуре 11. Уровень proBNP(1-108) был значительно более высоким в группе ишемического инсульта в сравнении с этой контрольной группой (критерий Манна-Уитни, p<0,0001). Эти результаты демонстрируют, что proBNP(1-108) также является применимым биомаркером плазмы для ранней диагностики ишемического инсульта.

Таблица 8
Концентрации proBNP по данным BioPlex™ 2200 в образцах цитратной плазмы в популяции с ишемическим инсультом и в контроле (величины минимума, 1-й квартили, медианы, 3-й квартили и максимума).
Популяции Минимум (пг/мл) 1-я квартиль (пг/мл) Медиана (пг/мл) 3-я квартиль (пг/мл) Максимум (пг/мл)
Популяция контроля (N=42) 0 0 1 (IC 95%:0-2) 2 23
Популяция с ишемическим инсультом (N=32) 2 34 71 (IC 95%:38-145) 219 1019

Авторы изобретения ясно демонстрируют, что сэндвич-анализ proBNP(1-108) с использованием моноклонального антитела 20G7, описанного в этом изобретении, может измерять концентрации proBNP(1-108) в пациентах с инсультом.

Пример 15. Анализ proBNP(1-108) в пациентах, страдающих от острой коронарной недостаточности

15.1. Пробы:

- образцы плазмы с ЭДТА из 27 пациентов с острой коронарной недостаточностью (со средними величинами Тропинина I плазмы, достигающими 12,5±6,9 нг/мл), полученные из коммерческого источника (ProMedex, NY, USA);

- образцы плазмы с ЭДТА из 48 здоровых субъектов (здоровых волонтеров, ProMedex, NY, USA).

15.2. Материалы и способы

Материалы и способы, используемые для анализа BNP(1-32), были идентичны материалам и способам, описанным выше в 8.2, а для proBNP(1-108) в 10.2.

15.3. Результаты

Было обнаружено, что величины proBNP(1-108), полученные из плазм пациентов, поступивших в критическом состоянии и диагностированных как имеющие острую коронарную недостаточность, при помощи анализа proBNP(1-108), описанного выше, в высокой степени коррелируют (r2=0,956) с величинами, полученными при помощи анализа BNP(1-32) с использованием антитела 20G7 по данному изобретению (фигура 12). Уровни BNP(1-32) и proBNP(1-108) пациентов с острой коронарной недостаточностью (668±619 и 1518±1533 пг/мл для proBNP(1-108) и BNP(1-32) соответственно, оцениваемые в соответствии с этим изобретением, были более высокими, чем уровни здоровых субъектов (37±32 и 227±172 пг/мл для proBNP(1-108) и BNPQ-32) соответственно, оцениваемые в соответствии с этим изобретением.

Таким образом, ясно, что сэндвич-анализ с использованием антитела 20G7 этого изобретения (связанного с пероксидазой) позволяет измерять концентрации proBNP(1-108), которые пропорциональны уровню BNP(1-32). Эти результаты еще раз доказывают применимость анализа proBNP(1-108) и BNP(1-32) в качестве маркеров, в частности в качестве маркеров острой коронарной недостаточности.

Пример 16. Анализ proBNP(1-108) в гликозилированной форме с использованием моноклонального антитела 20G7

16.1. Материалы

- proBNP(1-108) (рекомбинантный белок, продуцируемый в Е.coli, для негликозилированной формы и из перепрограммированных клеток НЕК293 для гликозилированной формы, HyTest, Finland)

- 96-луночный плоскодонный микропланшет Maxisorp™ (Nunc, Denmark)

- буфер ЗФР (забуференный фосфатом солевой раствор), pH 7,4, таблетки Gibco, кат.номер: 18912-014 (Invitrogen)

- Твин® 20 (Sigma-Aldrich, USA, #P1379)

моноклональное антитело hinge 76, которое узнает шарнирную последовательность шарнира proBNP(1-108): эпитоп RARR76S77P (SEQ ID NO: 55) (Giuliani et al., Clin. Chem., 52: 6, 1054-1061, 2006)

- моноклональное антитело 20G7 (Bio-Rad), связанное с пероксидазой.

16.2. Способ

16.2.1. Принцип аналитического анализа гликозилированного proBNP

Готовили диапазон стандартов 20 - 10000 пг/мл гликозилированного proBNP(1-108) в 0,1% буфере ЗФР-Т. Диапазон стандартов 20 - 10000 пг/мл негликозилированного proBNP(1-108) готовили таким же образом в 0,1% буфере ЗФР-Т.

Этот анализ основывался на принципе сэндвич-ELISA на микропланшете с использованием для иммобилизации на твердой фазе моноклонального антитела (антитела hinge 76, например, из Bio-Rad), узнающего эпитопную последовательность RARR76S77P (SEQ ID NO: 55) proBNP(l-108) и фиксированного пассивной адсорбцией с использованием 100 мкл раствора 0,5 мкг/мл на лунку.

100 мкл раствора моноклонального антитела 20G7 этого изобретения, связанного с пероксидазой, при концентрации 0,5 мкг/мл в буфере 0,1% ЗФР-Твин® 20 (ЗФР-Т), содержащем 0,1% молоко (полуобезжиренное), использовали в качестве детектирующих реагентов. Остальной протокол был идентичен протоколу ELISA в примере 10. Таким образом, характеристики детектирования 20G7 сравнивали для двух форм proBNP(l-108), гликозилированной и негликозилированной.

16.3. Результаты

Результаты, показанные в таблице 9 и на фигуре 13, соответствуют анализам гликозилированного proBNP(1-108) и негликозилированного proBNP(1-108) посредством иммуноанализа с использованием иммобилизованного антитела hinge 76 и антитела 20G7 для детектирования.

Таблица 9
Величины оптической плотности при 490 нм из анализа каждой испытанной формы proBNP(1-108).
Диапазон proBNP(1-108) (пг/мл) Негликозилированный proBNP(1-108) Гликозилированный proBNP(1-108)
10000 4 3,833
5000 3,807 3,801
2500 3,829 3,023
1250 3,256 1,679
625 1,816 0,925
312,5 0,989 0,465
156 0,510 0,268
78 0,221 0,130
39 0,109 0,087
20 0,063 0,041
9 0,037 0,028
0 0,021 0,023

ProBNP(1-108) может быть детектирован также хорошо в негликозилированной форме, как и в гликозилированной форме, с использованием 20G7. Отношение сигнал/фон является слегка более высоким для негликозилированного proBNP, чем для его гликозилированной формы (отношения сигнал/фон 3 и 1,8 соответственно получают при 20 пг/мл).

Пример 17. Иммунореактивность proBNP(1-108) в его гликозилированной форме и применения для анализа proBNP(1-108) с антителом hinge 76

17.1. Материалы

- Анализатор ProteOn XPR36 (технология поверхностных плазменных резонансов SPR, Bio-Rad, USA)

- proBNP(1-108) (рекомбинантный белок, HyTest, Finland) в гликозилированной и негликозилированной формах (13-200 нМ)

- анти-Рс-фрагмент-антитела (Sigma, USA)

- моноклональное антитело hinge 76 (Bio-Rad), которое узнает эпитоп RAPR76S77P (SEQ ID NO: 55) и используется в концентрации 30 мкг/мл в 0,1% ЗФР-Т

- буфер ЗФР (забуференный фосфатом солевой раствор), pJ 7,4

17.2. Способ

17.2.1. Принцип

Анализатор ProteOn XPR36 (принцип которого основывается на технологии поверхностного плазмонного резонанса (SPR)) использовали для определения кинетики и аффинности взаимодействия моноклонального антитела 20G7 с гликолизированными и негликозилированными формами proBNP(l-108). Авторы изобретения следовали инструкциям изготовителя. Моноклональное антитело иммобилизовали на биосенсоре (твердой поверхности) с использованием анти-Fc-фрагмент-антитела, тогда как гликозилированное или негликозилированное антитело циркулировало в увеличивающихся концентрациях (13-200 нМ) в постоянном потоке на поверхности этого биосенсора при комнатной температуре. Угол, при котором детектируется сигнал SPR, является прямо пропорциональным показателю преломления среды, в которой распространяется затухающая волна. Вариации в показателе преломления выражают в резонансных единицах (RU, где 1000 резонансных единиц соответствуют 1 нг фиксированных белков на мм2 активной зоны). Количественную характеристику взаимодействия и аффинности между антигеном и моноклональным антителом оценивают расчетом константы скорости ассоциации (ka) и константы скорости диссоциации (kd) при помощи глобальной обработки данных с использованием программы устройства (Bio-Rad). Равновесная константа диссоциации (KD=kd/ka) в моль/л отражает аффинность гликозилированного или негликозилированного антигена proBNP(l-108) в отношении конкретного моноклонального антитела.

17.2.2. Результаты

Таблица 10 показывает характеристики взаимодействия между анти-hinge-антителом (антителом hinge 76 с эпитопом RAPR76S77P (SEQ ID NO: 55) Bio-Rad) и гликозилированным и негликозилированным proBNP(1-108). Хотя константа аффинности между анти-hinge-антителом и негликозилированным proBNP(1-108) была более высокой (1,73.10-8), чем эта константа для гликозилированного proBNP(1-108) (2,35.10-8), антитело, нацеленное на шарнирную область proBNP(1-108), узнавало как гликозилированную, так и негликозилированную форму с высокой аффинностью.

Таблица 10
Реактивность антитела hinge 76 в отношении гликозилированного и негликозилированного proBNP(1-108)
Hinge 76-аптитело
ka(М- с') kd (с-') KD=kd/ka М
Негликозилированный proBNP(1-108) 1,12·106 1,94·10-4 1,73·10-10
Гликозилированный proBNP(1-108) 1,17·105 2,72·10-3 2,35·10-8

Пример 18. Биэпитопные и триэпитопные калибраторы

18.1. Структура всех биэпитопных и триэпитопных калибраторов в соответствии с этим изобретением может быть линейной или разветвленной при условии, что сохраняется иммунореактивность включенных эпитопов.

Протоколы синтеза, которые могут быть использованы для получения этих калибраторов, являются протоколами в области органической химии пептидов, хорошо известными квалифицированному в данной области специалисту (в этом контексте, см. "Синтез пептидов" в примере 1).

Для эпитопов Е2 и Е3 эти линейные пептидные последовательности по данному изобретению могут быть выбраны неограничивающим образом из группы, состоящей из следующих последовательностей:

SEQ ID NO: 56: PRSPKMVQG

SEQ ID NO: 57: APRSPKMV

SEQ ID NO: 58: SGLGCKLV

SEQ ID NO: 59: SPKMVQGSG

SEQ ID NO: 60: YTLRAPRSPKMVG

18.2. Примеры синтезированных эпитопов в соответствии с изобретением

Авторы этого изобретения синтезировали следующие калибраторы:

18.2.1. Биэпитопные калибраторы

CaliproBNP1: Ac-YTLRAPRSPKMV-AhX-SFGRKMDRISS-CONH2

CaliproBNP2: Ac-YTLRAPRSPKMV-Ahx-CFGRKMDRISSSSGLGCK-CONF2

CaliProBNP3: Ac-YTLRAPRSPKMVQG-AhX-FGRKMDR-CONH2

Эти три биэпитопных калибратора могут быть использованы для калибровки анализа proBNP(1-108), как описано выше в 10.2, на основе иммобилизации в твердой фазе моноклонального антитела hinge 76, которое узнает RAPRSP (SEQ ID NO: 55) (Giuliani et al., supra), а в детектировании, например, конъюгата моноклональное антитело 20С7-пероксидаза.

CaliproBNP4: Ac-FGRKMDR-Ahx-SGLGC*KVLRRH-COOH

CaliproBNP4b: Ac-FGRKMDR-Ahx-SGLGC*KVLR-CONH2

Эти два биэпитопных калибратора могут быть использованы для калибровки анализа BNP(1-32) на основе иммобилизации в твердой фазе моноклонального антитела, направленного на С-концевой район BNP(1-32), такого как, например, моноклональные антитела 50 В7 или 50Е1 (HyTest, Finland), а в детектировании, например, конъюгата моноклональное антитело 2007-пероксидаза.

CaliproBNP5: Ac-SPKMVQGSG-AhX-FGRKMDR-CONH2

Этот биэпитопный калибратор может быть использован для калибровки анализа BNP(1-32), как описано выше в 8.2, на основе иммобилизации в твердой фазе поликлонального антитела L21016 (Bio-Rad), а в детектировании, например, конъюгата моноклональное антитело 2007-пероксидаза.

В вышеописанных последовательностях калибраторов структурной формулой группы Ahx является NH-(CH2)5-CO.

Связывающая группа формулы -NH-(CH2)S-CO- произведена из хорошо известного агента связывания аминогексановой кислоты (AHX), который позволяет ковалентно связывать вместе две пептидные последовательности.

С* = С(Acm) = Цистеин, блокированный ацетамидометилом (защитной группой, хорошо известной квалифицированному в данной области специалисту).

18.2.2. Триэпитопные калибраторы

CaliproBNP6: Ac-YTLRAPRSPKMV-Ahx-FGRKMDR-Ahx-SGLGC*KVLRRH-СООН

CAIiproBNP6b:Ac-YTLRAPRSPKMV-Ahx-FGRKMDR-Ahx-SGLGC*KVLR-CONH2

Эти два триэпитопных калибратора могут быть использованы для калибровки анализа как proBNP(1-108), так и BNP(1-32) с использованием антител, таких как моноклональное антитело 76, которое узнает последовательность RAPRSP (SEQ ID NO: 55) (Giuliani et al., supra), и моноклональное антитело 20G7 этого изобретения и антитело с эпитопом, направленным, например, против C-концевой части BNP(1-32).

18.3. Материалы и способы

Для отображения полезности этих калибраторов результаты калибровки и стабильности представлены в двух различных форматах, в анализе BioPlex™ и анализе ELISA.

- Биэпитопы proBNP(1-108), соединения CaliproBNP1 и CaliproBNP3, тестировали при помощи анализа proBNP BioPlex™ 2200, как описано в примере 14.

- Биоэпитоп BNP(1-32), соединение CaliproBNP5, тестировали при помощи анализа, описанного в примере 8.2, а триэпитоп, соединение CaliproBNP6, тестировали при помощи анализа, описанного в примере 10.2.

18.4. Протокол

Эти различные соединения использовали при различных концентрациях, получаемых разведением в 0,1 М сукцинатном буфере, pH 7,6, содержащем 5% БСА, 2 мМ CaCl2, 10% антипротеазный коктейль (кат. номер Sigma P2714), 0,1% Проклин, 0,095% NaN3 и 0,1% бензоат натрия.

Калибратор CaliproBNPl разводили до 1 мкг/мл, 0,2 мкг/мл, 0,1 мкг/мл и 0,02 мкг/мл, калибратор CaliproBNP3 разводили до 1,6 мкг/мл, 0,8 мкг/мл, 0,3 мкг/мл, 0,06 мкг/мл, калибраторы CaliproBNP5 и CaliproBNP6 от 100 нг/мл до 0,01 нг/мл в том же самом сукцинатном буфере, рН 7,6.

Стабильность этих соединений исследовали при ускоряющих условиях (при комнатной температуре) в сравнении с синтетическим BNP(1-32) (Sigma-Aldrich, США, #В-5900) и рекомбинантным proBNP(1-108) (Ну Test Ref. 8PR08) следующим образом: рекомбинантный proBNP(1-108), синтетический BNP(1-32) и калибровочные пептиды разводили в 0,1 М сукцинатном буфере, рН 7,6, описанном выше. Каждый раствор делили на 10 пробирок, помещенных в условия комнатной температуры (20°C±5°C). Затем одну пробирку каждого раствора замораживали при J0, J+7, J+14, J+21. При J+21 эти различные растворы оттаивали и анализировали при помощи анализа proBNP BioPlex™ 2200, описанного в примере 14, или иммуноанализов, описанных в примерах 8.2 и 10.2.

В анализе ELISA тестировали диапазон proBNP(1-108), BNP(1-32) и CaliproBNP6 от 25 нг/мл до 0,04 нг/мл. Для CaliBNP4 и CaliBNP5 тестируемый диапазон был от 2 нг/мл до 0,004 нг/мл.

В анализе BioPlex™ 2200 proBNP анализировали стабильность двух концентраций proBNP(l-108), 10 нг/мл и 1 нг/мл, CaliproBNP1, 2 мкг/мл и 0,125 мкг/мл, и CaliproBNP3, 1 мкг/мл и 0,3 мкг/мл. В формате ELISA анализировали три концентрации proBNP(1-108) и BNP(1-32), 1,56 нг/мл, 0,78 нг/мл 0,39 нг/мл, и CaliproBNP5, 62,5 НС1 пг/мл, 31 нг/мл и 15,6 нг/мл.

18.5. Результаты

18.5.1. Калибраторы CaliproBNPl и CaliproBNP3 в анализе BioPlex™ 2200 proBNP assay

Результаты этого анализа соединений CaliproBNPl and CaliproBNP3 в диапазоне различных концентраций представлены на фигурах 14 и 15 соответственно.

В одном анализе BioPlex™ 2200 proBNP эти соединения CaliproBNPl и CaliproBNP3 способны генерировать увеличивающийся сигнал при повышении концентрации соединения. Таким образом, эти соединения применимы в качестве калибраторов этого анализа proBNP(1-108) после стандартизации на молекуле proBNP(1-108).

Результаты ускоренного теста стабильности рекомбинантного proBNP(1-108) и соединений CaliproBNP1 и CaliproBNP3 в диапазоне различных концентраций представлены в таблице 11.

Таблица 11
Соединение Концентрация (мкг/мл) Стабильность в жидкости* при комнатной температуре** в буфере***, выраженная отношением "сигнал при JO+X/сигнал при JO"
JO+7 JO+14 JO+21
Рекомбинантный proBNP(1-108) 0,001 0,79 0,65 0,51
0,01 0,85 0,72 0,69
CaliproBNPl 0,125 0,93 0,92 0,95
2 0,95 0,93 0,91
CaliproBNP3 0,3 0,91 0,98 1.15
1 0,92 1,02 1,06
* Норма приемлемости стабильности: чтобы сделать стабильность в день Х после JO приемлемой, отношение сигнал при JO+X/сигнал при ТО должно быть равно 1,00±0,2.
** Комнатная температура: 20°С±5°С
*** 0,1 М сукцинатный буфер, рН 7,6, содержащий 5% БСА, 2 мМ CaCl2, 10% антипротеазный коктейль (кат. номер Sigma P2714), 0,1% проклин, 0,095% NaN3 и 0,1% бензоат натрия.

Биэпитопные калибраторы CaliproBNPl и CaliproBNP3 ясно показывают более высокую стабильность, чем рекомбинантный proBNP(l-108).

18.5.2. Калибраторы CaliproBNP5 и CaliproBNP6 в иммуноанализах на основе применения антитела 20G7

Результаты этого теста соединений в диапазоне различных концентраций представлены на фигурах 16 и 17 соответственно.

В этом анализе BNP(1-32) и proBNP(1-108) биэпитопное соединение CaliproBNP5 и триэпитопное соединение CaliproBNP6 способны генерировать увеличивающийся сигнал при увеличении концентрации соединения. Таким образом, эти соединения применимы в качестве калибраторов в анализе proBNP(1-108) и BNP(1-32).

Результаты ускоренного теста стабильности рекомбинантного proBNP(1-108), BNP(1-32) и соединения CaliproBNP5 в диапазоне различных концентраций представлены в таблице 12.

Таблица 12
Соединение Концентрация (нг/мл) Стабильность в жидкости* при комнатной температуре** в буфере***, выраженная отношением "сигнал при JO+X/сигнал при JO"
JO+7 JO+14 JO+21
Рекомбинантный proBNP(1-108) 1,56 0,58 0,5 0,45
0,78 1,08 0,82 0,88
0,39 0,71 0,66 0,79
Синтетический BNP(1-32) 1.56 0,71 0,7 0,55
0,78 0,69 0,65 0,53
0,39 0,81 0,7 0,53
CaliproBNP5 0,0625 1,02 1,02 1.1
0,031 1,06 1.01 1,06
0,0156 1,1 1,01 1,10
* Норма приемлемости стабильности: чтобы сделать стабильность в день Х после JO приемлемой, отношение сигнал при JO+X/сигнал при JO должно быть равно 1,00±0,2.
** Комнатная температура: 20°С±5°С
*** 0,1 М сукцинатный буфер, рН 7,6, содержащий 5% БСА, 2 мМ CaCl2, 10% антипротеазный коктейль (кат. номер Sigma P2714), 0,1% проклин, 0,095% NaN3 и 0,1% бензоат натрия.

Снова биэпитопный калибратор CaliproBNP5 обнаруживает более высокую стабильность, чем рекомбинантный proBNP(l-108) и BNP(1-32).

Суммирующая таблица последовательностей

SEQ ID NO: Последовательности
1 HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGV WKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSG LGCKVLRRH
2 SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
3 HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGV WKSREVATEGIRGHRKMVLYTLRAPR
4 TGCFGRKMDRISTSTAIGCKVL
5 SGCYGRKMDRISTSTAIGCKVL
6 SGCFGRKMDRISSSSGLGCKVL
7 SGCFGRKMDRIATSTAIGCKVL
8 FGRKMDR
9 GRKMDR
10 FGRKMD
11 RKMDRI
12 SPKMVQGSGCFGRKM
13 KMVQGSGCFGRKMDR
14 VQGSGCFGRKMDRIS
15 GSGCFGRKMDRISSS
16 GCFGRKMDRISSSSG
17 FGRKMDRISSSSGLG
18 RKMDRISSSSGLGCK
19 MDRISSSSGLGCKVL
20 RISSSSGLGCKVLRR
21 VQGSGCFGR
22 SPKMVQGSGC
23 MDRJSSSSGLG
24 RKMDRI
25 RKMDRISS
26 SPKMVQGSGC
27 PKMVQGSGCF
28 KMVQGSGCFG
29 MVQGSGCFGR
30 VQGSGCFGRK
31 QGSGCFGRKM
32 GSGCFGRKMD
33 SGCFGRKMDR
34 GCFGRKMDRI
35 CFGRKMDRIS
36 FGRKMDRISS
37 GRKMDRISSS
38 RKMDRISSSS
39 KMDRISSSSG
40 MDRISSSSGL
41 DRISSSSGLG
42 RISSSSGLGC
43 ISSSSGLGCK
44 SSSSGLGCKV
45 SSSGLGCKVL
46 SSGLGCKVLR
47 SGLGCKVLRR
48 GLGCKVLRRH
49 GCFGRKM
50 CFGRKMD
51 FGRKMDR
52 GRKMDRI
53 RKMDRIS
54 SPKMV
55 RAPRSP
56 PRSPKMVQG
57 APRSPKMV
58 SGLGCKVL
59 SPKMVQGSG
60 YTLRAPRSPKMVG
61 FGRKMDRISSSS
62 AGRKMDR
63 GCFGRKMDRIS
64 SFGRKMDRISS
65 CFGRKMDRISSSSGLGCK
66 YTLRAPRSPKMV
67 YTLRAPRSPKMVQG
68 SGLGCKVLRRH
69 SGLGCKVLR

1. Полипептид, несущий эпитоп BNP(1-32) человека, для получения лигандов, выбранных из группы, состоящей из антитела и фрагмента указанного антитела, распознающего эпитоп, аптамера и полипептида, полученного путем фагового дисплея, специфически распознающего эпитоп, направленных против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR (SEQ ID NO: 51), где указанный полипептид имеет формулу (I):
a 1 R 1 X 1 F G R K M D R X 2 R 2 a 2 ( I )
где
- a1 может быть Н или обозначает функциональную группу или химическую группу, выбранную из тиоловой, спиртовой, аминокси-, первичной амино- или вторичной аминофункциональной группы, аминокарбоксильной группы, биотинильной группы и ацетильной группы;
- а2 может обозначать функциональную группу ОН, NH2 или алкоксильную группу;
- X1 отсутствует или присутствует и, когда присутствует, выбран из С и GC;
- Х2 отсутствует или присутствует и, когда присутствует, выбран из I и IS;
- R1 и R2, которые могут быть одинаковыми или различными, отсутствующими или присутствующими, обозначают любую аминокислоту или пептидную цепь из 2-15 аминокислот при условии, что указанный полипептид формулы (I) не включает в себя никакую часть BNP(1-32) человека, большую чем 11 аминокислот, включающих в себя последовательность GCFGRKMDRIS.

2. Полипептид по п. 1, где указанный полипептид выбран из группы, состоящей из a1-SGCFGRKMDR-a2 (SEQ ID NO: 33), a1-GCFGRKMDRI-a2 (SEQ ID NO: 34), a1CFGRKMDRIS-a2 (SEQ ID NO: 35) и a1FGRKMDRISS-a2(SEQ ID NO: 36), где a1 и а2 определены в п. 1.

3. Полипептид по п. 1, имеющий формулу (II):
a1-FGRKMDR-a2 (II),
где a1 и a2 определены в пункте 1.

4. Применение полипептида по любому из пп. 1-3 для получения лигандов, направленных против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR, где указанный лиганд, специфичный к эпитопу с последовательностью FGRKMDR, выбран из группы, состоящей из антитела или фрагмента указанного антитела, который распознает эпитоп, аптамера и полипептида, полученного при помощи фагового дисплея, который распознает эпитоп специфическим образом.

5. Применение полипептида по любому из пп. 1-3 для получения гибридомы, которая секретирует моноклональное антитело, направленное против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR.

6. Способ получения гибридомы, которая секретирует моноклональное антитело, направленное против BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR, в котором для получения гибридомы:
- образцы лимфоцитов, секретирующих иммуноглобулины, берут из животного, иммунизированного полипептидом по п.1,
- лимфоциты сливают с миеломными клетками.

7. Гибридома, секретирующая моноклональное антитело, направленное против BNP(1-32) человека или proBNP(1-108) человека, депонированная 13 апреля 2007 года в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75 724 Paris Cedex 15, France) под регистрационным номером CNCM I-3746.

8. Лиганд, специфичный к эпитопу с последовательностью FGRKMDR, представляющей собой моноклональное антитело, продуцируемое гибридомой, депонированной 13 апреля 2007 года в CNCM (Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25, rue du Docteur Roux, 75 724 Paris Cedex 15, France) под регистрационным номером CNCM I-3746.

9. Применение лиганда по пункту 8 для детектирования в биологическом образце BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR.

10. Способ детектирования в биологическом образце BNP(1-32) человека или производного proBNP(1-108) человека, содержащего последовательность FGRKMDR, включающий:
1) контактирование биологического образца, по меньшей мере, с одним лигандом, определенным в пункте 8, при условиях, позволяющих образование комплексов антиген-лиганд, и
2) детектирование любого комплекса, если он был образован.

11. Способ in vitro диагностики, прогноза, стратификации риска или последующего наблюдения отдаленных результатов сердечной и/или сосудистой патологии у индивидуума, включающий стадии:
1) контактирования биологического образца из индивидуума, по меньшей мере, с одним лигандом, определенным в п. 8, при условиях, позволяющих образование комплексов антиген-лиганд,
2) детектирования любого комплекса, который мог быть образован,
3) основанное на результатах детектирования стадии (2) определение диагноза, прогноза, риска развития или терапевтическое наблюдение патологии у индивидуума.

12. Способ по п.11, где эта патология выбрана из группы, состоящей из:
- застойной сердечной недостаточности,
- острого коронарного синдрома,
- нарушения мозгового кровообращения,
- почечной недостаточности,
- одышки (диспноэ),
- высокого кровяного давления,
- разрыва атероматозной бляшки,
- открытого артериального (Боталлова) протока у недоношенных новорожденных и/или
- диабета.

13. Мультиэпитопный калибратор, предназначенный для получения калибровочных кривых для анализов BNP(1-32), proBNP(1-108) и/или их фрагментов, содержащих последовательность F11GRKMDR17 (SEQ ID NO: 51), где указанный мультиэпитопный калибратор имеет общую формулу (III):
t 1 E 1 L 1 E 2 [ L k 1 E k ] n t 2 ( I I I ) ,
где:
- n обозначает целое число между 0 и 8;
- k обозначает целое число между 3 и n+2, когда n>0;
- E1, Е2 и Ek отличаются друг от друга, причем один обозначает пептидную последовательность R1-X1-FGRKMDR-X2-R2, где X1, X2, R1 и R2 имеют определенные в п.1 значения, а другие обозначают последовательность из 3-15 аминокислот, выбранную из последовательности proBNP(1-108) человека;
- t1 обозначает атом водорода, ацетильную группу, пептидную последовательность из 1-10 аминокислот, пептидную последовательность из 1-10 N-α-ацетилированных аминокислот, биотинильную или биоцитинильную группу, пептидную последовательность из 1-10 аминокислот, несущую биотинильный или биоцитинильный радикал, или линейную аминоалкил-(C1-C10)-карбонильную цепь;
- t2 обозначает гидроксильный радикал, аминорадикал, пептидную последовательность из 1-10 аминокислот, пептидную последовательность из 1-10 аминокислот, несущую концевую аминогруппу, или линейную или разветвленную аминоалкил-(C1-C10)-карбонильную цепь;
- L1 и Lk, которые могут быть одинаковыми или различными, обозначают связывающую группу пептидных цепей.

14. Набор для детектирования BNP(1-32) человека или proBNP(1-108) человека, а также их соответствующих фрагментов, содержащих последовательность FGRKMDR, содержащий, по меньшей мере:
- лиганд, определенный в п. 8; и
- мультиэпитопные калибраторы, определенные в п.13.

15. Способ in vitro диагностики инсульта у индивидуума, включающий стадии:
1) контактирования биологического образца из индивидуума, по меньшей мере, с одним лигандом, определенным в п. 8, при условиях, позволяющих образование комплексов антиген-лиганд,
2) детектирования любого комплекса, если он был образован;
где, по меньшей мере, один лиганд стадии 1) используют в иммобилизованной на твердой фазе форме в комбинации с моноклональным антителом, направленным против последовательности RAPR76S77P proBNP(1-108), присутствующим в меченой форме, или, по меньшей мере, один лиганд стадии 1) используют в меченой форме в комбинации с моноклональным антителом, направленным против последовательности RAPR76S77P proBNP(1-108), присутствующим в иммобилизованной форме на твердой фазе.



 

Похожие патенты:

Изобретение относится к устройствам для проведения иммуноанализа и может использоваться для лабораторной диагностики вирусных инфекций. Микрофлюидная система включает канал для анализируемой жидкости и еще четыре канала, расположенных перпендикулярно к каналу для анализируемой жидкости и одним концом соединяющихся с ним, при этом один из этих каналов является измерительным и в него помещены рецепторы в жидкой среде, другой канал является опорным и содержит только жидкую среду, а в два остальных канала помещены флуоресцентные метки с иммобилизованным на них субстратом в жидкой среде.
Изобретение относится к области медицины, а именно к биохимии, и может быть использовано для определения протеолитической модификации клеточных рецепторов на модели выделенных лимфоцитов периферической крови.
Изобретение относится к медицине, а именно к способу прогнозирования риска развития нагноительной формы заболевания и его затяжного течения у больных в возрасте 10-15 лет с инфильтративной формой зооантропонозной трихофитии.

Группа изобретений относится к области биотехнологии и может быть использована для повышения эффективности и достоверности определения уровня токсикантов в различных средах путем проведения твердофазного иммуноферментного анализа.

Изобретение относится к области лабораторной диагностики, а именно иммуногенетическим исследованиям в онкологии, и может быть использовано для прогнозирования развития нефробластомы у детей и подростков.

Изобретение относится к животноводству, а именно к скотоводству, и может быть использовано для оценки адаптации организма. Способ оценки уровня адаптационных способностей крупного рогатого скота заключается в определении показателя оценки в группе здоровых животных путем вычисления отношения содержания моноцитов к лимфоцитам в лейкограмме периферической крови по формуле: П о А = М Л ф * 100 , где ПоА - показатель оценки адаптации, М - моноциты, %, Лф - лимфоциты, %, 100 - корректирующий коэффициент. При этом выделяют три типа по уровню напряженности: высокий - 6,0-7,5, низкий - 5,0-6,0 и перенапряжения - 7,5-8,5.

Настоящее изобретение относится к прогностическому анализу, а также к способу его применения для определения вероятности продуцирования терапевтического ответа в пораженных клетках или тканях на лечение заболевания, имеющего этиологию, связанную с избыточной пролиферацией клеток, с использованием сердечного гликозида.

Предложенная группа изобретений относится к области медицины. Предложены способ и набор для определения функциональной активности компонента C3 комплемента человека.
Изобретение относится к медицине, а именно к гинекологии, и может быть использовано для прогнозирования эффективности использования однократного курса ультразвукового кавитационного орошения полости матки у женщин с хроническим эндометритом.

Изобретение относится к области микробиологии и молекулярной генетики и касается рекомбинантного полипептида А2, ДНК, его колирующей, штамма продуцирующего полипептид А2 и способов использования такого рекомбинантного полипептида.

Изобретение относится к биотехнологии и может быть использовано для получения моноклональных антител (МКА) к V антигену Yersinia pestis. .

Изобретение относится к биотехнологии и может быть использовано для получения моноклональных антител (МКА) к V антигену Yersinia pestis. .

Изобретение относится к области медицины и может быть использовано при патоморфологической диагностике остеопороза по костным биоптатам. .

Изобретение относится к области биотехнологии и представляет собой выделенную нуклеиновую кислоту, включающую регуляторную последовательность РНК-полимеразы I собаки и содержащую (i) по меньшей мере 250, или по меньшей мере 350, или по меньшей мере 450 соприкасающихся нуклеотидов или всю нуклеотидную последовательность, представленную в виде последовательности SEQ ID NO:26, (ii) полинуклеотид, который по меньшей мере на 80% идентичен указанной выше нуклеотидной последовательности (i) или включает комплементарную или обратно комплементарную (i) или (ii) последовательность.
Изобретение относится к биотехнологии и иммунологии и касается получения моноклональных антител (МкАт) к рекомбинантному эритропоэтину (ЭПО) человека с помощью гибридных культивируемых клеток (гибридом) животных.

Изобретение относится к области биотехнологии, а именно к рекомбинатной плазмидной ДНК рАР271 и линии клеток Mesocricetus auratus ВНК 21 k.13 (2H7). .

Изобретение относится к медицине, в частности к онкологии и иммунологии, и касается лечения В-клеточной лимфомы. .
Наверх