Способ лечения хронической сердечной недостаточности



Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности
Способ лечения хронической сердечной недостаточности

 


Владельцы патента RU 2512933:

КОРТЕРА, ИНК. (US)

Изобретение относится к медицине, в частности к кардиологии, и касается лечения пациентов с хронической сердечной недостаточностью. Способ включает введение человеку фармакологически активного релаксина Н2 в терапевтически эффективном количестве, равном 10-480 мкг/кг в сутки. Показанием для включения релаксина в проводимую терапию является хроническая и стабильная компенсированная застойная сердечная недостаточность на момент начала лечения. Способ обеспечивает снижение частоты декомпенсации, частоты или продолжительности госпитализации, риска смерти по сравнению с лечением без релаксина. 5 з.п. ф-лы, 2 пр., 3 табл., 13 ил.

 

Перекрестные сведения на родственные заявки

По настоящей заявке испрашивается приоритет в соответствии с 35 разделом Свода законов США, §119(е), на основе следующих предварительных заявок на патент США: US 61/201240, поданной 8 декабря 2008 г., US 60/470420, поданной 15 мая 2003 г., US 61/190545, поданной 28 августа 2008, и US 61/127889, поданной 16 мая 2008, сущность каждой из которых включена в настоящее изобретение в виде ссылки.

Область техники, к которой относится изобретение

Настоящее изобретение относится к способам лечения людей с хронической сердечной недостаточностью. В указанных способах осуществляют введение релаксина.

Предпосылки создания изобретения

Сердечная недостаточность представляет серьезную медицинскую проблему и является наиболее частой причиной госпитализации пациентов старше 65 лет (Krumholz и др., Am. Heart J., 139, 2000, с.72-77). Главными симптомами сердечной недостаточности являются одышка, утомляемость и задержка жидкости в организме, которые могут привести к легочной гиперемии и периферическому отеку. Сердечная недостаточность почти всегда является прогрессирующим заболеванием и легко обостряется, приводя к острой декомпенсированной сердечной недостаточности (Hunt и др., Circulation, 112, 2005, с.154-235). Клиническая диагностика острой сердечной недостаточности (ОСН) представляет одну из самых дорогих диагностик согласно ранее представленным данным Центра бесплатной или льготной медицинской помощи малоимущим и членам их семей. В самом деле, ежегодно наблюдается более миллиона госпитализаций с ОСН с частотой повторной госпитализации в течение шести месяцев, составляющей примерно 50% (Koelling и др., Am Heart J, 147, 2004, сс.74-78).

Хотя существенный прогресс был достигнут в области лечения хронической сердечной недостаточности (СН), по-прежнему остаются существенными показатели заболеваемости и смертности. Средняя продолжительность жизни у пациентов с соответствующими симптомами составляет менее пяти лет; сообщают, что процент смертельных исходов в течение года доходит до 90% для пациентов с наиболее запущенной формой заболевания (Stewart и др., Eur J Heart Fail, 3, 2001, сс.315-322; Hershberger и др., J Card Fail, 9, 2003, с.180-187; и Rose и др., N Eng J Med, 345, 2001, сс.1435-1443). Поэтому целью клинических манипуляций при сердечной недостаточности является продление компенсированного (стабилизированного) периода и предупреждение прогрессирования заболевания на возможно долгий срок. В настоящее время накоплены знания о сложном взаимодействии между сердцем и почками у пациентов с сердечной недостаточностью. По существу многие применяемые для лечения таких групп пациентов традиционные лекарственные средства, которые могут существенно изменять функцию почек, больше не рассматриваются в качестве средств, оптимальных для лечения. Кроме того, современные лекарственные средства, с помощью которых ведут пациентов с хронической сердечной недостаточностью, обладают умеренной эффективностью или проявляют тяжелые побочные эффекты, например гипотонию, тахикардию, аритмию и ухудшение почечной недостаточности. Таким образом, необходима разработка новых лекарственных средств и схем лечения, которые могут стабилизировать пациентов с хронической сердечной недостаточностью (СН) и которым свойственны менее тяжелые побочные эффекты.

Краткое описание предпочтительных вариантов осуществления настоящего изобретения

В настоящем описании приводятся способы лечения людей с хронической сердечной недостаточностью. В описанных в настоящем изобретении способах используют введение релаксина. В настоящем описании приводятся способы лечения пациентов с застойной сердечной недостаточностью (ЗСН) путем введения релаксина. Число госпитализаций из-за ухудшения состояния из-за ЗСН возрастает и стоимость, связанная с уходом за такими пациентами, становится крайне обременительной. Таким образом, необходим новый терапевтический подход, и сущность настоящего описания направлена на решение этой проблемы. Одно из преимуществ настоящего изобретения заключается в том, что введение релаксина приводит к сбалансированному расширению кровеносных сосудов, которое предупреждает компенсированную сердечную недостаточность от перехода к острой декомпенсированной сердечной недостаточности. При этом субъектов можно поддерживать на стабильно-устойчивом уровне, на котором госпитализация не требуется и число или длительность посещений врача существенно снижено. Другое преимущество настоящего изобретения заключается в том, что релаксин при введении пациенту проявляет эффективность с небольшими побочными реакциями из-за применения лекарства (ПРЛ), или такие реакции отсутствуют. В настоящем изобретении описано, что релаксин проявляет полезное действие на снижение острой декомпенсации путем стабилизации пациентов без индукции ПРЛ. Таким образом, настоящее изобретение предусматривает лечение, которое приводит к сбалансированному расширению кровеносных сосудов в определенной группе пациентов с хронической сердечной недостаточностью.

Один из объектов настоящего изобретения предусматривает способ снижения острых сердечных декомпенсационных событий, включая выбор людей с хронической СП, у которых имеется сосудистая сеть, а сосудистая сеть имеет рецепторы релаксина. Способ дополнительно включает введение субъекту фармацевтического состава, включающего фармацевтически действующий релаксин в количестве, эффективном для снижения частоты острых сердечных декомпенсационных событий у субъекта, приводя к сбалансированному расширению кровеносных сосудов. Сердечная декомпенсация может быть следствием одной или нескольких причин, включая, но ими не ограничиваясь, нейрогормональный дисбаланс, избыток жидкости в организме, сердечную аритмию и сердечную ишемию. В другом варианте осуществления настоящего изобретения пациент страдает от острой сосудистой недостаточности.

Установлено, что применяемым в фармацевтических составах релаксином может быть, например, синтетический или рекомбинантный релаксин, или фармацевтически эффективный агонист релаксина. В другом варианте осуществления настоящего изобретения релаксином является релаксин человека H1. В другом варианте осуществления настоящего изобретения релаксином является релаксин человека Н2. В еще одном из вариантов осуществления настоящего изобретения релаксином является релаксин человека Н3. В другом варианте осуществления настоящего изобретения релаксином является синтетический или рекомбинантный релаксин человека или фармацевтически эффективный агонист релаксина. Таким образом, субъекта можно лечить фармацевтическим составом синтетического или рекомбинантного релаксина человека или агониста релаксина. В другом варианте осуществления настоящего изобретения субъекта лечат синтетическим релаксином человека. В другом варианте осуществления настоящего изобретения субъекта лечат рекомбинантным релаксином человека. В еще одном из вариантов осуществления настоящего изобретения субъекта лечат фармацевтически эффективным агонистом релаксина. Релаксин может быть введен субъекту с помощью ряда различных способов, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное, подъязычное введение и введение ингаляцией. Точнее фармацевтический состав релаксина или агониста релаксина может вводиться субъекту в количестве примерно 10-1000 мкг/кг массы тела субъекта в сутки. В этом случае релаксин вводят субъекту таким образом, чтобы поддерживать концентрацию релаксина в сыворотке примерно в диапазоне 1-500 нг/мл.

У субъектов, которые могут извлечь пользу из методов, представленных в настоящем описании, сердечная недостаточность была диагностирована за год или более перед введением релаксина. Признаки острой сердечной декомпенсации, частота которых может быть снижена за счет лечения релаксином, включают, но ими не ограничиваются, одышку, гипертонию, аритмию, пониженный почечный кровоток и почечную недостаточность. Эти события часто ассоциированы с госпитализацией, в том числе повторной. В другом варианте осуществления настоящего изобретения эти признаки декомпенсации острой сердечной недостаточности, по сути, являются патофизиологическими. В большинстве случаев такие события связаны с острой декомпенсированной сердечной недостаточностью (ОСН). В другом варианте осуществления настоящего изобретения пациенты подвержены сосудистой недостаточности. В другом варианте осуществления настоящего изобретения острая сердечная декомпенсация является прерывистой.

Другой объект настоящего изобретения предусматривает способ снижения частоты острых сердечных декомпенсирующих событий. В некоторых вариантах осуществления настоящего изобретения способы включают выбор субъекта с компенсированной ЗСН, у которого имеется сосудистая сеть с рецепторами релаксина, и введение указанному субъекту фармацевтического состава, включающего релаксин фармацевтического действия в количестве, эффективном для снижения частоты признаков острой сердечной декомпенсации, проявляемых у субъекта, за счет связывания рецепторов релаксина в сосудистой сети субъекта. В этом способе лечение релаксином приводит к снижению частоты случаев острой сердечной декомпенсации, и этот эффект длится по меньшей мере примерно 1-14 суток от начала лечения релаксином. Случаи острой сердечной декомпенсации включают, но ими не ограничиваются, одышку, избыточную массу тела из-за задержки жидкости в организме, длительности пребывания в больнице, вероятность повторной госпитализации, потребность в петлевых диуретиках, потребность во внутривенном (ВВ) нитроглицерине и степень ухудшения сердечной недостаточности. В другом варианте осуществления настоящего изобретения пациентов лечат релаксином в течение 48 ч. В другом варианте осуществления настоящего изобретения пациентов лечат релаксином релаксин в течение 24 ч. В еще одном из вариантов осуществления настоящего изобретения пациентов лечат релаксином в течение 12 ч. В еще одном другом варианте осуществления настоящего изобретения пациентов лечат релаксином в течение 6 ч. Действие релаксина может быть измерено в какое-либо время, например, в 1 сутки, 2 сутки, 3 сутки, 4 сутки, 5 сутки, 6 сутки, 7 сутки, 8 сутки, 9 сутки, 10 сутки, 11 сутки, 12 сутки, 13 сутки, 14 сутки или позднее после введение релаксина.

В одном из предпочтительных вариантов осуществления настоящего изобретения релаксин вводят в количестве примерно 30 мкг/кг/сутки. В одном из предпочтительных вариантов осуществления настоящего изобретения релаксин вводят в количестве примерно 30 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 35 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 40 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 45 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 50 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 55 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 60 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 65 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 70 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 75 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 80 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 85 мкг/кг/сутки. В другом предпочтительном варианте осуществления настоящего изобретения релаксин вводят в количестве примерно 100 мкг/кг/сутки. Релаксин также может вводиться в дозе 90-200 мкг/кг/сутки. К фармацевтически эффективным релаксинам относятся рекомбинантный или синтетический релаксин человека H1, релаксин человека Н2, или релаксин человека Н3, или их агонист или вариант. В одном из предпочтительных вариантов осуществления настоящего изобретения релаксин вводят субъекту таким образом, чтобы поддержать концентрацию в сыворотке примерно на уровне 10 нг/мл. Фармацевтический состав релаксина может вводиться внутривенно, подкожно, внутримышечно, сублингвально или ингаляционно. В одном из предпочтительных вариантов осуществления настоящего изобретения фармацевтический состав релаксина вводят внутривенно. К рецепторам релаксина, которые активируются через связывание релаксина, относятся, но ими не ограничиваются, LRG7, LGR8, GPCR135 и GPCR142. Связывание релаксина с рецепторами релаксина индуцирует выработку оксида азота (NO), что приводит к сбалансированному расширению сосудов. Рецепторы релаксина расположены, например, на ткани гладких мышц сосудистой сети.

Кроме того, настоящее изобретение предусматривает способ лечения сердечной недостаточности, включающий введение человеку фармацевтически действующего релаксина в количестве, терапевтически эффективном для снижения частоты или длительности госпитализации субъекта по сравнению с лечением без применения релаксина, в котором у субъекта имеется сердечная недостаточность II класса, или III класса по классификации сердечной недостаточности, разработанной Ассоциацией кардиологов Нью-Йорка (АКН), на момент начала введения лекарственного средства. В другом варианте осуществления настоящего изобретения способ включает снижение частоты декомпенсации по сравнению с лечением без релаксина. В другом варианте осуществления настоящего изобретения декомпенсация включает симптом, требующий внеплановой медицинской помощи, который выбран из группы, включающей одышку, отек и утомляемость. В другом варианте осуществления настоящего изобретения декомпенсация включает один или несколько симптомов из следующих: повышенного задержания жидкости в организме, гипотонии, гипертонии, аритмии, пониженного кровотока почек, повышенных уровней натрийуретического пептида мозга (brain natriuretic peptide - BNP), повышенных уровней N-концевого про-В-типа натрийуретического пептида (NT-pro-BNP), повышенных уровней азота мочевины крови (АМК) и повышенных уровней креатинина. В другом варианте осуществления настоящего изобретения декомпенсация нуждается во введении внутривенного диуретика. В другом варианте осуществления настоящего изобретения декомпенсация включает снижение риска смерти из-за сердечной недостаточности, причем у субъекта имеется стадия В, или стадия С, органическое заболевание сердца, согласно методическим руководствам Американской ассоциации кардиологов, без наблюдаемых симптомов сердечной недостаточности на момент начала введения.

В другом варианте осуществления настоящего изобретения у субъекта на стадии С, органическое заболевание сердца, согласно методическим руководствам Американской ассоциации кардиологов, с имеющимися симптомами сердечной недостаточности, имеющимися на начало введения. В еще одном из вариантов осуществления настоящего изобретения фракция выброса левого желудочка (ФВЛЖ) у субъекта составляет примерно 35% или менее на момент начала введения. В еще одном из вариантов осуществления настоящего изобретения у субъекта систолическое кровяное давление составляет примерно 85 мм Hg или более на момент начала введения. В другом варианте осуществления настоящего изобретения у субъекта систолическое кровяное давление составляет примерно 85-125 мм Hg на момент начала введения. В другом варианте осуществления настоящего изобретения релаксин (например, рекомбинантный, очищенный или синтетический) является релаксином человека Н2 (или в других вариантах осуществления настоящего изобретения, релаксином человека H1 или релаксином человека Н3). В другом варианте осуществления настоящего изобретения релаксин является агонистом релаксина. В другом варианте осуществления настоящего изобретения релаксин вводят в фиксированной дозе примерно 10-960 (например, примерно 10, 30, 100, 240, 480 или 940) мкг/кг/сутки (без предварительного титрования). В другом варианте осуществления настоящего изобретения релаксин вводят, используя обычный способ доставки, выбранный из группы, включающей внутривенное, внутримышечное и подкожное введение (или внутрикожное, подъязычное, ингаляционное введение или использование пригодного для ношения инфузионного насоса). В еще одном из вариантов осуществления настоящего изобретения релаксин вводят инфузией на протяжении периодов времени, выбранных из группы, состоящей по меньшей мере примерно из 4, 8, 12, 24 и 48 ч. В другом варианте осуществления настоящего изобретения введение представляет непрерывное введение релаксина. В еще одном из вариантов осуществления настоящего изобретения релаксин вводят инъекцией с частотой, выбранной из группы, включающей частоту введения трижды в сутки, дважды в сутки, ежедневно, три раза в неделю, два раза в неделю, раз в неделю, раз в две недели и раз в месяц. В другом варианте осуществления настоящего изобретения введение представляет прерывистое введение релаксина. В другом варианте осуществления настоящего изобретения введение не приводит к побочному эффекту, выбранному из группы, состоящей из гипотонии, тахикардии, аритмии и ухудшения функции почек. В другом варианте осуществления настоящего изобретения введение дополнительно приводит к снижению одного или нескольких из следующих показателей: системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления, азота мочевины крови, креатинина и циркулирующего N-концевого прогормона мозгового натрийуретического пептида. В другом варианте осуществления настоящего изобретения субъект получает одно или несколько из следующих средств: антитромбоцитарный агент, бета-блокатор, диуретик и антиангиотензивную терапию (ингибитор ангиотензин-конвертирующего фермента или блокатор рецептора ангиотензина) на момент начала введения. В еще одном другом варианте осуществления настоящего изобретения у субъекта нет острой сердечной недостаточности, требующей госпитализации на момент начала введения.

Настоящее описание также предусматривает способ лечения сердечной недостаточности, включающий введение субъекту фармацевтически действующего релаксина в количестве, терапевтически эффективном для улучшения функциональной активности субъекта, у которого наблюдают сердечную недостаточность III класса или IV класса по классификации сердечной недостаточности Ассоциации кардиологов Нью-Йорка (АКН). В другом варианте осуществления настоящего изобретения улучшенная функциональная активность соответствует повышенной оценке по вопроснику Миннесоты для живущих с сердечной недостаточностью (Minnesota Living With Heart Failure®) (или близкой оценке качества жизни или воздействия физикальных симптомов сердечной недостаточности на социальные, ментальные и/или эмоциональные функции). В другом варианте осуществления настоящего изобретения улучшенная функциональная активность соответствует повышенному пройденному расстоянию в 6-минутном прогулочном тесте (или по сходному измерению переносимости физической нагрузки). В другом варианте осуществления настоящего изобретения улучшенная функциональная активность соответствует повышению максимального потребления кислорода (VO2max). В другом варианте осуществления настоящего изобретения улучшенная функциональная активность соответствует изменению в сторону класса более умеренного проявления сердечной недостаточности по классификации сердечной недостаточности АКН.

В другом варианте осуществления настоящего изобретения субъект находится на стадии С, органическое заболевание сердца, согласно методическим руководствам Американской ассоциации кардиологов с наблюдаемыми симптомами сердечной недостаточности на момент начала введения. В еще одном другом варианте осуществления настоящего изобретения субъект находится на стадии D, неподдающейся лечению сердечной недостаточности, согласно методическим руководствам Американской ассоциации кардиологов, которая отличается выраженными симптомами сердечной недостаточности в состоянии покоя, несмотря на оптимальное лечение на момент начала введения. В другом варианте осуществления настоящего изобретения субъект на стадии D сердечной недостаточности пригоден для механической поддержки кровообращения или для трансплантации сердца, или и для того, и для другого. В другом варианте осуществления настоящего изобретения у субъекта имеется стадия D сердечной недостаточности и он признается субъектом для проявления заботы в предстоянии смерти. В еще одном варианте осуществления настоящего изобретения у субъекта диагностируют сердечную недостаточность по меньшей мере за один год до начала введения. В другом варианте осуществления настоящего изобретения релаксин (например, рекомбинантный, очищенный или синтетический) является релаксином Н2 человека (или в других вариантах осуществления настоящего изобретения релаксином H1 человека или релаксином Н3 человека). В другом варианте осуществления настоящего изобретения релаксином является агонист релаксина. В другом варианте осуществления настоящего изобретения релаксин вводят в фиксированной дозе примерно 10-960 (например, примерно 10, 30, 100, 240, 480 или 940) мкг/кг/сутки (без предварительного титрования).

В другом варианте осуществления настоящего изобретения релаксин вводят в фиксированной дозе примерно 240-960 (например, примерно 240, 480 или 940) мкг/кг/сутки (без предварительного титрования). В другом варианте осуществления настоящего изобретения релаксин вводят способом введения, выбранным из группы, включающей: внутривенное, внутримышечное и подкожное введение (или внутрикожное, подъязычное, ингаляционное введение или использование пригодного для ношения инфузионного насоса). В другом варианте осуществления настоящего изобретения релаксин вводят инфузией в течение временного отрезка, выбранного из группы, включающей по меньшей мере примерно 4, 8, 12, 24 и 48 ч. В еще одном другом варианте осуществления настоящего изобретения введение представляет непрерывное введение релаксина. В еще одном варианте осуществления настоящего изобретения релаксин вводят инъекцией с частотой, выбранной из группы, включающей частоту введения трижды в сутки, дважды в сутки, ежедневно, три раза в неделю, два раза в неделю, раз в неделю, раз в две недели и раз в месяц. В другом варианте осуществления настоящего изобретения введение включает прерывистое введение релаксина. В другом варианте осуществления настоящего изобретения введение не приводит к побочным эффектам, выбранным из группы, включающей гипотонию, тахикардию, аритмию и ухудшенную функцию почек. В другом варианте осуществления настоящего изобретения введение дополнительно приводит к снижению одного или нескольких следующих признаков: системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления, азота мочевины крови, креатинина и циркулирующего N-концевого прогормона мозгового натрийуретического пептида. В другом варианте осуществления настоящего изобретения субъект получает один или несколько из следующих агентов: антитромбоцитарный агент, бета-блокатор, диуретик и антиангиотензивная терапия (ингибитор ангиотензин-конвертирующего фермента или блокатор рецептора ангиотензина) на момент начала введения. В еще одном варианте осуществления настоящего изобретения у субъекта нет острой сердечной недостаточности, требующей госпитализации на момент начала введения.

Другой объект настоящего изобретения раскрывает способ лечения сердечной недостаточности, включающий введение человеку фармацевтически действующего релаксина в количестве, терапевтически эффективном для уменьшения применения субъектом одновременно используемых лекарственных средств, применяемых при хронической сердечной недостаточности, к которым относятся один или несколько из следующих: антитромбоцитарный агент, бета-блокатор, диуретик и антиангиотензивные средства (ингибитор ангиотензин-конвертирующего фермента или блокатор рецептора ангиотензина). В другом варианте осуществления настоящего изобретения у субъекта была сердечная недостаточность II класса или III класса по классификации сердечной недостаточности Ассоциацией кардиологов Нью-Йорка (АКН) на момент начала введения. В другом варианте осуществления настоящего изобретения у субъекта имеется стадия В или стадия С, органическое заболевание сердца, согласно методическим руководствам Американской ассоциации кардиологов без наблюдаемых симптомов сердечной недостаточности на момент начала введения. В еще одном варианте осуществления настоящего изобретения у субъекта имеется стадия С, органическое заболевание сердца, согласно методическим руководствам Американской ассоциации кардиологов с проявляемыми симптомами сердечной недостаточности на момент начала введения. В другом варианте осуществления настоящего изобретения у субъекта фракция выброса левого желудочка (ФВЛЖ) составляет примерно 35% или менее на момент начала введения. В другом варианте осуществления настоящего изобретения систолическое кровяное давление у субъекта составляет примерно 85 мм Hg или более на момент начала введения. В еще одном варианте осуществления настоящего изобретения систолическое кровяное давление у субъекта составляет примерно 85-125 мм Hg на момент начала введения. В другом варианте осуществления настоящего изобретения релаксин (например, рекомбинантный, очищенный или синтетический) является релаксином Н2 человека (или в других вариантах осуществления настоящего изобретения релаксином H1 человека или релаксином Н3 человека). В еще одном варианте осуществления настоящего изобретения релаксин является агонистом релаксина. В другом варианте осуществления настоящего изобретения релаксин вводят в фиксированной дозе примерно 10-960 (например, примерно 10, 30, 100, 240, 480 или 940) мкг/кг/сутки (без предварительного титрования). В другом варианте осуществления настоящего изобретения релаксин вводят используя способ доставки, выбранный из группы, состоящей из внутривенного, внутримышечного и подкожного введения (или внутрикожного, подъязычного, ингаляционного введения или использования пригодного для ношения инфузионного насоса). В еще одном варианте осуществления настоящего изобретения релаксин вводят инфузией в течение периода времени, выбранного из группы, состоящей из 4, 8, 12, 24 и 48 ч. В другом варианте осуществления настоящего изобретения введение представляет непрерывное введение релаксина. В еще одном другом варианте осуществления настоящего изобретения релаксин вводят инъекцией с частотой, выбранной из группы, включающей частоту введения трижды в сутки, дважды в сутки, ежедневно, три раза в неделю, два раза в неделю, раз в неделю, раз в две недели и раз в месяц. В другом варианте осуществления настоящего изобретения введение включает переменное введение релаксина. В другом варианте осуществления настоящего изобретения введение не приводит к побочным эффектам, выбранным из группы, состоящей из гипотонии, тахикардии, аритмии и почечной недостаточности. В другом варианте осуществления настоящего изобретения введение дополнительно приводит к снижению одного или нескольких из следующих показателей: системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления, азота мочевины крови, креатинина и циркулирующего N-концевого прогормона мозгового натрийуретического пептида. В другом варианте осуществления настоящего изобретения снижение применения представляет снижение дозы одного или нескольких лекарственных средств, применяемых одновременно при хронической сердечной недостаточности. В другом варианте осуществления настоящего изобретения снижение применения представляет прекращение одновременного применения одного или нескольких из указанных лекарственных средств, применяемых при хронической сердечной недостаточности. В еще одном другом варианте осуществления настоящего изобретения у субъекта нет острой сердечной недостаточности, требующей госпитализации на момент начала введения.

Настоящее изобретение дополнительно предусматривает способ лечения сердечной недостаточности, включающий введение человеку фармацевтически действующего релаксина в количестве, терапевтически эффективном для повышения сердечного индекса у субъекта с сердечной недостаточностью, и сердечный индекс субъекта на момент начала введения меньше примерно 2,5 л/мин/м2. В другом варианте осуществления настоящего изобретения у субъекта имеется сердечная недостаточностью II класса или III класса по классификации сердечной недостаточности Ассоциации кардиологов Нью-Йорка (АКН) на момент начала введения. В другом варианте осуществления настоящего изобретения сердечный индекс субъекта составляет примерно 1,8-2,5 л/мин/м на момент начала введения. В еще одном другом варианте осуществления настоящего изобретения фракция выброса левого желудочка (ФВЛЖ) у субъекта составляет примерно 35% или меньше на момент начала введения. В другом варианте осуществления настоящего изобретения систолическое кровяное давление у субъекта составляет примерно 85 мм Hg или больше на момент начала введения. В еще одном другом варианте осуществления настоящего изобретения систолическое кровяное давление у субъекта составляет примерно 85-125 мм Hg на момент начала введения. В другом варианте осуществления настоящего изобретения релаксин (например, рекомбинантный, очищенный или синтетический) является релаксином Н2 человека (или в других вариантах осуществления настоящего изобретения релаксин H1 человека или релаксин Н3 человека). В другом варианте осуществления настоящего изобретения релаксин является агонистом релаксина. В другом варианте осуществления настоящего изобретения релаксин вводят в фиксированной дозе примерно 10-960 (например, примерно 10, 30, 100, 240, 480 или 940) мкг/кг/сутки (без предварительного титрования). В другом варианте осуществления настоящего изобретения релаксин вводят в фиксированной дозе примерно 240-960 (например, примерно 240, 480 или 940) мкг/кг/сутки (без предварительного титрования). В другом варианте осуществления настоящего изобретения релаксин вводят используя способ доставки, выбранный из группы, состоящей из внутривенного, внутримышечного и подкожного введения (или внутрикожного, подъязычного, ингаляционного введения или использования пригодного для ношения инфузионного насоса). В другом варианте осуществления настоящего изобретения релаксин вводят инфузией на протяжении периодов времени, выбранных из группы, состоящей по меньшей мере примерно из 4, 8, 12, 24 и 48 ч. В еще одном другом варианте осуществления настоящего изобретения введение представляет непрерывное введение релаксина. В еще одном другом варианте осуществления настоящего изобретения релаксин вводят инъекцией с частотой, выбранной из группы, включающей частоту введения трижды в сутки, дважды в сутки, ежедневно, три раза в неделю, два раза в неделю, раз в неделю, раз в две недели и раз в месяц. В другом варианте осуществления настоящего изобретения введение представляет прерывистое введение релаксина. В другом варианте осуществления настоящего изобретения введение не приводит к побочному эффекту, выбранному из группы, состоящей из гипотонии, тахикардии, аритмии и ухудшенной функции почек. В другом варианте осуществления настоящего изобретения введение дополнительно приводит к снижению одного или нескольких из следующих показателей: системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления, азота мочевины крови, креатинина и циркулирующего N-концевого прогормона мозгового натрийуретического пептида. В другом варианте осуществления настоящего изобретения субъект получает одно или несколько из следующих средств: антитромбоцитарный агент, бета-блокатор, диуретик и антиангиотензивную терапию (ингибитор ангиотензин-конвертирующего фермента или блокатор рецептора ангиотензина) на момент начала введения. В еще одном другом варианте осуществления настоящего изобретения у субъекта нет острой сердечной недостаточности, требующей госпитализации на момент начала введения.

Краткое описание фигур

Настоящее описание будет наилучшим образом понято, если его текст сопровождается фигурами, иллюстрирующими предпочтительные варианты осуществления настоящего изобретения. Очевидно, что сущность настоящего изобретения не ограничивается специфическими вариантами его осуществления, описанными в фигурах.

Фиг.1А показывает пептидный гормон релаксина Н2, который схож по размеру и форме с инсулином. Фигура 1Б предусматривает аминокислотную последовательность цепи В (SEQ ID NO:1) и цепи А (последовательность SEQ ID NO:2, в которой Х представляет глутаминовую кислоту [Е] или глутамин [Q]), молекулы релаксина 2 человека (Н2).

Фиг.2 иллюстрирует предполагаемый механизм действия релаксина. Рецепторы релаксина LGR7 и LGR8 связывают релаксин, который активирует матриксные металлопротеиназа (matrix metalloproteinases - ММР) ММР-2 и ММР-9 для конверсии эндотелина-1 в усеченный эндотелии-1 (1-32), который в свою очередь связывается с рецептором эндотелина В (рецептором ЕТв). В результате индуцируется синтаза оксида азота (nitric oxide synthase - NOS) для выработки оксида азота (NO), который повышает расширение кровеносных сосудов.

Фиг.3 показывает просвет кровеносных сосудов. Стрелки указывают на клетки гладкой мускулатуры (ГМ) и эндотелия (Э). Рецепторы релаксина расположены на клетках гладкой мускулатуры кровеностных сосудов (системных и почечной сосудистой сети).

Фиг.4 показывает сердечный индекс и релаксин. График отражает инфузию (черные столбцы) и постинфузию (белые столбцы) в течение 24 ч (каждая). Вертикальные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки). * Р<0,05 относительно исходного уровня.

Фиг.5 показывает частоту сердечных сокращений и релаксин. График отражает инфузию (черные столбцы) и постинфузию (белые столбцы) в течение 24 ч (каждая). Вертикальные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки).

Фиг.6 показывает системное сосудистое сопротивление и релаксин. График отражает инфузию (черные столбцы) и постинфузию (белые столбцы) в течение 24 ч (каждая). Вертикальные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки). * Р<0,05 относительно исходного уровня.

Фиг.7 показывает давление заклинивания в капиллярах легочной артерии и релаксин. График отражает инфузию (черные столбцы) и постинфузию (белые столбцы) в течение 24 ч (каждая). Вертикальные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки). * Р<0,05 относительно исходного уровня.

Фиг.8 показывает систолическое кровяное давление и релаксин. График отражает инфузию (черные столбцы) и постинфузию (белые столбцы) в течение 24 ч (каждая). Вертикальные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки). * Р<0,05 относительно исходного уровня.

Фиг.9 показывает плазматический NT-pro-BNP и релаксин. График отражает инфузию в течение 24 ч (черные значки) и постинфузию в течение 24 ч и на 9 сутки (белые значки). Вертикальные пунктирные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки). * Р<0,05 относительно исходного уровня.

Фиг.10 показывает сывороточный креатинин и релаксин. График отражает инфузию (черные столбцы) и постинфузию (белые столбцы) в течение 24 ч (каждая). Вертикальные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки). * Р<0,05 относительно исходного уровня.

Фиг.11 показывает давление в правом предсердии, легочное сосудистое сопротивление и релаксин. График отражает инфузию (черные столбцы) и состояние после инфузии (белые столбцы) в течение 24 ч (каждая). Вертикальные линии отмечают повышение дозировки в группах А и Б каждые 8 ч. В группе В получают постоянную дозу (все дозы в мкг/кг/сутки). * Р<0,05 относительно исходного уровня.

Фиг.12 показывает стабильное снижение систолического кровяного давления (СКД) у субъектов с гипертонией и нормотонией в клиническом исследовании релаксина у пациентов с системным склерозом. Снижение кровяного давления у пациентов, у которых в начале исследования была гипертония, было больше, чем снижение кровяного давления у пациентов, у которых в начале исследования была нормотония. Снижение кровяного давления было стабильным на протяжении шести месяцев непрерывного дозирования. Ни у одного из пациентов не развилась гипотония во время дозирования.

Фиг.13 показывает стабильное улучшение функции почек, измеренное в качестве прогнозированного очищения креатинина (creatinine clearance - CrCl), на протяжении шести месяцев непрерывного дозирования релаксина, но не с плацебо, у пациентов с системным склерозом.

Подробное описание изобретения

Общий обзор

Настоящее изобретение предусматривает способы поддержания сердечной недостаточности (СН) у пациентов на стадии компенсации. Установлено, что релаксин оказывает положительное воздействие на пациентов с СН, судя по улучшению маркеров функции почек (например, по снижению азота мочевины в крови, повышению клиренса креатинина), сердечного индекса и по снижению системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления и циркулирующего N-концевого прогормона мозгового натрийуретического пептида. Кроме того, релаксин имеет дополнительные преимущества, которые не возникают при лечении современными лекарственными средствами, включая пониженный риск гипотонии и тахикардии на протяжении лечения. Важно, что отсутствовали клинические побочные эффекты от введения релаксина во всем диапазоне применяемых доз в пилотном исследовании, описанном в примере 1 (Dschietzig и др., J Cardiac Fail, 15, 2009, с.182-190).

Определения

Понятие «релаксин» относится к пептидному гормону, хорошо известному в данной области (см. фиг.1). Понятие «релаксин» в настоящем изобретении охватывает релаксин человека, включая интактную полной длины молекулу релаксина человека или часть молекулы релаксина, которая сохраняет биологическое действие. Понятие «релаксин» охватывает H1 препрорелаксин, прорелаксин и релаксин; Н2 препрорелаксин, прорелаксин и релаксин; и Н3 препрорелаксин, прорелаксин и релаксин человека. Понятие «релаксин» также включает релаксин биологического действия (также называемый в настоящем изобретении «фармацевтически действующим») из рекомбинантных, синтетических или нативных источников, а также варианты релаксина, например, варианты аминокислотной последовательности. По существу понятие представляет синтетический релаксин человека и рекомбинантный релаксин человека, включая синтетический релаксин H1, H2 и Н3 человека и рекомбинантный релаксин H1, H2 и Н3 человека. Понятие дополнительно включает действующие агенты с действием, подобным действию релаксина, например, агонисты релаксина и/или аналоги релаксина и их части, которые сохраняют биологическое действие, включая все агенты, которые конкурентно смещают связанный релаксин с рецептором релаксина (например, рецептор LGR7, рецептор LGR8, GPCR135, GPCR142, и т.д.).

Таким образом, фармацевтически эффективный агонист релаксина является каким-либо агентом с действием, подобным действию релаксина, который способен связываться с рецептором релаксина для индукции релаксин-подобного ответа. Кроме того, последовательность нуклеиновой кислоты релаксина человека, применяемая в настоящем изобретении, не должны быть на 100% идентична последовательности нуклеиновой кислоты релаксина человека (например, H1, H2 и/или Н3), но может быть по меньшей мере примерно на 40%, 50%, 60%, 65%, 66%, 67%, 68%, 69%. 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%. 86%. 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична последовательности нуклеиновой кислоты релаксина человека. Релаксин в контексте настоящего изобретения может быть получен каким-либо методом, известным специалистам в данной области.

Примеры таких методов описаны, например, в US 5759807, а также в публикации Bullesbach и др.. The Journal of Biological Chemistry 266(17), 1991, сс.10754-10761. Примеры молекул релаксина и аналогов показаны, например, в US 5166191. Природный биологического действия релаксин может быть получен от людей, грызунов (т.е. крыс или мышей), свиней или других млекопитающих. К настоящему изобретению также относится релаксин, модифицированный для повышения периода полураспада in vivo, например, пэгелированный релаксин (т.е. релаксин, конъюгированный с полиэтиленгликолем), модификации аминокислот в релаксине, которые являются объектами для расщепления разрушающими ферментами, и др. Понятие также охватывает релаксин, включающий цепи А и В с N- и/или С-концевыми усечениями. В общем, в релаксине H2 цепь А может варьировать от А(1-24) до А(10-24) и цепь В может варьировать от В(1-33) до В(10-22); и в релаксине H1 цепь А может варьировать от А(1-24) до AQO-24) и цепь В может варьировать от В(1-32) до В(10-22).

Понятие «релаксин» также относится к другим инсерциям, замещениям или делециям одного или нескольких аминокислотных остатков, гликозилированным вариантам, негликозилированному релаксину, органическим и неорганическим солям, ковалентно модифицированным производным релаксина, препрорелаксина и прорелаксина. К понятию «релаксин» также относится аналог релаксина с аминокислотной последовательностью, отличающейся от последовательности дикого типа (например, природной), включая, но ими не ограничиваясь, аналоги релаксина, описанные в US 5811395. Возможные модификации аминокислотных остатков релаксина включают ацетилирование, формилирование или сходную защиту свободных аминогрупп, включая N-концевые, амидирование С-концевых групп или формирование сложных эфиров гидроксильных или карбоксильных групп, например, модификация остатка триптофана (Trp) в В2 добавлением формильной группы. Формильная группа представляет типичный пример легкоудаляемой защитной группы. К другим возможным модификациям относятся замещение одной или нескольких природных аминокислот в цепях В и/или А на разные аминокислоты (включая D-форму природной аминокислоты), включая, но ими не ограничиваясь, замещение части молекулы Met в В24 на норлейцин (Nie), валин (Val), аланин (Ala), глицин (Gly), серии (Ser) или гомосерин (HomoSer).

К другим возможным модификациям относятся делеция природной аминокислоты из цепи или добавление одной или нескольких дополнительных аминокислот в цепи. К дополнительным модификациям относятся аминокислотные замещения в В/С и С/А соединениях прорелаксина, причем указанные модификации облегчают расщепление цепи С прорелаксина, и вариант релаксина, включающий неприродный пептид С, например, описанный в US 5759807. К понятию «релаксин» также относятся гибридные полипептиды, включающие релаксин и гетерологичный полипептид. Гибридный партнер гетерологичного полипептида (например, полипептид, не являющийся релаксином) может быть С-концевым или N-концевым по отношению к части релаксина в гибридном белке. Гетерологичные полипептиды включают иммунологически выявляемые полипептиды (например, «метки эпитопа»); полипептиды, способные вырабатывать выявляемый сигнал (например, зеленый флуоресцирующий белок, ферменты, например, щелочную фосфатазу, и другие известные в этой области); терапевтические полипептиды, включая, но ими не ограничиваясь, цитокины, хемокины и факторы роста. Все такие вариации или изменения в структуре молекулы релаксина, в результате которых формируются варианты, включены в рамки охвата настоящего изобретения, поскольку функциональное (биологическое) действие релаксина поддерживается. Предпочтительно, какая-либо модификация аминокислотной последовательности или структуры релаксина не повышает его иммуногенности у индивидуума, которого лечат вариантом релаксина. Такие варианты релаксина, обладающие описанным биологическим действием, могут быть легко идентифицированы методами in vitro и in vivo, известными в данной области.

Понятие «сердечная недостаточность» обычно означает, что сердце не работает должным образом. Сердечная недостаточность (СН) наблюдается в тех случаях, когда сердечная мышца не может соответствовать потребностям организма в соответствующем кровотоке. Это синдром, т.е. совокупность показателей, которые могли возникнуть по ряду причин. СН может быть вызвана ослаблением сердечной мышцы (т.е. кардиомиопатией), и сердце становится неспособным нагнетать достаточное количество крови. СН также называется застойной СН, поскольку жидкости обычно накапливаются в организме, что приводит к застою. Кроме СН, вызванной ослаблением сердца, имеются также другие варианты СН. К ним относятся варианты СН, соответствующие организму, потребности которого слишком высоки даже для нормального сердца, например, в некоторых случаях заболевания щитовидки, которая вырабатывает слишком много тиреоидного гормона, у пациентов с анемией, или при нескольких других состояниях; и СН из-за нейрогормонального дисбаланса, который в итоге приводит к острым эпизодам одышки, или из-за других острых состояний, например, гипертонии, высокого кровяного давления, аритмии, пониженного кровотока в почках, почечной недостаточности и тяжелых летальных случаев. Если ранее у пациента была диагностирована СН, указанные выше случаи могут изменить состояние пациента с хронической СН на острую декомпенсированную сердечную недостаточность (ОСН) и/или острую сосудистую недостаточность. ОСН обычно может потребовать госпитализации или внеплановой медицинской помощи для выведения пациента из декомпенсированного состояния в компенсированное.

Понятия «компенсированная хроническая сердечная недостаточность» и «компенсированная хроническая СН» взаимозаменяемы и описывают контролируемую застойную сердечную недостаточность, обычно приводящую к нормальному минутному сердечному выбросу, который обычно достигается медицинским вмешательством. Несмотря на нормальный минутный сердечный выброс, это состояние ненормально и при нем поврежденное сердце поддерживает на достаточном уровне минутный сердечный выброс за счет компенсаторных механизмов. В результате компенсированная хроническая СН обычно представляет прогрессирующее заболевание и главная цель медицинского вмешательства заключается в максимизации состояния стабильной компенсированной хронической СН с минимальными побочными эффектами.

Понятия «острая сердечная недостаточность (ОСН)» и «острая декомпенсированная сердечная недостаточность», используемые в настоящем изобретении, проявляются по наличию всех следующих признаков: одышки в спокойном состоянии или при минимальном напряжении, застоя в легких при рентгене грудной клетки и повышенных уровней натрийуретического пептида [натрийуретического пептида мозга (brain natriuretic peptide - BNP)≥350 пг/мл или NT-pro-BNP≥1400 пг/мл].

Понятия «острая сердечная декомпенсация» и «острая декомпенсация» в настоящем изобретении используют взаимозаменяемо и назначают в настоящем описании и формуле неспособность сердечной мышцы компенсировать системное и почечное сужение сосудов из-за нейрогормонального дисбаланса в организме. Острая сердечная декомпенсация характеризуется измененной сердечной функцией и измененной регуляцией жидкости, что приводит к началу гемодинамической нестабильности и к физиологическим изменениям (особенно к застою и отеку), а также к симптомам сердечной недостаточности (обычно к одышке). Эта форма функциональной декомпенсации может быть диагностирована ошибочно в виде формы, вызванной дефектом клапана или миокарда (т.е. структурного дефекта), хотя обычно она не связана с гипотонией. Однако «острая сердечная декомпенсация» в контексте настоящего изобретения означает функциональную декомпенсацию, которая часто ассоциирована с одним или несколькими определенными признаками декомпенсации, к которым относятся, но которыми перечень не ограничивается, одышка, гипертония, высокое кровяное давление, аритмия, пониженный кровоток почек, почечная недостаточность и смертность. У пациентов с «острой сердечной декомпенсацией», указанных в настоящем изобретении, обычно имеется застойная или хроническая сердечная недостаточность, но она ранее не была диагностирована. У таких пациентов может быть история сердечного заболевания или она полностью отсутствует.

Понятие «сосудистая сеть» относится к сети кровеносных сосудов в органе или части тела, включая артерии и капилляры.

Понятие «сбалансированное сужение сосудов» в настоящем описании и формуле изобретения означает двойное сжатие сосудов, имеющихся в системной (преимущественно артериальной) и почечной сосудистой сети в качестве результата связывания релаксина или агониста релаксина со специфическими рецепторами релаксин (см. ниже подробное описание).

Понятия «нейрогормональный дисбаланс» и «нейрогуморальный дисбаланс» используют в настоящем изобретении взаимозаменяемо, и они относятся к гормональным нарушениям в организме, которые могут привести к сердечной недостаточности. Например, чрезмерная передача сигнала через Gs-связанные адренергические или Gq-связанные ангиотензивные метаболические пути может вызвать нейрогормональный дисбаланс. В обоих случаях чрезмерная нейрогуморальная передача сигнала может вызвать, а также повысить, функциональную декомпенсацию (см. Schrier и др., The New England Journal of Medicine 341(8), 1999, с.577-585). Кроме того, чрезмерная нейрогуморальная передача сигнала может вызвать, а также повысить острую сосудистую недостаточность.

Понятие «избыток жидкости» в контексте настоящего изобретения относится к состоянию, которое наблюдается при слишком большом содержании воды в крови. Избыток жидкости (гиперволемия) обычно наблюдают при сердечной недостаточности, которая может вызвать избыток жидкости путем активирования системы ренина-ангиотензина-альдостерона. Такая жидкость, преимущественно состоящая из соли и воды, накапливается в разных местах и приводит к увеличению массы, отеку ног и рук (периферический отек) и/или брюшной полости (асцит). В конечном счете, жидкость поступает в воздухоносные полости легких, снижает количество кислорода, поступающего в кровь, и вызывает учащенное дыхание (одышку). Жидкость может также скопиться в легких ночью при положении лежа и может затруднить в ночное время дыхание и сон (ночная пароксизмальная одышка). Избыток жидкости - один из наиболее выраженных признаков застойной СН.

Понятие «сердечная аритмия» означает состояние, при котором сокращение сердечной мышцы становится нерегулярным. Необычно быстрый ритм (более 100 ударов в мин) называют тахикардией. Необычно медленный ритм (менее 60 ударов в мин) называют брадикардией.

Понятие «сердечная ишемия» означает, что ток крови к сердечной мышце (миокарду) прегражден за счет частичной или полной блокады коронарной артерии. Внезапная тяжелая блокада может привести к сердечному приступу (инфаркту миокарда). Сердечная ишемия также может вызвать серьезное нарушение сердечного ритма (аритмию), которая может вызвать потерю сознания и в тяжелых случаях - смерть.

Понятие «патофизиологическое» относится к нарушению нормальной механической, физической или биохимической функции, либо вызванному заболеванием, либо возникающему из-за заболевания или отклоняющегося от нормы синдрома или состояния, которое нельзя квалифицировать в качестве заболевания. Понятие «патофизиология» означает исследование биологических и физических проявлений заболевания, поскольку они коррелируют с лежащими в основе нарушениями и физиологическими расстройствами.

Понятие «оксид азота (NO)» в настоящем изобретении относится к важным сигнальным молекулам, участвующим во многих физиологических и патологических процессах в организме млекопитающего, в том числе человека. NO может действовать в качестве сосудорасширяющего средства, которое расслабляет гладкие мышцы кровеносных сосудов, что приводит к их расширению. Расширение артериальных сосудов (преимущественно артериол) приводит к снижению кровяного давления. Предполагают, что релаксин вызывает по меньшей мере некоторое расширение сосудов за счет NO. В этом случае релаксин связывается со специфическими рецепторами релаксина, например, рецепторами LGR7 и LGR8 на клетках гладких мышц сосудистой сети, которые в свою очередь активируют каскад эндотелина для активации синтазы оксида азота (nitric oxide synthase - NOS) для выработки оксида азота (NO) (см. фиг.2).

Понятие «сердечный индекс (СИ)» означает количество крови, которое выбрасывает левый желудочек в кровеносную систему за минуту, выраженное в литрах в минуту (л/мин). Это вазодинамический параметр, который связывает сердечный индекс с площадью поверхности тела (ППТ) и таким образом связывает работу сердца с размером индивидуума, в результате получают величину, выраженную в единицах измерения литры в минуту на квадратный метр (л/мин/м).

Понятия «ОСН (острая сердечная недостаточность)» и «острая декомпенсированная сердечная недостаточность» в контексте настоящего изобретения определяют при осмотре по наличию всех следующих признаков: одышки в спокойном состоянии или при минимальном напряжении, застоя в легких при рентгене грудной клетки и повышенных уровнях натрийуретического пептида [натрийуретического пептида мозга (brain natriwetic peptide - BNP)≥350 пг/мл или NT-pro-BNP≥1400 пг/мл].

Понятие «одышка» относится к тяжелому или затрудненному дыханию. Это признак различных расстройств и первоначально является показателем ненадлежащей вентиляции легких или недостаточного количества кислорода в циркулирующей крови. Понятие «ортопное» относится к тяжелому или затрудненному дыханию в положении лежа, которое проходит при принятии вертикального положения (сидя или стоя, которое перпендикулярно положению лежа).

Клинические исследования и практические рекомендации обычно характеризуют гипертонию по систолическому кровяному давлению (СКД), превышающему примерно 140 мм Hg, нормальное кровяное давление составляет величину СКД ниже примерно 140 мм Hg, 130 мм Hg или 120 мм Hg, в зависимости от определенного исследования или руководства. В контексте острой сердечной недостаточности или другого сердечного заболевания гипотония может быть определена в качестве СКД ниже примерно 110 мм Hg, 100 мм Hg, или 90 мм Hg. В некоторых предпочтительных вариантах осуществления настоящего изобретения фраза «нормотоническое или гипертоническое состояние» относится к СКД выше 125 мм Hg во время проведения исследования или введения релаксина.

В контексте настоящего изобретения фраза «ухудшенная функция почек» означает примерную скорость клубочковой фильтрации (пСКФ) 30-75 мл/мин/1,72 м2, рассчитанную с применением уравнения упрощенной модификации диеты при заболевании почек (уМДЗП).

Понятие «плацебо» относится к физиологически инертному лечению, которое часто сравнивают в клинических исследованиях с физиологически действующим лечением. Эти исследования обычно проводят в виде двойных слепых исследований и ни лечащий врач, ни пациенты не знают, получают ли они действующее лекарственное средство или вещество без какого-либо четкого фармацевтического действия (плацебо). Установлено, что у пациента, получающего физиологически инертное лечение, может проявиться улучшение состояния, если этот пациент верит, что он получает физиологически действенное лечение (эффект плацебо). Таким образом, включение плацебо в исследование подтверждает, что статистически значимый положительный эффект связан с физиологически действенным лечением, а не является просто результатом эффекта плацебо.

Понятие «повторная госпитализация» означает повторное помещение в госпиталь на протяжении определенного периода времени после первоначального лечения. Период времени обычно зависит от типа лечения и состояния пациента.

В контексте настоящего изобретения понятие «смерть от сердечно-сосудистого заболевания» относится к смерти, которая происходит главным образом из-за причины, связанной с сердечно-сосудистым состоянием, например, смерти от удара, острого инфаркта миокарда, не поддающейся лечению застойной сердечной недостаточности и какой-либо внезапной смерти.

Понятие «петлевой диуретик» означает лекарственное средство, используемое пациентами с застойной сердечной недостаточностью или почечной недостаточностью для снижения симптомов гипертонии и отека. Петлевой диуретик принадлежит к классу диуретиков, снижающих повторное всасывание натрия и хлора в почках, в результате чего повышается секреция мочи.

Понятие «примерно» в контексте установленной величины включает диапазон, отличающийся до величины 10% выше или ниже относительно установленной величины (например, 90-110% от установленной величины). Например, скорость внутривенной инфузии, составляющая примерно 30 мкг/кг/сутки, включает скорости внутривенной инфузии 27-33 мкг/кг/сутки.

Понятие «терапевтически эффективное» относится к количеству фармацевтически действующего релаксина, которое может привести к измеряемому требуемому медицинскому или клиническому положительному эффекту для пациента по сравнению с исходным состоянием субъекта или с состоянием при отсутствии лечения или при лечении плацебо (например, при отсутствии лечения релаксином).

Релаксин

Релаксин является пептидным гормоном, который близок по размеру и форме инсулину (см. фиг.1). Точнее релаксин является эндокринным и аутокринным/паракринным гормоном, который относится к надсемейству гена инсулина. Действующая форма кодированного белка состоит из цепи А и цепи В, связанных вместе дисульфидными связями, двумя внутрицепочечными и одной внецепочечной. Таким образом, структура близка инсулину по расположению дисульфидных связей. У людей известно три неаллельных гена релаксина, релаксина-1 (RLN-1 или H1), релаксина-2 (RLN-2 или Н2) и релаксина-3 (RLN-3 или Н3). У H1 и Н2 высокая гомология последовательностей. Имеется два по-разному сплайсированных варианта транскрипта, кодирующих разные изоформы, описанные для этого гена. H1 и Н2 по разному экспрессируются в репродуктивных органах (см. US 5023321 и Garibay-Tupas и др.. Molecular and Cellular Endocrinology 219, 2004, с.115-125), но Н3 обнаруживают преимущественно в мозге. Эволюция семейства релаксиновых пептидов в связи с их рецепторами в целом известна в данной области (см. Wilkinson и др., ВМС Evolutionary Biology 5(14), 2005, с.1-17; кн.; Wilkinso, Bathgate, «Relaxin and Related Peptides», 2007, глава 1, изд-во Landes Bioscience and Springer Science + Business Media).

Релаксин активирует специфические рецепторы релаксина, т.е. LGR7 (RXFP1) и LGR8 (RXFP2), а также GPCR135 и GPCR142. LGR7 и LGR8 являются обогащенными лейцином повторами, G белок-связанными рецепторами (G protein-coupled receptor - LGR), которые представляют уникальную подгруппу G белок-связанных рецепторов. Они содержат трансмембранный домен из семи спиралей и крупный гликозилированный эктодомен, отдаленно связанные с рецепторами гликопротеогормонов, например LH-рецептором или FSH-рецептором. Эти рецепторы релаксина обнаружены в сердце, гладких мышцах, соединительной ткани и в центральной и автономной нервной системе. Мощные релаксины, например релаксины H1 и Н2 свиньи и кита, имеют общую последовательность, т.е. последовательность Arg-Glu-Leu-Val-Arg-X-X-Ile или связывающую кассету. Эти релаксины активируют рецепторы LGR7 и LGR8. Релаксины, которые имеют отличия по гомологии последовательности, например, релаксины крысы, акулы, собаки и лошади, демонстрируют снижение биологической активности через рецепторы LGR7 и LGR8 (см. Bathgate и др., Ann. N.Y. Acad. Sci. 1041, 2005, с.61-76). Однако, будучи сходным с релаксином Н2, релаксин Н3 активирует рецептор LGR7 (см. Satoko и др., The Journal of Biological Chemistry 278(10), 2003, с.7855-7862). Кроме того установлено, что Н3 активирует рецептор GPCR135 (см. Van der Westhuizen, Ann. N.Y. Acad. Sci. 1041, 2005, сс.332-337) и рецептор GPCR142. Рецепторы GPCR135 и GPCR142 являются двумя структурно связанными G-белок-связанными рецепторами. Мышиный и крысиный GPCR135 проявляют высокую гомологию (т.е. более 85%) по отношению к GPCR135 человека и имеют весьма близкие фармакологические свойства со свойствами GPCR135 человека. Мышиный и человеческий, а также крысиный релаксин-3 связывается и активирует GPCR135 мыши, крысы и человека с высоким сродством. Напротив, GPCR142 мыши меньше сохранился (т.е. гомология 74%) относительно GPCR142 человека. Гены GPCR142 обезьяны, коровы и свиньи клонируют и показано, что они высоко гомологичны (т.е. более 84%) GPCR142 человека. Фармакологическое описание GPCR142 разных видов показывает, что релаксин-3 связывается с GPCR142 разных видов с высоким сродством (см. Chen и др., The Journal of Pharmacology и Experimental Therapeutics 312(1), 2005, с.83-95).

Релаксин обнаружен и у мужчин, и у женщин (см. Tregear и др. в кн.: «Relaxin 2000», Труды третьего международного симпозиума по релаксину и родственным пептидам, 22-27 октября 2000, Broome, Австралия). У женщин релаксин вырабатывается желтым телом яичника, грудью и, во время беременности, также плацентой, хорионом и отпадающей плацентой. У мужчин релаксин вырабатывается в семенниках. Уровни релаксина повышаются после овуляции в качестве результата его выработки желтым телом, и его пик достигается на протяжении первого триместра, а не к концу беременности. Если беременности нет, его уровень снижается. У людей релаксин действует при беременности, повышает подвижность сперматозоидов, регулирует давление крови, контролирует частоту сердечных сокращений и высвобождает окситоцин и вазопрессин. У животных релаксин расширяет лобковую кость, облегчает роды, смягчает шейку матки (созревание шейки) и расслабляет мускулатуру матки. У животных релаксин также влияет на метаболизм коллагена, ингибируя синтез коллагена и повышая его разрушение за счет повышения металлопротеиназ матрикса. Он также повышает ангиогенез и является почечным вазодилатором.

Основным свойством релаксина является его принадлежность к ростовым факторам, и он может изменять природу соединительной ткани и влиять на сокращение гладких мышц. Полагают что H1 и Н2 преимущественно экспрессируются в репродуктивной ткани, хотя известно, что Н3 преимущественно экспрессируются в мозге (см. выше). Однако в ходе создания настоящего изобретения Н2 и Н3 играют важную роль в сердечно-сосудистом и сердечно-почечном функционировании и может таким образом применяться для лечения ассоциированных заболеваний. H1 может использоваться сходным образом, поскольку он является гомологом Н2. Кроме того, фармацевтически эффективные агонисты релаксина с релаксинподобным действием способны активировать рецепторы релаксина для индукции релаксинподобного ответа.

Агонисты релаксина

В некоторых вариантах осуществления настоящего изобретения в описании предусматривают способы лечения пациентов, у которых диагностирована хроническая сердечная недостаточность, включающая введение агониста релаксина. В некоторых способах агонист релаксина активирует один или несколько близких релаксину связанных с G-белком-связанных рецепторов (G-protein coupled receptors - GPCR), выбранных из RXFP1, RXFP2, RXFP3, RXFP4, FSHR (LGR1), LHCGR (LGR2), TSHR (LGR3), LGR4, LGR5, LGR6 LGR7 (RXFP1) и LGR8 (RXFP2), но ими перечень не ограничивается. В некоторых вариантах осуществления настоящего изобретения агонист релаксина включает последовательность формулы I из патентной заявки WO 2009/007848 (включенной в настоящее изобретение в виде ссылки для представления последовательностей агонистов релаксина).

Пептиды формулы I содержат предпочтительно 7-100 аминокислот в длину и включают аминокислотную последовательность: X1-Х2-Х3-Х4-Х5-Х6-Х7-Х8-Х9-Х10-X11-Х12-Х13-Х14-Х15-Х16-Х17-Х18-Х19-Х20-Х21-Х22-Х23-Х24-Х25-Х26-Х27-Х28-Х29-Х30-Х31-Х32-Х33; где X1 отсутствует или означает G, или низкомолекулярную природную, или неприродную аминокислоту; Х2 отсутствует или означает Q, или полярную природную, или неприродную аминокислоту; Х3 отсутствует или означает К, или основную природную, или неприродную аминокислоту; Х4 отсутствует или означает G, или низкомолекулярную природную, или неприродную аминокислоту; Х5 отсутствует или означает Q, или S, полярную природную, или неприродную аминокислоту; Х6 отсутствует или означает V, или А, или Р, или М, или полярную природную, или неприродную аминокислоту; Х7 отсутствует или означает G, или низкомолекулярную природную, или неприродную аминокислоту; Х8 отсутствует или означает Р, или L, или А, природную или неприродную аминокислоту; Х9 отсутствует или означает Р, или Q, природную или неприродную аминокислоту; Х10 отсутствует или означает G, или низкомолекулярную природную, или неприродную аминокислоту; X11 отсутствует или означает А, или Н, или Е, или D, или гидрофобную, или низкомолекулярную, или кислую природную, или неприродную аминокислоту; Х12 отсутствует или означает А, или Р, или Q, или S, или R, или Н, или гидрофобную, или низкомолекулярную природную, или неприродную аминокислоту; Х13 отсутствует или означает С, или V, или гидрофобную природную, или неприродную аминокислоту; Х14 отсутствует или означает R, или К, или Q, или Р, или основную, или полярную природную, или неприродную аминокислоту; Х15 отсутствует или означает R, или Q, или S, или основную, или полярную природную, или неприродную аминокислоту; Х16 отсутствует или означает А, или L, или Н, или Q, или гидрофобную, или низкомолекулярную природную, или неприродную аминокислоту; Х17 отсутствует или означает Y, или гидрофобную, или ароматическую природную, или неприродную аминокислоту; X18 отсутствует или означает А, или гидрофобную, или низкомолекулярную природную, или неприродную аминокислоту; X19 отсутствует или означает А, или гидрофобную низкомолекулярную природную, или неприродную аминокислоту; Х20 отсутствует или означает F, или гидрофобную, или ароматическую природную, или неприродную аминокислоту; Х21 отсутствует или означает S, или Т, или полярную природную, или неприродную аминокислоту; Х22 отсутствует или означает V, или гидрофобную природную, или неприродную аминокислоту; Х23 отсутствует или означает G, или гидрофобную, или низкомолекулярную неприродную аминокислоту, или замещен амидом; Х24 отсутствует, или означает R, или основную природную, или неприродную аминокислоту; Х25 отсутствует, или означает R, или основную природную, или неприродную аминокислоту; Х26 означает А, или гидрофобную, или низкомолекулярную природную, или неприродную аминокислоту; Х27 означает Y, или гидрофобную, или ароматическую природную, или неприродную аминокислоту; Х28 означает А, или гидрофобную, или низкомолекулярную природную, или неприродную аминокислоту; Х29 означает А, или гидрофобную, или низкомолекулярную природную, или неприродную аминокислоту; Х30 означает F, или гидрофобную природную, или неприродную аминокислоту; Х31 означает S, или Т, или полярную природную, или неприродную аминокислоту; Х32 означает V, или гидрофобную природную, или неприродную аминокислоту; Х33 отсутствует или означает G, или гидрофобную, или низкомолекулярную природную, или неприродную аминокислоту, или замещен на амид; или его фармацевтически приемлемую соль (SEQ ID NO: 4). В некоторых вариантах осуществления настоящего изобретения агонист релаксина представляет последовательность пептида P59C13V (свободная кислота) GQKGQVGPPGAA VRRA Y AAFSV (SEQ ID NO: 5). В другом предпочтительном варианте осуществления настоящего изобретения агонист релаксина представляет последовательность пептида P74C13V (свободная кислота) GQKGQVGPPGAA VRRA Y AAFS VGRRA Y AAFS V (SEQ DD NO: 6). Другие производные комплемент C1Q фактор некроза опухоли-родственного белка 8 (CTRP8 или C1QT8), например, пептид P59-G (свободная кислота Gly) GQKGQVGPPGAACRRA Y AAFSVG (SEQ ID NO: 7), также могут быть пригодны для применения в способах по настоящему изобретению. Аминокислотная последовательность C1QT8 представлена далее в виде последовательности SEQ ID NO:8

MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDL

WRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQV

GPPGAACRRAYAAFSVGRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGA

FDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSV

MQAQSLMLLLAAGDAVWVRMF QRDRDNAIYGEHGDLYITFSGHLVKP AAEL.

Настоящее изобретение также охватывает гомологи этих полипептидом, такие гомологи могут быть по меньшей мере на 50%, по меньшей мере на 55%, по меньшей мере на 60%, по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или на 100% идентичны аминокислотной последовательности типичного агониста релаксина (например, SEQ ID NO:5 или SEQ ID NO:6), что можно определить, используя программное обеспечение BlastP Национального центра биотехнологической информации (National Center of Biotechnology Information -NCBI), используя параметры по умолчанию, необязательно и предпочтительно включая следующие: фильтрация (эта опция фильтрует повторяющиеся или мало отличающиеся последовательности по запросу, используя программу Seg (белок)), матрицей оценки является BLOSUM62 для белков, размер слова равен 3, величина Е составляет 10, цены гэпов составляют 11,1 (инициализация и (инициализация и удлинение). Необязательно и предпочтительно идентичность/гомологию последовательности нуклеиновой кислоты определяют с помощью программного обеспечения BlastN Национального центра биотехнологической информации (NCBI), используя параметры по умолчанию, которые предпочтительно включают применение фильтрующей программы DUST, а также предпочтительно включают наличие величины Е, равной 10, фильтрацию мало усложненных последовательностей и размер слова 11. В заключении, настоящее изобретение также предусматривает фрагменты описанных выше полипептидов и полипептиды с мутациями, например, делециями, инсерциями или замещениями одной или нескольких аминокислот, полученными естественным или искусственным путем, случайно или направленно.

Способы лечения

А. Повышение сердечного индекса (СИ)

Для пациентов II класса и III класса по классификации Ассоциацией кардиологов Нью-Йорка (АКН), живущих с хронической компенсированной сердечной недостаточностью, ограничения повседневного качества жизни реально существуют, несмотря на оптимальную стандартную лекарственную терапию. Сердечный индекс (СИ) и минутный сердечный выброс (СВ) понижают у большинства пациентов с хронической СН. Поскольку сердце у таких пациентов не работает оптимально, лекарственные средства используют для компенсации нарушенной работы сердца. Однако современные лекарственные средства имеют побочные эффекты, например гипотонию и почечную токсичность. Напротив, лечение релаксином повышает СИ и СВ у пациентов с хронической компенсированной СН без вредных побочных эффектов. В частности, введение релаксина не повышает у субъекта частоту сердечных сокращений, но понижает системное сосудистое сопротивление без индукции гипотонии или ухудшения функции почек. Наиболее частой причиной сердечной недостаточности является дисфункция систолы левого желудочка, которая вызывает пониженную частоту сердечных сокращений, приводящую к низкой величине СИ и высокому давлению в легочной артерии. Важно, помимо повышения СИ, что было показано, что релаксин снижает давление заклинивания в капиллярах легочной артерии у пациентов с хронической сердечной недостаточностью. Таким образом, релаксин обладает многими свойствами, которые могут быть весьма полезны для пациентов с хронической СН, например, тем, у кого величина СИ ниже нормы. Кроме того, терапевтически эффективное количество релаксина может быть введено в фиксированной дозе без необходимости предварительного титрования. Такая доза обычно составляет примерно 10-960 мкг/кг/сутки. Однако релаксин также может вводиться пациентам с хронической компенсированной сердечной недостаточностью в фиксированной дозе 960 мкг/кг/сутки. Установлено, что эта доза приводит к существенному повышению СИ и снижению давления заклинивания в капиллярах легочной артерии. Релаксин может быть введен внутривенно в течение 8 или 24, или до 48 ч, или на протяжении требуемого длительного периода (например, 7, 14, 21 суток и т.д.). Однако дополнительные пути и схемы доставки также применимы и некоторые из них подробнее описаны в разделе «Введение и режим дозирования» настоящего описания. Помимо указанной пользы для лечения пациентов, которые уже претерпели хирургическое вмешательство на сердце, очевидно, что наиболее важно предупредить такое ремоделирование чтобы замедлить прогрессирования сердечной недостаточности. Таким образом, релаксин может быть полезен для популяции, которая не отвечает на стандартное превентивное лечение, для того, чтобы избежать дальнейшего развития органического заболевания сердца.

Б. Улучшенная функциональная способность

Пациенты с хронической СН, которая представляет заболевание с более выраженной симптоматикой или находящееся на поздней стадии, например III класса и особенно IV класса по классификации Ассоциации кардиологов Нью-Йорка (АКН), обычно только частично поддаются лечению. Симптомы, часто существенные, оказываются устойчивыми несмотря на лечение, а развитие лекарственной устойчивости или побочные эффекты могут дополнительно понизить терапевтический успех проводимого лечения. Для улучшения качества жизни пациентов на поздней стадии сердечной недостаточностью или с устойчивыми симптомами СН в состоянии покоя вмешательство релаксина может быть полезным. Современные вводимые внутривенно инотропы и вазодилаторы, например добутамин, милринон, нитроглицерин, нитропруссид или несиритид, применяемые для лечения пациентов с тяжелыми симптомами СН, включая устойчивые симптомы в состоянии покоя, ограничены в применении для пациентов с хронической компенсированной СН (например, ограниченная эффективность, почечная токсичность, риск возникновения гипотонии или потребность в титровании). Однако терапевтически эффективное количество релаксина может быть введено в фиксированной дозе без необходимости в предварительном титровании. Кроме того, токсичность релаксина для почек не наблюдают у пациентов в широком диапазоне доз. Кроме того, релаксин повышает СИ и СО у пациентов с хронической компенсированной СН без повышения частоты сердечных сокращений и в то же время снижает системное сосудистое сопротивление без индукции гипотонии или ухудшения функции почек. Кроме того, помимо повышения СИ, установлено, что релаксин снижает давление заклинивания в капиллярах легочной артерии у пациентов с хронической сердечной недостаточностью.

Таким образом, релаксин обладает многими свойствами, которые могут быть в значительной степени лечебными для пациентов с хронической СН, включая пациентов на поздней стадии заболевания. Вводимая доза обычно составляет примерно 10-960 мкг/кг/сутки. Однако релаксин также может вводиться пациентам с хронической компенсированной сердечной недостаточностью в фиксированной дозе 960 мкг/кг/сутки. Установлено, что эта доза приводит к существенному повышению СИ и к снижению давления заклинивания в капиллярах легочной артерии. Релаксин может быть введен внутривенно в течение 8 или 24, или до 48 ч, или на протяжении требуемого длительного периода (например, 7, 14, 21 суток и т.п.д.). Однако дополнительные пути и схемы доставки также могут быть применимы и некоторые из них подробно описаны в разделе «Введение и режим дозирования» настоящего описания.

В. Снижение частоты случаев декомпенсации Введение пациентам релаксина со стабильной компенсированной хронической СН (например, пациентам, у которых компенсация достигается за счет установки режима лекарственной терапии), также приводит к дополнительному лечебному результату с повышенным сердечным индексом и со снижением системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления, циркулирующего N-концевого прогормона мозгового натрийуретического пептида и маркеров дисфункции почек (азот мочевины крови и креатинин). Важно, что одновременно с такими полезными свойствами релаксина отсутствует существенный риск гипотонии, тахикардии и/или аритмии в качестве результата лечения релаксином. По существу релаксин может обеспечить стабилизацию и целительное действие по отношению к популяции со стабильной компенсированной хронической СН, в результате снижая риск декомпенсации и понижая частоту случаев декомпенсации, требующих госпитализации. Таким образом, эти отличительные свойства релаксина являются показателем пользы применения релаксина для амбулаторных больных с диагностированной излечиваемой хронической СИ, относящейся ко II классу или к III классу сердечной недостаточности по классификации Ассоциации кардиологов Нью-Йорка (АКН). Введенная доза обычно составляет примерно 10-960 мкг/кг/сутки. Релаксин может быть введен внутривенно в течение 8, или 24, или до 48 ч, или на протяжении требуемого длительного периода (например, 7, 14, 21 суток и т.д.). Однако дополнительные пути и схемы доставки также могут быть применимы и некоторые из них подробно описаны в разделе «Введение и режим дозирования» настоящего описания.

Г. Снижение одновременного применения лекарственных средств, предназначенных для лечения хронической сердечной недостаточности

Имеется широкий круг одобренных лекарственных средств, используемых в настоящее время для лечения пациентов с хронической СИ. Пациентов с риском сердечной недостаточности лечат для уничтожения лежащих в основе причин, например гипертонии и жировых расстройств. Определенные пациенты с диабетом и сосудистыми расстройствами получают лекарственные средства, например, вазодилаторы, адренергические блокаторы, определенным образом действующие альфа-агонисты, ингибиторы ангиотензин-конвертирующего фермента (АКФ), блокаторы рецептора II ангиотензина (БРА), блокаторы кальциевых каналов, позитивные инотропы и многие типы диуретиков (например, петлевых, калий-сберегающих, тиазида и тиазидподобные). В некоторых вариантах осуществления настоящего изобретения предусматривают способы лечения сердечной недостаточности, включающие введение релаксина в комбинации с дополнительной терапией, например с гипотензивным средством. В некоторых методах гипотензивное средство выбирают из антитромбоцитарного агента, бета-блокатора, диуретика и антиангиотензивной терапии, но ими перечень не ограничивается.

Ингибиторы ангиотензин-конвертирующего фермента (АКФ) используют для лечения гипертонии на протяжении многих лет. Ингибиторы АКФ блокируют формирование ангиотензина II, гормона с побочным эффектами, оказываемыми на сердце и кровообращение у пациентов с ЗСН. К побочным эффектам этих лекарств относится сухой кашель, низкое кровяное давление, ухудшенная функция почек, дисбаланс электролитов и иногда аллергические реакции. Примерами ингибиторов АКФ являются каптоприл (продукт CAPOTEN), эналаприл (продукт VASOTEC), лизиноприл (продукты ZESTRIL, PRINIVIL), бенацеприл (продукт LOTENSIN) и рамиприл (продукт ALTACE). Для тех пациентов, которые не переносят ингибиторы АКФ, может быть применена другая группа лекарственных средств, называемых блокаторами рецептора ангиотензина (БРА). Эти лекарственные средства непосредственно действуют на тот же гормональный путь, что и ингибиторы АКФ, но вместо блокирования действия ангиотензина II по его сайту рецептора. Побочные эффекты этих лекарственных средств сходны с теми, которые ассоциированы с ингибиторами АКФ, хотя сухой кашель встречается реже. Примерами этого класса лекарственных средств являются лозартан (продукт COZAAR), кандесартан (продукт ATACAND), телмисартан (продукт MICARDIS), валсартан (продукт DIOVAN) и ирбесартан (продукт AVAPRO).

Бета-блокаторы являются лекарственными средствами, которые блокируют действие определенных стимулирующих гормонов, например эпинефрина (адреналина), норэпинефрина и других сходных гормонов, которые действуют на бета-рецепторы разных тканей организма. Природное воздействие этих гормонов на бета-рецепторы сердца представляет более сильное сокращение сердечной мышцы. Бета-блокаторы являются агентами, которые блокируют действие таких стимулирующих гормонов на бета-рецепторы. Стимулирующее действие этих гормонов, хотя первоначально полезное для поддержания сердечной функции, проявляет вредное воздействие на сердечную мышцу на протяжении времени. Обычно, если пациенты с хронической СП получают бета-блокаторы, первое время они получают их в очень низкой дозе, которую затем ступенчато повышают. К побочным эффектам относятся удержание жидкости в организме, низкое кровяное давление и общая утомляемость и головокружение. Бета-блокаторы также не применяют при заболеваниях у людей дыхательных путей (например, при астме, эмфиземе) или при очень низкой частоте сердечных состояний в состоянии покоя. Лекарственное средство карведилол (продукт COREG) наиболее подробно исследован в связи с застойной сердечной недостаточностью и остается единственным бета-блокатором, одобренным Управлением по контролю за продуктами и лекарствами США для лечения застойной сердечной недостаточности. Однако в настоящее время проводят сравнительное исследование карведилола непосредственно с другими бета-блокаторами при лечении застойной сердечной недостаточности. Длительно действующий метопролол (продукт TOPROL XL) также эффективен для пациентов с застойной сердечной недостаточностью. Дигоксин (продукт LANOXIN) получают из растения наперстянки и используют для лечения пациентов с хронической СН в течение десятилетия. Дигоксин стимулирует сердечную мышцу для более сильного сокращения. К побочным эффектам относятся тошнота, рвота, нарушение сердечного ритма, дисфункция почек и нарушение электролитного баланса. У пациентов с существенным нарушением почек доза дигоксина должна быть тщательно отрегулирована и подвергнута мониторингу.

Диуретики часто используют для предупреждения или облегчения симптомов по задержке жидкости в организме у пациентов с хронической СН. Эти лекарственные средства помогают удерживать жидкость от ее сосредоточения в легких и других тканях путем стимуляции тока жидкости через почки. Хотя они эффективно облегчают симптомы, например частое дыхание и отеки ног, не было показано, чтобы они положительно воздействовали на длительное выживание. Если требуется госпитализация, диуретики часто вводят внутривенно, поскольку способность к всасыванию пероральных диуретиков может быть ослаблена. К побочным эффектам диуретиков относятся обезвоживание, нарушение электролитного баланса, частичное снижение уровней калия, нарушения слуха и низкое кровяное давление. Важно предупредить низкие уровни калия путем снабжения пациентов добавками, если это возможно. Какой-либо дисбаланс электролитов может сделать пациентов чувствительными к серьезным нарушениям сердечного ритма. Примерами различных классов диуретиков являются фуросемид (продукт LASIX), гидрохлортиазид, буметанид (продукт BUMEX), торсемид (продукт DEMADEX) и метолазон (продукт ZAROXOLYN). Спиронолактон (продукт ALDACTONE) применяют в течение многих лет в качестве относительно слабого диуретика при лечении различных заболеваний. Это лекарственное средство блокирует действие гормона альдостерона. Альдостерон оказывает теоретически вредное воздействие на сердце и кровообращение при застойной сердечной недостаточности. Его высвобождение стимулируется частично ангиотензином II (вверху). К побочным эффектам этого лекарственного средства относятся повышенные уровни калия и у самцов рост ткани груди (гинекомастия). Другим ингибитором альдостерона является эплеренон (продукт INSPRA).

Полезные средства релаксина, которые установлены при лечении пациентов, например повышенный сердечный индекс и снижение системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления, циркулирующего N-концевого прогормона мозгового натрийуретического пептида и маркеров функции почек (азота мочевины крови и креатинина), показывают, что желательно вводить релаксин вместо или помимо лекарственных средств, в настоящее время одобренных к применению при сердечной недостаточности. Релаксин обладает многими преимуществами, которые не наблюдают при применении современных лекарственных средств, включая отсутствие существенного риска гипотонии и тахикардии во время дыхания, не требует титрования перед введением и не вызывает почечной токсичности. Пациенты с СН при стандартном медикаментозном лечении для достижения и поддержания состояния стабильной компенсированной СН могут получать релаксин, введенный в дозе, которая обычно составляет примерно 10-960 мкг/кг/сутки. Релаксин может быть введен внутривенно в течение 8 или 24, или до 48 ч, или на протяжении требуемого длительного периода (например, 7, 14, 21 суток и т.д.). Однако дополнительные пути и схемы доставки лекарственного средства также применимы и некоторые из них подробно описаны в разделе «Введение и режим дозирования» настоящего описания. Лечебный эффект релаксина также установили у пациентов с хронической компенсированной СН, если релаксин вводят дополнительно с оптимальной стандартной терапией. В результате подтверждают описанный выше целебный эффект релаксина и показывают снижение дозы или приостановку введения одного или нескольких одновременно применяемых лекарственных средств.

Д. Дополнительные методы лечения

Результаты лечения релаксином при сбалансированном расширении сосудов. Полагают, что лечебный эффект релаксина является прямым следствием действия релаксина в качестве специфического в отношении рецептора сосудорасширяющего фактора в почечной и системной сосудистой сети путем связывания со специфическими рецепторами релаксина, обнаруженными в ткани гладких мышц сосудистой цепи. Это в свою очередь приводит к сбалансированному расширению сосудов, поскольку и системные, и почечные артерии расширяются умеренно, но эффективно, без индукции гипотонии у подвергаемых лечению пациентов. Это свойство релаксина, специфического в отношении рецептора и сбалансированного сосудорасширяющего фактора, частично благоприятно в связи с тем, что желательно получить повышенное расширение сосудов в определенных областях тела, где сужение сосудов вызывает серьезный болезненный эффект, например в артериях, которые поставляют кровь к сердцу и почкам. Особенно сбалансированное расширение сосудов происходит без индукции каких-либо побочных эффектов на протяжении лечения. Обычным осложнением при лечении неспецифического расширения сосудов является то обстоятельство, что эти лекарственные средства часто приводят к серьезным побочным эффектам у подвергаемого лечению пациента, преимущественно из-за того, что обычные агонисты действуют слишком сильно и неспецифично. При сравнении, умеренный эффект релаксина медленно увеличивает расширение сосудов в тех местах тела, где это требуется наибольшим образом. Важно отметить, что лечение релаксином не вызывает гипотонии, которая бывает в случае применения многих лекарственных средств, которые с избытком компенсируют сужение сосудов. В частности, неспецифические сосудорасширяющие средства могут вызвать чрезмерное расширение крупных и малых сосудов по всему телу, приводящее к гипотонии. Таким образом, если пациент получает фармацевтическую композицию с фармацевтически действующим релаксином или фармацевтически эффективным агонистом релаксина, который направляется на системные и почечные кровеносные сосуды через локализованные специфические рецепторы релаксина (например, рецепторы LRG7, LGR8, GPCR135, GPCR142), результатом является сбалансированное расширение сосудов без гипотонии.

Кроме того, при работе над настоящим изобретением было установлено, что сбалансированное расширение сосудов у пациентов с сердечной недостаточностью, вызванное релаксином, является формой системы двойного расширения сосудов - системных (преимущественно артериальных) и почечной сосудистой сети. Релаксин, однако, вызывает расширение сосудов у пациентов с сердечной недостаточностью, которое следует сбалансировать, поскольку релаксин привносит действительное расширение сосудов в почках к общему системному расширению сосудов и, таким образом, достигает баланса между системной и почечной сосудистой сетью. Известно, что предшествующие лекарственные средства вызывают непрямое улучшение состояния почек в результате системного расширения сосудов, но их действия недостаточно для достижения баланса. В самом деле, баланс расширения сосудов, вызванный введением релаксина, позволяет пациентам с ОСИ перейти от острой стадии к стабильной стадии за относительно короткий период. Кроме того, введение релаксина пациентам со стабильной компенсированной хронической СН, которая была достигнута лечением современными лекарственными средствами, приводит к дополнительному положительному результату с пониженными маркерами дисфункции почек и к благоприятным гемодинамическим эффектам, согласующимся с расширением сосудов. При этом релаксин может оказать стабилизирующий и целительный эффект на популяцию индивидуумов со стабильной компенсированной хронической СН, приводя к снижению риска декомпенсации и возможно к снижению прогрессирования этого заболевания, в результате снижается частота случаев декомпенсации, которые требуют госпитализации пациентов с компенсированной хронической сердечной недостаточностью. Кроме того, повышение сердечного индекса без повышения частоты сердечных сокращений наряду со снижением других параметров, например, системного сосудистого сопротивления, давления заклинивания в капиллярах легочной артерии, легочного сосудистого сопротивления, азота мочевины крови, креатинина и циркулирующего N-концевого прогормона мозгового натрийуретического пептида, является показателем пользы от применения релаксина и для пациентов с хронической СН, и для пациентов на поздней стадии СН, нуждающихся в более агрессивном режиме лечения.

Такие целебные эффекты релаксина включают связывание релаксина с его рецепторами (например, рецепторами LRG7, LGR8, GPCR135, GPCR142), что приводит к сбалансированному расширению сосудов, т.е. двойному расширению сосудов, и системной, и почечной сосудистой сети. Таким образом, релаксин может применяться для снижения риска возникновения случаев сердечной декомпенсации или для ограничения прогрессирования заболевания выбором субъектов (людей) со стабильной компенсированной сердечной недостаточностью и введение субъектам фармацевтического состава с фармацевтически действующим релаксином. Частично, такие субъекты получают фармацевтически действующий релаксин человека (например, синтетический, рекомбинантный) или фармацевтически действующий агонист релаксина в количестве в диапазоне примерно 10-960 мкг/кг массы тела субъекта в сутки. Релаксин может быть введен внутривенно в течение 8 или 24, или до 48 ч, или на протяжении требуемого длительного периода (например, 7, 14, 21 суток и т.д.). Однако дополнительные пути и схемы доставки также применимы и некоторые из них описаны подробнее в разделе «Введение и режим дозирования» настоящего описания. Введение релаксина продолжают таким образом, чтобы поддержать концентрацию релаксина в сыворотке примерно от 0,5 до примерно 500 нг/мл, более предпочтительно примерно от 3 до примерно 300 нг/мл. Таким образом, способы по настоящему изобретению включают введение, которое приводит к указанным концентрациям релаксина в сыворотке. Эти концентрации релаксина могут понизить или предупредить прогрессирование заболевания и риск получения признаков декомпенсации, например одышки, гипертонии, аритмии, пониженного почечного кровотока и почечной недостаточности.

Лечение релаксином не ассоциировано с почечной токсичностью. Дисфункция почек является распространенным и прогрессирующим осложнением хронической СН. Клинический курс обычно меняется с клиническим статусом и лечением. Несмотря на растущее число диагнозов комбинированной сердечной и почечной дисфункции, также называемой «сердечно-почечным синдромом», лежащая в основе патофизиология точно не установлена. В данной области нет единого мнения, каким образом можно достичь соответствующего лечения. Поскольку пациенты с хронической сердечной недостаточностью живут дольше и умирают реже от сердечной аритмии, сердечно-почечный синдром все больше превалирует и необходимо надлежащее лечение (Gary Francis, Cleveland Clinic Journal of Medicine 73(2), 2006, с.1-13). Релаксин, введенный субъекту, производит двойное действие за счет связывания с рецепторами релаксина в системной и почечной сосудистой сети, что приводит к сбалансированному расширению сосудов. Согласно указанному выше такие субъекты получают фармацевтически действующий релаксин человека (например, синтетический, рекомбинантный) или фармацевтически эффективный агонист релаксин в количестве в диапазоне примерно 10-960 мкг/кг массы тела субъекта в сутки. Дозы приводят к концентрациям релаксина в сыворотке примерно 75, 150 и 300 нг/мл, соответственно. Введение релаксина продолжают таким образом, чтобы поддержать концентрацию релаксина в сыворотке примерно 0,5-500 нг/мл, более предпочтительно примерно 3-300 нг/мл. Релаксин может быть введен внутривенно в течение 8 или 24, или до 48 ч, или на протяжении требуемого длительного периода (например, 7, 14, 21 суток и т.д.). Однако дополнительные пути и схемы доставки также применимы и некоторые из них подробнее описаны в разделе «Введение и режим дозирования» настоящего описания.

Субъекты с почечной недостаточностью, связанной с сердечной недостаточностью, часто также проявляют повышенные уровни натрийуретического пептида мозга (BNP). BNP синтезируется в желудочках сердца в ответ на сердечную недостаточность и дисфункцию левого желудочка и используется в качестве диагностического маркера сердечной недостаточности. Его проявление выражается в системном расширении сосудов и несбалансированном расширении сосудов в почках, т.е. сужение приносящих артериол и расширение выносящих артериол. Уровни BNP еще больше снижены, если релаксин вводят для стабилизации пациентов с компенсированной хронической СН. Это делает BNP подходящим маркером, поскольку он снижается по мере снижения тяжести декомпенсации, и отслеживание уровней BNP у пациентов, которых лечат релаксином, таким образом, удобно осуществлять для подтверждения, что компенсированная хроническая СН стабилизирована.

Релаксин вызывает токсичность на низком уровне или не вызывает токсичности, если его дают пациентам со стабильной компенсированной хронической СН. Это означает, что функция почек у пациентов скорее улучшается, чем ухудшается в результате лечения. Даже при повышенных концентрациях в сыворотке, примерно равных 75 нг/мл, релаксин намного менее токсичен, чем современные применяемые лекарственные средства (например, петлевые диуретики, например, фуросемид, ингибиторы ангиотензин-конвертирующих ферментов, например, каптоприл, блокаторы рецептора ангиотензина, например, кандесартан и др.). Одним важным отличительным фактом настоящего изобретения является то обстоятельство, что релаксин сохраняет функцию почек, хотя на протяжении лечения он не вызывает почечной токсичности или эта токсичность незначительна. Хотя существующие лекарственные средства могут сохранить в некоторой степени функцию почек, они также повышают почечную токсичность у пациентов. Такая почечная токсичность затем дополнительно ухудшает состояние сердца. При сравнении, введение релаксина достигает поддержания устойчивого состояния большинства пациентов в частности из-за отсутствия почечной токсичности. Это позволяет больше стабилизировать популяцию субъектов с хронической СН для достижения управляемого состояния, где вероятность усугубленной сердечной недостаточности до известной степени снижена.

Композиции и составы с релаксином

Релаксин, агонисты релаксина и/или аналоги релаксина перерабатывают в виде фармацевтических средств, предназначенных для применения в способах настоящего изобретения. Какая-либо композиция или соединение, способное стимулировать биологический ответ, ассоциированный со связыванием биологически или фармацевтически действующего релаксина (например, синтетического релаксина, рекомбинантного релаксина) или агониста релаксина (например, аналога релаксина или релаксин-подобного модулятора) с рецепторами релаксина, могут применяться в качестве фармацевтических агентов по настоящему изобретению. Главные детали способов получения составов и введения описаны в научной литературе (см. кн.: «Remington's Pharmaceutical Sciences», изд-во Maack Publishing Co, Easton, Пасадена). Фармацевтические составы, содержащие фармацевтически действующий релаксин, могут быть получены по какому-либо способу, известному в данной области, для получения фармацевтических средств. Составы, содержащие фармацевтически действующий релаксин или агонисты релаксина, которые используют в способах настоящего изобретения, могут быть переработаны для введения каким-либо традиционным путем, включая, но ими не ограничиваясь, введение внутривенное, подкожное, внутримышечное, подъязычное, местное, пероральное, ингаляционное введение или введение через пригодный для ношения инфузионный насос. Иллюстративные примеры приведены ниже. В одном из предпочтительных вариантов осуществления настоящего изобретения релаксин вводят внутривенно (ВВ).

Если лекарственные средства вводят внутривенной инъекцией, составы, содержащие фармацевтически действующий релаксин или фармацевтически эффективный агонист релаксина, могут быть в форме стерильного инъекционного препарата, например стерильного инъекционного водного препарата или жировой суспензии. Суспензия может быть переработана известным в данной области образом, используя соответствующие диспергирующие или увлажняющие агенты и суспендирующие агенты, указанные выше. Стерильный инъекционный препарат также может быть стерильным инъекционным раствором или суспензией в нетоксичном парентерально-приемлемом разбавителе или растворителе. Среди приемлемых связующих агентов и растворителей, которые могут быть применены, содержатся вода и раствор Рингера, изотонический раствор хлорида натрия. Кроме того, стерильные фиксированные масла могут легко применяться в качестве растворителя или суспендирующей среды. Для этой цели может быть применено какое-нибудь обычное нелетучее масло, в том числе синтетические моно- или диглицериды. Кроме того, жирные кислоты, например олеиновая кислота, также могут применяться в инъекционных препаратов.

Фармацевтические составы для перорального введения могут быть переработаны, используя фармацевтически приемлемые носители, хорошо известные в данной области, в дозах, пригодных для перорального введения. Такие носители позволяют перерабатывать фармацевтические составы в разовые дозированные формы в виде таблеток, пилюль, порошков, капсул, жидкостей, пастилок, гелей, сиропов, жидких смесей, суспензий и др., приемлемых для потребления пациентами через рот. Фармацевтические препараты для перорального применения могут быть получены комбинированием соединений релаксина с твердым эксципиентом, необязательно измельчая получаемую смесь и перерабатывая смесь в гранулы после добавления при необходимости соответствующих дополнительных соединений для получения таблеток или пилюль. Соответствующими твердыми эксципиентами являются углеводные или белковые наполнители, которые включают, но ими не ограничиваются, сахара, включая лактозу, сахарозу, манит или сорбит; кукурузный, пшеничный, рисовый, картофельный или иной растительный крахмал; целлюлозу, например, метилцеллюлозу, гидроксипропилметилцеллюлозу или натриевую соль карбоксиметилцеллюлозы; и камедь, включая гуммиарабик и трагакант; а также белки, например желатин и коллаген. При необходимости могут быть добавлены разрыхляющие или растворяющие агенты, например, поливинилпирролидон с поперечными сшивками, агар, альгиновая кислота или ее соли, например, альгинат натрия. Фармацевтическими препаратами по настоящему изобретению, которые могут также применяться перорально, являются, например, заполненные капсулы из желатина, а также мягкие запечатанные капсулы, сделанные из желатина и покрытые, например, глицерином или сорбитом. Заполненные капсулы могут содержать релаксин, смешанный с наполнителем или связующими, например, лактозой или крахмалами, смазывающими агентами, например, тальком или стеаратом магния, и, необязательно, стабилизаторами. В мягких капсулах соединения релаксина могут быть растворены или суспендированы в соответствующих жидкостях, например жирных маслах, жидком парафине или жидком полиэтиленгликоле со стабилизаторами или без них.

Водные суспензии по настоящему изобретению содержат релаксин в смеси с эксципиентами, пригодными для получения водных суспензий. К таким эксципиентам относится суспендирующий агент, например натриевая соль карбоксиметилцеллюлозы, метилцеллюлоза, гидроксипропилметилцеллюлоза, альгинат натрия, поливинилпирролидон, трагакант и камедь акации аравийской, а также разрыхляющие или растворяющие агенты, например природные фосфатиды (например, лецитин), продукт конденсации оксида алкилена с жирной кислотой (например, стеарат полиоксиэтилена), продукт конденсации оксида этилена с длинноцепочечным алифатическим спиртом (например, гептадекаэтиленоксицетанолом), продукт конденсации оксида этилена с неполным сложным эфиром, производным жирной кислоты и гекситола (например, полиоксиэтиленсорбитолмоноолеат), или продукт конденсации оксида этилена неполным сложным эфиром, производным жирной кислоты и ангидридом гекситола (например, полиоксиэтиленсорбитанмоноолеат). Водная суспензия также может содержать один или несколько консервантов, например, этил или n-пропил р-гидроксибензоат, один или несколько окрашивающих агентов, один или несколько ароматизирующих агентов и один или несколько подсластителей, например сахарозу, аспартам или сахарин. Составы могут быть отрегулированы по осмолярности.

Масляные суспензии могут быть переработаны путем суспендирования релаксина в растительном масле, например арахисовом масле, оливковом масле, кунжутном масле, или кокосовом масле, или минеральном масле, например жидком парафине. Масляные суспензии могут содержать загуститель, например пчелиный воск, твердый парафин или цетиловый спирт. Подсластители могут быть добавлены для получения перорального препарата приятного вкуса. Эти составы могут быть сохранены добавлением антиоксиданта, например аскорбиновой кислоты.

Дисперсные порошки и гранулы по настоящему изобретению, пригодные для получения водной суспензии добавлением воды, могут быть переработаны из релаксина в смеси с диспергирующим, суспендирующим и/или увлажняющим агентом с одним или несколькими консервантами. Соответствующие диспергирующие или увлажняющие агенты и суспендирующие агенты представлены указанными выше примерами. Также могут содержаться дополнительные эксципиенты, например подсластители, ароматизаторы и красители.

Фармацевтические составы по настоящему изобретению также могут быть в форме эмульсий масло-в-воде. Фаза масла может быть представлена растительным маслом, например оливковым маслом или арахисовым маслом, минеральным маслом, например, жидким парафином или их смесью. К соответствующим эмульгирующим агентам относятся природные камеди, например гуммиарабик и трагакант, природные фосфатиды, например соевый лецитин, сложные эфиры или неполные сложные эфиры, производные жирной кислоты и ангидрид гекситола, например сорбитанмоноолеат, и продукты конденсации неполных сложных эфиров с оксидом этилена, например полиоксиэтиленсорбитанмоноолеат. Эмульсия также может содержать подсластители и ароматизаторы. Сиропы и эликсиры могут быть переработаны с подсластителями, например с глицерином, сорбитом или сахарозой. Такие составы также могут содержать смягчающий агент, консервант, ароматизатор или краситель.

Введение и режимы дозирования

Составы, содержащие фармацевтически действующий релаксин или фармацевтически действующий агонист релаксина, используемые в способах настоящего изобретения, могут вводиться каким-либо легко применяемым способом, включая, но ими не ограничиваясь, внутривенное, подкожное, внутримышечное, подъязычное, местное, пероральное, ингаляционное введение и использование пригодного для ношения инфузионного насоса. Введение может меняться в зависимости от фармакокинетических и других свойств лекарственных средств, а также от состояния здоровья пациента. Основные рекомендации представлены ниже.

Способы по настоящему изобретению вызывают гемодинамические эффекты, включающие расширение сосудов, в том числе улучшенные параметры, отражающие функцию почек у субъектов со стабильной компенсированной хронической СН. Количество одного только релаксина или релаксина в комбинации с другим агентом или лекарственным средством или агентами и лекарственными средствами, которые соответствуют завершению комбинации, рассматривают в качестве терапевтически эффективной дозы. Схема дозирования и количества, эффективные для применения, т.е. «режим дозирования», могут зависеть от разных факторов, включая стадию заболевания или состояния, тяжести заболевания или состояния, тяжести побочных эффектов, общего состояния здоровья пациента, физического статуса пациента, возраста и т.д. При расчете режима дозирования пациента способ введения также учитывают. Режим дозирования также обязательно должен учитывать фармакокинетику, т.е. скорость абсорбции, биодоступность, метаболизм, клиренс и др. Основываясь на этих принципах, релаксин может применяться для лечения субъектов с симптомами сердечной недостаточности для поддержания стабильной компенсированной хронической СН.

Настоящее изобретение предусматривает релаксин и дополнительные лекарственные средства, включая антитромбоцитарный агент, бета-блокаторы, диуретики, нитраты, гидралазин, инотропы, дигиталис и ингибиторы ангиотензин-конвертирующего фермента или блокаторы рецептора ангиотензина для одновременного, комбинированного, раздельного или последовательного введения. Настоящее изобретение также предусматривает применение антитромбоцитарной терапии, бета-блокаторов, диуретиков, нитратов, гидралазина, инотропов, дигиталиса и ингибиторов ангиотензин-конвертирующего фермента или блокаторов рецептора ангиотензина в получении лекарственного средства для терапии стабильной компенсированной хронической СН, причем лекарственное средство получают для введения с релаксином.

Другие варианты осуществления настоящего изобретения представляют применение релаксина для получения лекарственного средства для поддержания стабильной компенсированной хронической СН, причем пациент, ранее подвергавшийся лечению антитромбоцитарными средствами, бета-блокаторами, диуретиками, нитратами, гидралазином, инотропами, дигиталисом и ингибиторами ангиотензин-конвертирующего фермента или блокаторами рецептора ангиотензина (например, за несколько часов, за одни или несколько суток, недель, месяцев или лет и др.). В другом варианте осуществления настоящего изобретения одно или несколько из лекарственных средств, например антитромбоцитарный агент, бета-блокаторы, диуретики, нитраты, гидралазин, инотропы, дигиталис и ингибиторы ангиотензин-конвертирующего фермента или блокаторы рецептора ангиотензина, сохраняют действие у пациентов in vivo. Настоящее изобретение также предусматривает применение антитромбоцитарного агента, бета-блокаторов, диуретиков, нитратов, гидралазина, инотропов, дигиталиса и ингибиторов ангиотензин-конвертирующего фермента или блокаторов рецептора ангиотензина для получения лекарственного средства для лечения стабильной компенсированной хронической СН, причем пациента ранее лечили релаксином.

Состояние в настоящей области позволяет врачам определять режим дозирования релаксина для каждого конкретного пациента. В виде примера рекомендации, представленные ниже для релаксина, могут быть применены в качестве руководства для определения режима дозирования, т.е. схемы дозирования и уровней составов, содержащих фармацевтически действующий релаксин, которые вводят при осуществлении способов по настоящему изобретению. В качестве общей рекомендации предполагают, что суточная доза фармацевтически действующего релаксина Н2 человека (например, синтетического, рекомбинантного, аналога, агониста и др.) обычно находится в диапазоне примерно 10-960 мкг/кг массы тела субъекта в сутки. В другом варианте осуществления настоящего изобретения дозы релаксина составляют 10, 30, и 100 мкг/кг/сутки. В другом варианте осуществления настоящего изобретения дозирование приводит к концентрациям релаксина в сыворотке, составляющим примерно 3, 10 и 30 нг/мл, соответственно. В другом варианте осуществления настоящего изобретения дозы релаксина составляют 240, 480 и 960 мкг/кг/сутки. В другом варианте осуществления настоящего изобретения эти дозы приводят к концентрациям релаксина в сыворотке примерно 75, 150 и 300 нг/мл, соответственно. В другом варианте осуществления настоящего изобретения введение релаксина продолжают таким образом, чтобы поддержать в сыворотке концентрацию релаксина примерно от 0,5 до примерно 500 нг/мл, более предпочтительно примерно от 3 до примерно 300 нг/мл. Таким образом, способы по настоящему изобретению предусматривают введение, которое приводит к таким концентрациям релаксина в сыворотке. Эти концентрации релаксина могут облегчить или понизить признаки декомпенсации, например, одышки, гипертонии, высокого кровяного давления, аритмии, пониженного кровотока почек, почечной недостаточности и смертность. Кроме того, эти концентрации релаксина могут облегчить или понизить нейрогормональный дисбаланс, избыток жидкости в организме, сердечную аритмию, сердечную ишемию, риск смертности, сердечный стресс, сосудистое сопротивление и др. В зависимости от субъекта введение релаксина поддерживают на протяжении определенного периода или так долго как потребуется, для поддержания стабильности у субъекта.

Длительность лечения релаксином может быть определена для некоторых субъектов, или предпочтительно находится в диапазоне примерно от 4 ч до примерно 96 ч в зависимости от пациента, и при необходимости проводят одно или несколько повторных лечений. Например, в связи с частотой введения введение релаксина может составлять примерно от 8 ч до 48 ч лечения. Релаксин может вводиться непрерывно или прерывисто через внутривенное или подкожное введение (или внутрикожное, подъязычное, ингаляционное введение или использование пригодного для ношения инфузионного насоса). Внутривенно релаксин может вводиться с помощью дозатора шприцевого для инфузионной терапии или через капельницу. Внутривенно через капельницу может вводиться стандартный физиологический раствор, неполный стандартный физиологический раствор, 5% декстроза в воде, раствор лактата Рингера или другой близкий раствор в капельницах объемом 100, 250, 500 или 1000 мл. Для подкожной инфузии релаксин может вводиться установкой для подкожной инфузии, соединенной пригодным для ношения инфузионным насосом. В зависимости от субъекта введение релаксина поддерживают на протяжении определенного периода времени (например, 4, 8, 12, 24 и 48 ч) или более длительного периода в зависимости от потребности (например, в течение суток, месяца или в течение 7, 14, 21 суток и т.д.) для поддержания стабильности у субъекта.

Некоторых субъектов лечат неопределенный срок, а других лечат на протяжении конкретных периодов времени. Можно лечить субъекта время от времени релаксином при необходимости. Таким образом, введение может продолжаться на протяжении периода времени, достаточного для поддержания стабильной компенсированной хронической СИ, что приводит к облегчению или снижению случаев острой сердечной декомпенсации, включая, но ими не ограничиваясь, одышку, гипертонию, высокое кровяное давление, аритмию, пониженный почечный кровоток и почечную недостаточность. Составы должны обеспечить достаточное количество релаксина для эффективного облегчения и стабилизации состояния. Типичный фармацевтический состав для внутривенного введения релаксина может зависеть от конкретной терапии. Например, релаксин может быть введен пациенту в режиме монотерапии (т.е. без других сопутствующих лекарственных средств) или в режиме комбинированной терапии с другим лекарственным средством, например, с антитромбоцитарным агентом, антитромбоцитарными средствами, бета-блокаторами, диуретиками, нитратами, гидралазином, инотропами, дигиталисом и ингибиторами ангиотензин-конвертирующего фермента или блокаторами рецептора ангиотензина или с другими лекарственными средствами. В другом варианте осуществления настоящего изобретения релаксин вводят пациенту ежедневно в качестве монотерапии. В другом варианте осуществления настоящего изобретения релаксин вводят ежедневно в качестве комбинированной терапии с другим лекарственным средством. В особенности дозы и частота введения релаксина пациенту могут варьировать в зависимости от возраста, степени развития заболевания, устойчивости к лекарственному средству и сопутствующих лекарственных средств и состояний. В другом варианте осуществления настоящего изобретения релаксин вводят пациенту с основной целью заместить, уменьшить или не использовать других лекарственных средств для снижения их побочных эффектов и для повышения или поддержания терапевтической пользы медицинского вмешательства, используя релаксин для оптимального поддержания стабильной компенсированной и хронической сердечной недостаточности.

ПРИМЕРЫ

Приводимые ниже примеры предназначены проиллюстрировать настоящее изобретение и их не следует рассматривать в качестве примеров, ограничивающих рамки охвата формулы настоящего изобретения.

Аббревиатуры: AUC (область под кривой); BNP (натрийуретический пептид мозга); КД (кровяное давление); АМК (азот в составе мочевины крови); ЗСН (застойная сердечная недостаточность); СИ (сердечный индекс); МОС (минутный объем сердца); CrCl (клиренс креатинина); ДКД (диастолическое кровяное давление); дл (децилитр); пСКФ (примерную скорость клубочковой фильтрации); СН (сердечная недостаточность); ч (час); ЧСС (частота сердечных сокращений); ОИТ (отделение интенсивной терапии); ВВ (внутривенный); кг (килограмм); л (литр); ДДКЛЖ (диастолическое давление в конце левого желудочка); ФВЛЖ (фракция выброса левого желудочка); мкг (микрограмм); мЭкв (миллиэквиваленты); ИМ (инфаркт миокарда); мМЕ (милли-международные единицы); мл (миллилитр); АКН (Ассоциацией кардиологов Нью-Йорка); ПАГ (пара-аминогиппурат); ЛАД (легочное артериальное давление); ДЗКЛА (давление заклинивания в капиллярах легочной артерии); ФД (фармакодинамика); ДПП (давление в правом предсердии); БПНП (блокада правой ножки пучка); ПК (почечный кровоток); рРЛНч (рекомбинантный релаксин человека); РЛН (релаксин); ИД (интенсивность дыхания); СКД (систолическое кровяное давление); ИСК (индекс систолического кровотока); уМДЗП (упрощенная модификация диеты при заболевании почек); ПК (подкожный); ССС (системное сосудистое сопротивление); Т (температура); ВШ (визуальная аналоговая шкала); ФЖ (фибрилляция желудочков); ЖТ (желудочковая тахикардия); и УСН (ухудшение сердечной недостаточности).

Пример 1

Введение релаксина пациентам с хронической сердечной недостаточностью

Общее положение. В этом открытом исследовании 16 пациентов с хронической и стабильной компенсированной застойной СН были включены в три группы с повышающимися дозами рекомбинантного внутривенно вводимого релаксина (10-960 мкг/кг/сутки) и исследовали на протяжении 24 ч. Релаксин вызывает повышение сердечного индекса и ударного объема крови и снижает давление заклинивания в капиллярах легочной артерии и NT-pro-BNP. Он улучшает маркеры почечной функции, с небольшой отдачей при наивысшей дозе в период после инфузии. Это исследование показывает, что релаксин проявляет благотворное гемодинамическое, нейрогуморальное и почечное действие на пациентов со стабильной компенсированной СН без существенных побочных эффектов, что делает релаксин главным перспективным лекарственным средством для сохранения стабильной компенсированной хронической сердечной недостаточности у пациентов под контролем. Определяют максимально переносимую дозу.

Схема исследования. В этом одноцентровом открытом исследовании, в котором 16 пациентов, полностью соответствующих критериям включения, но не соответствующих критериям исключения, касающихся хронической и стабильной компенсированной застойной СН, последовательно распределяют на три восходящие группы по внутривенному введению релаксина. Основные критерии включения следующие: возраст >18 лет; ЗСН классов II-III Ассоциации кардиологов Нью-Йорка (АКН) без ограничения по этиологии; фракция выброса левого желудочка <35% в течение 6 месяцев регистрации; предполагают, что установленная пероральная терапия СН остается неизменной на протяжении периода исследования. Основные критерии исключения следующие: давление заклинивания <16 мм Hg или СИ>2,5 л/мин/м2; острый коронарный синдром (в течение 4 недель) или ранее перенесенный инфаркт миокарда или хирургическое вмешательство на сердце (в течение 6 месяцев); ОСН требует внутривенной терапии при базовом уровне; систолическое кровяное давление <85 мм Hg; неисправленная болезнь клапанов сердца, исключая относительную недостаточность митрального и/или трехстворчатого клапана; обструктивная или облитерирующая кардиомиопатия; ранее имевшийся случай желудочковой тахикардии или фибрилляции (в течение 4 недель); недавний удар (в течение 3 месяцев); креатинин >2,0 мг/дл или сывороточные трансаминазы и/или общий билирубин >2,5 раза верхнего предела нормы при тщательном анализе; история эндометриоза.

Разработка лекарственного средства. Исследуемым лекарственным средством является релаксин (полученный методом рекомбинации). Рекомбинантный релаксин идентичен нативному гормону релаксина Н2 человека. Повышение дозы происходит следующим образом: группа А включает последовательное лечение в течение каждых 8 ч дозами, равными 10, 30 и 100 мкг/кг/сутки. Группа Б включает последовательное лечение в течение каждых 8 ч дозами, равными 240, 480 и 960 мкг/кг/сутки. Группа В включает 24 ч лечения с помощью 960 мкг/кг/сутки. Повышение от группы А к группе Б проводят после исследования безопасности и переносимости доз, применяемых в группе А. Определяют имеющееся увеличение от группы Б к группе В после определения безопасности и переносимости наивысшей дозы в группе Б (960 мкг/кг/сутки).

Методы исследования, конечные точки и статистический анализ. Пациентов подвергают мониторингу в отделении интенсивной терапии в течение инфузионного и постинфузионного периодов (24 ч каждый). Гемодинамические измерения, включая СИ, ССС, ДЗКЛА, СКД, ДПП и ЛСС, проводят сериями, используя катетеры Свана-Ганза и артериальный. Подобным образом клинический и лабораторный мониторинг проводят сериями на протяжении инфузии, после инфузии и на 9 сутки после начала инфузии. Дополнительную 30-суточную оценку тяжести побочных эффектов проводят по телефону. К конечным точкам относятся гемодинамические и нейрогуморальные (уровни NT-pro-BNP) изменения относительно исходного уровня, а также мониторинг основных показателей состояния организма, электрокардиограммы, химического состава сыворотки и гематологических параметров на протяжении исследования. Для статистического анализа вероятность ошибки Р<0,05 расценивают в качестве существенной. Показатели исходного уровня сравнивают, используя вариационный анализ Kruskal-Wallis ANOVA по рангам с последующим тестом Данна. Различия на протяжении времени в отдельных группах (гемодинамика, показатели состояния почек и уровни пептидов) анализируют методом повторяемых измерений Friedman по рангам с последующим тестом Дана для сравнения относительно исходного уровня.

Демография и безопасность. Все пациенты получают стандартное лекарственное средство (средства) для лечения СН и проявляют выраженную пониженную функцию систолы левого желудочка из-за заболевания коронарной артерии, гипертонии, дилатационной кардиомиопатии или (в одном случае) скорректированной болезни клапанов сердца. Все субъекты получают дозирование, и все дозы релаксина хорошо переносимы. См. табл.1 ниже. Отсутствуют существенные клинические побочные эффекты, связанные с инфузией; наивысшую дозу, исследованную в группах А и Б, мкг/кг/сутки, соответственно выбирают для введения в группе В в течение 24 ч. Через три недели после инфузии лекарственного средства установлен один побочный эффект (умеренная стенокардия без признака какого-либо признака прогрессирующего заболевания коронарной артерии по ангиографической оценке), который предположительно не связан с релаксином. Установлено семь случаев побочных эффектов, не связанных с исследованием лекарственного средства, о которых сообщалось при дозировании в течение 9 суток, т.е. два пациента жаловались на умеренную стенокардию (не включая SAE), и еще один пациент жаловался на слабость, бессонницу, головную боль, доброкачественную гипертрофию простаты и умеренное кровохарканье. Кровохарканье четко индуцируется продвижением катетера Свана-Ганза в положении клином и прекращается сомопризвольно.

Таблица 1.
Исследуемые субъекты
Группа Субъект Лекарственные средства ФВЛЖ
А Мужчина европеоидной расы 79 лет, коронарная болезнь сердца АСК, СТА, ББ, ИАКФ, АА, ДИГ, Д 31%
А Мужчина европеоидной расы 65 лет, коронарная болезнь сердца АСК, КЛО, СТА, ББ, ИАКФ,НИТ, Д 33%
А Мужчина европеоидной расы 82 лет, коронарная болезнь сердца АСК, КЛО, СТА, ББ, ИАКФ, Д 23%
А Женщина европеоидной расы 73 лет, гипертония АСК, ББ, ИАКФ, Д 28%
Б Мужчина европеоидной расы 68 лет, гипертония ББ, CAP, АА, ДИГ, Д 28%
Б Мужчина европеоидной расы 60 лет, ДКМП ББ, ИАКФ, АА, Д 30%
Б Мужчина европеоидной расы 73 лет, коронарная болезнь сердца АСК,КЛО,СТА, ББ, ИАКФ, АА 23%
Б Мужчина европеоидной расы 47 лет, гипертония СТА, ББ, ИАКФ, АА, ДИГ.Д 28%
Б Мужчина европеоидной расы 50 лет, коронарная болезнь сердца СТА, КЛО, ББ, ИАКФ, АА, НИТ, БКК, Д 22%
Б Мужчина европеоидной расы 63 лет, гипертония ББ, ИАКФ, АА, НИТ, Д, КРД 26%
Б Мужчина европеоидной расы 69 лет, ДКМП СТА, ББ, CAP, АА, ДИГ, Д 25%
В Мужчина европеоидной расы 78 лет, коронарная болезнь сердца АСК, КЛО, СТА, ББ, ИАКФ, БКК, Д 29%
В Мужчина европеоидной расы 64 лет, коронарная болезнь сердца АСК, СТА, ББ, ИАКФ, САР.Д 23%
В Мужчина европеоидной расы 72 лет, ЗСН клапана* ББ, ИАКФ, ДИГ, Д, КРД 26%
В Мужчина европеоидной расы 64 лет, коронарная болезнь сердца АСК. ББ, ИАКФ, АА, НИТ.Д 20%
В Мужчина европеоидной расы 64 лет, коронарная болезнь сердца АСК, КЛО, СТА, ББ, CAP, АА, БКК, Д 24%
ФВЛЖ - фракция выброса левого желудочка; АСК = ацетилсалициловая кислота; КЛО = клопидогрел; СТА = статин; ББ = бета-блокатор; ИАКФ = ингибитор ангиотензин-конвертирующего фермента; CAP = сартан; БКК = блокатор кальциевых каналов; АА = антагонист альдостерона; ДИГ = дигиталис (наперстянка); НИТ = нитрат; Д = диуретик; КРД = кордарон; ДКМП = дилатационная кардиомиопатия.
*после хирургической коррекции

Исходные показатели гемодинамики и функции почек. У пациентов в группе А проявляется тенденция к более уклоняющимся от нормы исходным параметрам, а в группе Б проявляются минимальные отклонения. Пациенты в группе Б имеют существенно более низкую ССС по сравнению с пациентами группы А, в группе В проявляют существенно более высокие величины ЛСС по сравнению с группой Б. В том, что касается связанных с почками показателей, пациенты в группе В проявляют тенденцию к повышенным величинам креатинина и АМК по сравнению с пациентами в группах А и Б, хотя они не являются существенно большими. Кроме того, тенденция к снижению величин NT-pro-BNP, наблюдаемая в группе Б, не является значительной. См, ниже табл.2.

Таблица 2.
Исходные величины в исследуемых группах
Группа А Группа Б Группа В
СИ (л/мин/м2) 2,1±0,2 2.3±0,1 2,1±0,1
ДЗКЛА (мм Hg) 20±1 19±2 20±2
ССС (дин·сек-1·см5) 1518±134 1010±52* 1254±98
ЛСС (дин·сек-1·см5) 194±34 128±12 ЛСС (дин·сек-1·см5)
СКД (мм Hg) 128±9 109±5 118±8
СЛАД (мм Hg) 30±1 27±2 33±4
ДПП (мм Hg) 8±2 12±2 10±2
ЧСС (удары/мин) 71±6 68±2 66±5
Креатинин (мг/дл) 1,08±0,13 1,19±0,10 1,46±0,16
АМК (мг/дл) 39±7 47±8 72±12
NT-pro-BNP (пг/мл) 3715±1046 2273±648 2693±501
СИ = сердечный индекс; ДЗКЛА = давление заклинивания в капиллярах легочной артерии; ССС/ЛСС = системное сосудистое сопротивление/легочное сосудистое сопротивление; СКД = систолическое кровяное давление; СЛАД = среднее легочное артериальное давление; ДПП = давление в правом предсердии; ЧСС = частота сердечных сокращений; АМК = азот мочевины крови.
Р<0,05, *группа А против группы Б, и # группа Б против группы В.

Инфузия и состояние после инфузии. Величины СИ (фиг.4) проявляют тенденцию к повышению по мере увеличения доз релаксина в группе А. В группе Б величина СИ проявляет тенденцию к повышению в течение первого 8-часового периода (240 мкг/кг/сутки), затем снижается при дозе 480 мкг/кг/сутки, и в итоге, существенно повышается при дозе 960 мкг/кг/сутки. В группе В последняя доза приводит к существенному и устойчивому повышению СИ с полным повышением до 0,8 л/мин/м2. Такой выраженный эффект постепенно исчезает в течение первых 8 ч после инфузии. Следует указать, что такое повышение СИ исключительно связано с повышенным ударным объемом (систолическим объемом) сердца, поскольку частота сердечных сокращений не меняется ни в одной из групп (фиг.5). Изменения СИ параллельны соответствующим реципрокным изменениям величины ССС (фиг.6), которая достигает статистической значимости в группе С. Применительно к показателям ДЗКЛА (фиг.7) следует отметить, что величины существенно падают при 30 и 100/кг/сутки в группе А. В группе Б установлено, что величина ДЗКЛА падает на протяжении первых 8 ч, но затем возвращается к базовому уровню несмотря на повышение доз релаксина. И опять, доза 960 мкг/кг/сутки релаксина, введенная на протяжении 24 ч в группе С, индуцирует четкий и существенный эффект при полном снижении ДЗКЛА примерно до 4 мм Hg. В общем, существенных изменений СКД (фиг.8) не наблюдают. В группе А, в которой проявляется тенденция к повышению СКД относительно базовой линии (128±9 мм Hg, ср. табл.2), СКД несомненно проявляет тенденцию к снижению, несмотря на то, что в группах Б и В нет существенного изменения. Время курса NT-pro BNP (фиг.9) хорошо согласуется с гемодинамическим ответом, наблюдаемым в разных группах: установлено существенное снижение в группах А и В, но не установлено изменений в группе Б при проявляемой тенденции к еще более высоким величинам в этой группе на 9 сутки. В итоге величины креатинина снижаются на протяжении инфузии релаксина во всех группах (фиг.10), эффект становится существенным в группах А и В. С повышением доз в группах Б и В величины, определенные на 9 сутки, предположительно проявляют определенный ответный эффект, хотя ни у одного из пациентов не возникает побочных эффектов в почках и никому не потребовалось медицинского вмешательства. При действии лекарственного вещества величины АМК параллельны величинам, определенным для креатинина. На протяжении исследования релаксин не вызывает каких-либо отклонений от нормы, касающихся основных показателей состояния организма, электрокардиограммы, химического состава сыворотки и гематологических параметров.

Результаты. Настоящее пилотное исследование является первым исследованием, рассматривающим применение релаксина пациентами с хронической застойной СН. Основная цель пилотного исследования - исследовать безопасность и переносимость состава с релаксином, а также зависимость дозы-ответа у пациентов с хронической СН. Исследование показывает следующее. 1) В широком диапазоне доз (10-960 мкг/кг/сутки) релаксин не показывает существенных побочных эффектов и является хорошо переносимым. 2) Релаксин вызывает лечебные гемодинамические эффекты (например, снижение сосудистого сопротивления, повышение сердечного индекса, связанное с повышенным ударным объемом (систолическим объемом) сердца и снижением давления заклинивания, без индукции гипотонии). 3) Введение релаксина ассоциировано с ранним снижением креатинина и АМК. 4) У пациентов, получающих наивысшую дозу релаксина (960 мкг/кг/сутки), наблюдают потенциальное доза-ограничительное повышение уровня креатинина после лечения. Это означает, что доза 240-480 мкг/кг/сутки предположительно является максимально переносимой дозой (МПД) внутривенно вводимого релаксина в этой популяции при отсутствии медицинского наблюдения. Таким образом, в группах А и В показаны схожие ответные реакции на инфузии релаксина, которые отсутствуют в группе Б. Это может быть связано с исходными отличиями: у пациентов в группе Б уже были максимально расширены сосуды, что подтверждается их существенно более низкой величиной ССС, и они проявляли тенденцию к понижению величин СКД и NT-pro BNP (табл.2). У этих пациентов возможное дополнительное расширение сосудов релаксином («сверхрасширение кровеносных сосудов»), вероятно ускоряет существенные ответы противоположных регуляторных систем, предупреждая оценку полных потенциальных гемодинамических эффектов лекарственного средства, особенно в средней дозе (480 мкг/кг/сутки).

Пациенты в этом исследовании стабильны, но проявляют признаки поздней стадии сердечной недостаточностью. Наиболее вероятно они могут попасть в квартиль регистра ADHERE, где величины СКД ниже 120 мм Hg и, соответственно, наихудший исход. Судя по тому, что гипотония при госпитализации, а также связанная с лечением гипотония, известны или ожидаемы при ухудшенном прогнозе ОСН, что принципиально важно для оценки ответа СКД на лечение релаксином. В этом исследовании не наблюдают симптоматической гипотонии, несмотря на существенные снижения системного сосудистого сопротивления. Проявляется тенденция к снижению СКД в группе А, но она наблюдается у одного из 4 индивидуумов, испытывающих устойчивое, пока еще бессимптомное, падение СКД (примерно от 120/65 мм Hg до примерно 100/50 мм Hg). Не зафиксировано существенных изменений СКД в группах Б (группа меньшей тяжести) и В несмотря на повышенные дозы релаксина. Тем не менее, важно отметить утрату выраженной гипотонии. Кроме того, у пациентов с повышенным кровяным давлением относительно давления, зафиксированного в этом исследовании, предположительно гипотензивный эффект релаксина более выражен. Эти сведения также были получены другими исследователями (см. Debrah и др., Hypertension 46, 2005, с.745-750), т.е. и у гипертоничных, и у нормотоничных крыс, рРЛНч вызывает повышение СИ и снижение ССС без воздействия на среднее артериальное давление. Если рРЛНч является неспецифическим вазодилатором, можно ожидать частичной компенсации падения СКД за счет повышенного ударного объема сердца.

Ни в одной из групп лечения не показано существенного снижения давления в правом предсердии (фиг.11) несмотря на выраженное существенное падение ЛСС в группе В (~30%) и существенное падение ДЗКЛА, наблюдаемое в группах А и В (фиг.7). Это показывает, что релаксин может активировать венозный приток для подержания центрального давления, заполняющего вены. Некоторые исследователи (Edouard и др., Am J. Physiol. 274, 1998, c.H1605-H1612) отмечают повышение венозного тона в нижних конечностях, начиная с первого триместра беременности. Релаксин, впервые описанный в качестве гормона беременности, является ключевым медиатором для адаптации почек к беременности (см. Novak и др., J. Clin. Invest. 107, 2001, cc.1469-1475). Кроме того, наблюдаемая гемодинамическая картина (повышенная величина СИ и пониженная величина ССС, но значимое снижение величины СКД) имеет сходство с картиной, наблюдаемой при беременности (см. Slangen и др., Am J. Physiol. 270, 1996, c.H1779-H1784).

Инфузия релаксина приводит к улучшению показателей, отражающих функцию почек (креатинин, АМК) у большинства пациентов, эффект, которых становится существенным в группах А и В. Поскольку было показано, что релаксин повышает клубочковую фильтрацию (КФ) и почечный кровоток у животных (см. выше Novak, Jeyabalan и др., Circ. Res. 93, 2003, c.1249-1257), сходный механизм может действовать в данном случае. Даже в таком случае понимание механизма не является необходимым для получения и применения вариантов осуществления настоящего изобретения. Хотя индуцированные релаксином повышения КФ не были измерены у людей, небольшое открытое исследование показало, что релаксин повышает почечный кровоток у здоровых волонтеров (Smith и др., J. Am. Soc. Nephrol. 17, 2006, с.3192-3197). В клинических исследованиях пациентов со склеродермой (Seibold и др., Ann. Intern. Med. 132, 2000, с.871-879) релаксин приводит к устойчивому облегчению прогнозировавшегося клиренса креатинина. Относительно периода после инфузии повышение на 9 сутки креатинина и АМК фиксируют после внутривенного введения релаксина в дозах, равных 960 мкг/кг/сутки, которые спонтанно устраняются на 30 сутки. Ни одно из повышений креатинина не превышает 0,5 мг/дл, величины, которую обычно используют в качестве определения ухудшения функции почек, и не было клинических проявлений побочных эффектов в почках. В самом деле, доза 960 мкг/кг/сутки ассоциирована с существенными повышениями СИ. Возможно, что такая высокая доза стимулирует противоположные регуляторные системы, приводящие к возобновленным гемодинамическим ответам, ассоциированным с пониженной перфузией почек и поздним повышением АМК и креатинина. В самом деле, 32- и 48-часовые гемодинамические измерения после дозы 960 мкг/кг/сутки, касающиеся давления заклинивания в капиллярах легочной артерии и давления в правом предсердии, проявляют тенденцию к повышению относительно исходного уровня, причем эффект отсутствует при других дозах. Эти результаты означают, что внутривенно введенный релаксин в дозе 960 мкг/кг/сутки может иметь некоторые ограниченные дозой побочные воздействия и на гемодинамику, и на функцию почек. Максимально переносимая доза (МПД) без медицинского контроля может быть определена в настоящем исследовании в диапазоне 240-480 мкг/кг/сутки. Интересно, что дозы релаксина в диапазоне 10-100 мкг/кг/сутки проявляют более выраженный эффект, чем повышенные дозы, в отношении ДЗКЛА, СКД и NT-pro-BNP, хотя повышенные дозы в диапазоне 240-960 мкг/кг/сутки проявляют тенденцию к повышенному воздействию на СО и СИ. Дозы в более низком диапазоне могут привести к обычному венозному сокращению (пониженному ДЗКЛА без соответствующего изменения СО/СИ), хотя повышенные дозы могут привести к большей артериальной вазодилатации (повышенная величина СО/СИ).

Таблица 3.
Исходные уровни и отклонения от них сердечных и гемодинамических параметров
Группа А Группа Б Группа В
Степень инфузии (мкг/кг/сутки) 10 30 100 240 480 960 960 960
Длительность инфузии (ч) 8 8 8 8 8 8 8 24
Исходный уровень ЧСС (ударов/мин) 71,5±11,2 67,5±6,1 66,2±11,5
Отклонение от исходного уровня 3,3±7,6 2,3±16,2 0,5±1,3 1,7±6,7 -1,8±4,5 1,8±3,4 2,5±4,3 0,67±3,6
Исходный уровень СКД (мм Hg) 128,5±18,0 109,2±11,6 118,3±20,0
Отклонение от исходного уровня -12,5±9,3 -5,3±16,8 -13,0±8,3 -2,5±7,4 2,2±5,6 -3.0±5,1 -1,3±4,7 -7,3±9.5
Исходный уровень ДКД (мм Hg) 59,5±5,2 55,3±6,1 55,3±9,7
Отклонение от исходного уровня -3,0±4,2 2,5±10,9 -5,0±3,7 3.0±6,0 0,0±7.2 -0,3±6,8 -4,8±5,4 -6,5±7,5
Исходный уровень СИ (л/мин/м2) 2,1±0,4 2,3±0,2 2,1±0,2
Отклонение от исходного уровня 0,08±0,3 0,25±0,4 0,25±0.2 0,28±0,2 0,17±0,3 0,25±0,3 0,43±0,3 0,67±0,15*
Исходный уровень МСВ (л/мин) 4,0±0,7 4,8±0,5 4,1±0,6
Отклонение от исходного уровня 0,13±0,5 0,45±0,6 0,45±0,2 0,62±0,4 0,33±0,7 0,48±0.7 0,85±0,5 1,25±0,03*
Исходный уровень ССС (дин·сек/см5) 1518±268 1011±127# 1254±239
Отклонение от исходного уровня -143±140 -171±159 -288±92 -150±138 -12±219 -102±248 -255±188 -395±217*
Исходный уровень ДПП (мм Hg) 12,8±10,0 11,7±5,0 10,3±
6,1
Отклонение от исходного уровня 0,8±0,9 -1,0±1,8 -0,8±1,2 0,3±1,4 0,5±1,1 0,8±1,2 -1,2±2,9 -1,5±2,7
Исходный уровень ЛАД (мм Hg) 29,8±2,8-3,75±4,1 -4,0±
5,5
-4,5±4,2 27,5±5,4-1,7±1,6 1,,7±2,7 0,3±3,7 32,7±8,9-3,2±~ 3.1 -5,0±3,4
Отклонение от исходного уровня
Исходный уровень ДЗКЛА (мм Hg) 19,8±1,7 19,3±4,8 19,8±4.2
Отклонение от исходного уровня -1,8±1,9 -5,0±2,6* -3,5±3,7 -1,5±1,9 0,33±2,6 -0,17
±2,7
-2,5±3,5 -3,5±3,0
Исходный уровень ЛСС (дин·сек/см5) 193,5
±67,2
127,7±29,0 267,2±168,1§
Отклонение от исходного уровня -17,3±60,5 -0,5±56,7 -25,3±28,9 -14,8±16,9 5,5±35,2 3,3±27,5 -58,5±69,4 -82,5
±55,5*
СИ = сердечный индекс; МСВ = минутный сердечный выброс; ДЗКЛА = давление заклинивания в капиллярах легочной артерии; ССС/ЛСС = системное сосудистое сопротивление/легочное сосудистое сопротивление; СКД = систолическое кровяное давление; ДКД = диастолическое кровяное давление; ЛАД = среднее легочное артериальное давление; ДПП = давление в правом предсердии; ЧСС = частота сердечных сокращений.

Применены средние величины ± среднеквадратическое отклонение.

*Р<0,05 по сравнению с исходным уровнем.

#Группа А против группы Б. §Группа Б против группы В.

Заключение. Целью пилотного исследования является определение безопасности и устойчивости релаксина при введении пациентам с установленной хронической сердечной недостаточностью. Это исследование представляет первое терапевтическое применение релаксина при сердечной недостаточности у людей. Многочисленные заключения следуют из клинических исследований хронической СН. По всему дозовому диапазону релаксин не показывает существенных побочных эффектов. Релаксин вызывает лечебные гемодинамические эффекты, параллельные с изменениями NT-pro BNP, т.е. повышение сердечного индекса, которому свойственен повышенный ударный объем крови, снижение легочного давления заклинивания и системное сосудистое сопротивление без индукции гипотонии. Релаксин быстро улучшает маркеры функции почек (креатинин, АМК). При наивысшей дозе он вызывает небольшое и спонтанно восстанавливаемое повышение маркеров почек после инфузии. Следовательно, максимально переносимая доза релаксина без медицинского контроля в настоящем исследовании составляет 240-480 мкг/кг/сутки.

Вкратце, IV релаксин, введенный пациентам с хронической устойчивой сердечной недостаточностью, приводит к сокращению сосудов с последующим снижением давления заклинивания и повышением ударного объема крови. Существенного снижения кровяного давления не наблюдают из-за размера группы, особенностей пациентов, включенных в группу, и/или дополнительных свойств релаксина. Помимо гемодинамических эффектов внутривенное введение релаксина индуцирует раннее снижение креатинина и АМК, что может быть положительным свойством при введении пациентам с ОСН. МПД релаксина идентифицируют в настоящем исследовании, основываясь на позднем повышении давления заклинивания в капиллярах легочной артерии и давления в правом предсердии, а также креатинина и АМК после изучения прерывания применения лекарственного средства при наивысшей дозе внутривенно введенного релаксина (960 мкг/кг/сутки). Таким образом, во время первого терапевтического применения внутривенного релаксина пациентами с сердечной недостаточностью профиль безопасности и эффективности релаксина показывает, что такое применение эффективно для лечения хронической и стабильной сердечной недостаточности.

Пример 2

Введение релаксина пациентам с системным склерозом

Общие сведения. Клинические исследования с применением релаксина также были проведены на пациентах с системным склерозом. 257 человек, больных системным склерозом, который является тяжелым фиброзным заболеванием, лечат релаксином путем непрерывной и подкожной инфузии в течение 6 месяцев. Результаты, которые включают информацию об обширной и длительной безопасности, показывают, что эти пациенты не испытывают каких-либо серьезных понижений кровяного давления в результате применения релаксина (фиг.12), подтверждая последующие результаты исследования ЗСН. Исследования системного склероза показывают, что введение релаксина ассоциировано со стабильным снижением кровяного давления без серьезных случаев гипотонии и со статистически существенным повышением расчетного клиренса креатинина (см. фиг.13). Эти результаты поддерживают гипотезу, что введение релаксина ассоциировано со сбалансированной системой и расширением сосудов почек.

Кроме того, 570 человек лечили релаксином в 13 полноценных исследованиях. К этим субъектам относятся пациенты с фибромиалгией, женщины с пересаженными яйцеклетками, беременные женщины перед родами, здоровые волонтеры женщины и мужчины, здоровые взрослые, проходящие ортодонтическую терапию, и пациенты с системным склерозом.

Результаты и заключения. Релаксин может быть безопасно введен субъектам с различным состоянием здоровья. В ряде подобных исследований полученные данные показывают, что релаксин вызывает сбалансированное расширение системных и почечных кровеносных сосудов.

Различные вариации и модификации настоящего изобретения будут понятны специалистам в данной области без отклонения от области охвата и сущности настоящего изобретения. Хотя настоящее изобретение описано в связи со специфическими предпочтительными вариантами его осуществления, следует учитывать, что формулу настоящего изобретения не следует ограничивать указанными конкретными вариантами его осуществления. В самом деле, различные модификации описанных способов осуществления настоящего изобретения, которые ясны специалистам в данной области, также подпадают под область охвата настоящего изобретения.

1. Способ лечения сердечной недостаточности, включающий введение человеку фармацевтически активного релаксина Н2 в терапевтически эффективном количестве для снижения частоты декомпенсации, частоты или продолжительности госпитализации, или риска смерти из-за сердечной недостаточности указанного субъекта, по сравнению с лечением без релаксина, причем у указанного субъекта имеется хроническая и стабильная компенсированная застойная сердечная недостаточность на момент начала указанного введения.

2. Способ по п.1, в котором релаксин вводят в диапазоне доз 10-480 мкг/кг в сутки.

3. Способ по п.2, в котором введение релаксина не вызывает побочного эффекта, выбранного из группы, состоящей из гипотонии, тахикардии, аритмии и ухудшенной функции почек.

4. Способ по п.1, в котором указанная декомпенсация включает требующий внеплановой медицинской помощи симптом, выбранный из группы, состоящей из одышки, отека и усталости.

5. Способ по п.1, в котором указанная декомпенсация включает один или несколько следующих признаков: повышенное удержание жидкости в организме, гипотония, гипертония, аритмия, пониженный почечный кровоток, повышенные уровни циркулирующего мозгового натрийуретического пептида (BNP или N-концевой pro-BNP), повышенные уровни азота мочевины крови (АМК) и повышенные уровни креатинина.

6. Способ по п.1, в котором указанное введение дополнительно приводит к снижению одного или нескольких следующих признаков: системное сосудистое сопротивление, давление заклинивания в капиллярах легочной артерии, легочное сосудистое сопротивление, азот мочевины крови, креатинин и циркулирующий N-концевой прогормон мозгового натрийуретического пептида.



 

Похожие патенты:
Изобретение относится к области медицины, а именно к анестезиологии и реаниматологии, и касается профилактики синдрома малого сердечного выброса (СМСВ) и его осложнений у пациентов после репротезирования клапанов сердца.

Изобретение относится к новым замещенным дигидропиразолонам формулы (I) и его фармацевтически приемлемым солям, обладающим свойствами ингибитора HIF- пролил-4-гидрооксилазы.

Изобретение относится к производным оксазолопиримидина в любой из их стереоизомерных форм или в виде смеси стереоизомерных форм, указанным в пункте 1 формулы изобретения.

Предложено применение селективного ингибитора фактора коагуляции Ха 5-хлор-N-({(5S)-2-оксо-3-[4-(3-оксо-4-морфолинил)фенил]-1,3-оксазолидин-5-ил}метил)-2-тиофенкарбоксамида (ривароксабана) для лечения и/или профилактики сердечной недостаточности.
Изобретение относится к медицине, а именно к кардиологии и пульмонологии, и касается лечения больных хронической обструктивной болезнью легких и ишемической болезнью сердца с сердечной недостаточностью, осложнившейся анемией.

Изобретение относится к производным N-гидроксилсульфонамида формул (I) или (III), где R1 представляет собой Н; R2 представляет собой H; n представляет собой 0; b является целым числом в диапазоне 1-4; R3, R4 , R5, R6 и R7 независимо выбраны из Н, галогена, карбоксила, сложного эфира карбоксила, выбранного из группы, включающей -С(O)O-морфолино, -С(O)O-С1-С 8алкил и -С(O)O-замещенный С1-С8алкил, где заместителем является морфолино; ациламино, представляющего собой группу -C(O)NRaRb, где Ra и Rb независимо представляют собой С1-С 8алкил, или Ra и Rb вместе с атомом азота, к которому они присоединены, образуют морфолино; и сульфониламино, представляющего собой группу SO2NR2, где две группы R вместе с атомом азота, к которому они присоединены, образуют морфолино; R8 выбран из галогена и карбониламино, выбранного из группы -CONH-замещенный С1-С8 алкил, где заместителем является морфолино; и -CONR2 , где две группы R вместе с атомом азота, к которому они присоединены, образуют морфолино; С представляет собой гетероароматический цикл, содержащий циклические фрагменты Q9, Q10 , Q11, Q12, Q13 и Q14 , которые независимо выбраны из С, СН и S, при условии, что по меньшей мере один из фрагментов Q9, Q10 , Q11, Q12, Q13 и Q14 представляет собой S.

Изобретение относится к фармацевтической промышленности, в частности к фармацевтической композиции для лечения кардиомиопатии. .

Изобретение относится к химико-фармацевтической промышленности, конкретно к (1-гидрокси-4,5-диметил-1H-имидазол-2-ил)(фенил)метаноноксиму формулы (I): проявляющему антиаритмическую активность, что делает возможным использование этого соединения в медицине в качестве фармацевтического средства.

Изобретение относится к области биохимии. Предложен ПЭГ-модифицированный эксендин или аналог эксендина, содержащий одно или более ПЭГ-производных (варианты).
Изобретение относится к медицине, а именно к онкологии, и может быть использовано при лечении глиальных опухолей головного мозга. .

Изобретение относится к медицинскому пластырю, который может снабжать поврежденную кожу или открытые раны активным веществом, способствующим ускорению или улучшению заживления ран.
Изобретение относится к медицине, а именно к онкологии, и может быть использовано для лечения базально-клеточного рака кожи. .
Изобретение относится к медицине, а именно к диетологии, и может быть использовано для получения пищевой композиции для кормления грудных детей. .
Изобретение относится к медицине, а именно к реаниматологии, и может быть использовано для лечения пострадавших с тяжелой сочетанной черепно-мозговой травмой (ЧМТ).

Изобретение относится к области фармацевтики. .
Изобретение относится к медицине, а именно к офтальмологии, и предназначено для лечения кровоизлияний в сетчатке глаза и/или стекловидном теле глаза. Для этого проводят сеанс подкожного введения в область сосцевидного отростка препарата «Гистохром» в объеме 0,5 мл, в область височной ямки - препарата «Эхинацея композитум» в объеме 1,0 мл, парабульбарно - препарата «Гемаза» 2500-5000 МE, разведенного на препарате «Лимфомиозот», в объеме 0,5-1,0 мл. Курс лечения составляет 10-15 сеансов, проводимых ежедневно или через день. Способ обеспечивает ускоренное рассасывание внутриглазных кровоизлияний, предупреждение повреждений сетчатки токсическими продуктами распада, повышение остроты зрения. 3 пр.
Наверх