Иммуногенная композиция для применения в вакцинации против стафилококков



Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков
Иммуногенная композиция для применения в вакцинации против стафилококков

 


Владельцы патента RU 2521501:

ГлаксоСмитКлайн Байолоджикалз С.А. (BE)

Изобретение относится к области иммунологии, молекулярной биологии и генетической инженерии. Предложена иммуногенная композиция, содержащая смесь стафилококковых белков, и включающая стафилококковый белок, связывающий внеклеточный компонент, и стафилококковый транспортный белок, или стафилококковый белок, связывающий внеклеточный компонент, и стафилококковый регулятор вирулентности или токсин, или стафилококковый транспортный белок и стафилококковый регулятор вирулентности или токсин. Также предложены вакцины, способы лечения, применения и способы получения стафилококковой вакцины. Изобретение может быть использовано в медицине для лечения и предупреждения стафилококковой инфекции. 10 н. и 13 з. п. ф-лы, 8 табл., 7 ил., 8 пр.

 

Область изобретения

Настоящее изобретение относится к области стафилококковых иммуногенных композиций и вакцин, их изготовлению и применению таких композиций в медицине. Более конкретно, оно относится к вакцинным композициям, содержащим комбинацию антигенов для лечения или предупреждения стафилококковой инфекции. Также предложены способы применения таких вакцин в медицине и способы их приготовления.

Предшествующий уровень техники

Число как внебольничных, так и внутрибольничных инфекций увеличилось за последние годы с увеличением применения внутрисосудистых устройств. Внутрибольничные (нозокомиальные) инфекции являются основной причиной заболеваемости и смертности, более конкретно в США, где они поражают более 2 миллионов пациентов ежегодно. Согласно различным исследованиям, примерно 6 процентов американских пациентов приобретают инфекцию во время их пребывания в больнице. Оценили, что экономическое бремя в США в 1992 г.превысило более чем 4,5 биллиона долларов (Emori and Gaynes, 1993, Clin. Microbiol. Rev. 6; 428). Наиболее частыми инфекциями являются инфекции мочеполового тракта (UTI-33% инфекций), затем пневмония (15,5%), хирургические раневые инфекции (14,8%) и первичные инфекции кровообращения (13%) (Emori and Gaynes, 1993, Clin. Microbiol. Rev. 6; 428)).

Staphylococcus aureus, коагулазо-отрицательные стафилококки (чаще всего Staphylococcus epidermidis), Enterococcus spp, Esherichia coli и Pseudomonas aeruginosa являются основными нозокомиальными патогенами. Хотя эти патогены вряд ли вызывают одно и то же количество инфекций, тяжесть расстройств, которые они могут вызывать, вместе с частотой устойчивых к антибиотикам изолятов, сдвигают это равновесие в сторону S. aureus и S. epidermidis, как являющихся наиболее значимыми нозокомиальными патогенами.

Staphylococcus aureus является наиболее частой причиной внутрибольничных инфекций со значительной заболеваемостью и смертностью (Romero-Vivas et al., 1995, Infect. Dis. 21; 1417). Он является причиной некоторых случаев остеомиелита, эндокардита, септического артрита, пневмонии, абсцессов и синдрома токсического шока.

S. epidermidis является нормальным кожным комменсалом, который является также важным оппортунистическим патогеном, ответственным за инфекции имплантированных медицинских устройств и инфекции хирургических ран. Медицинские устройства, инфицированные S. epidermidis, включают в себя водители ритма сердца, цереброспинальные шунты, катетеры для постоянного перитонеального диализа в амбулаторных условиях, ортопедические устройства и искусственные клапаны сердца.

Инфекции S. aureus и S. epidermidis лечат антибиотиками, причем пенициллин является лекарством выбора, тогда как ванкомицин используют для метициллин-устойчивых изолятов. Процент штаммов стафилококков, проявляющих широкий спектр устойчивости к антибиотикам, стал все больше увеличиваться с 1980-х гг.(Panlilo et al., 1992, Infect. Control. Hosp. Epidemiol. 13; 582), представляя угрозу для эффективной противомикробной терапии. Кроме того, недавнее появление ванкомицин-устойчивого штамма S. aureus вызвало опасение, что появятся и распространятся метициллин-устойчивые штаммы S. aureus, для которых не существует эффективной терапии.

Исследовали альтернативный подход с использованием антител против стафилококковых антигенов в пассивной иммунотерапии. Терапия, включающая введение поликлональных антисывороток, находится в стадии разработки (WO 00/15238, WO 00/12132), а также лечение моноклональным антителом против липотейхоевой кислоты (WO 98/57994).

Альтернативный подход мог бы представлять собой применение активной вакцинации для индукции иммунного ответа против стафилококков. Идентифицированы несколько кандидатов для включения в качестве вакцинных компонентов. Они включают в себя фибронектин-связывающий белок (US5840846), аналог МНС II (US5648240), фибриноген-связывающий белок (US6008341), GehD (US 2002/0169288), коллаген-связывающий белок (US6288214), SdrF, SdrG и SdrH (WO 00/12689), мутант SEA и экзотоксины SEB (WO 00/02523) и витронектин-связывающий белок 52 кДа (WO 01/60852).

Геном S. aureus секвенирован, и многие кодирующие последовательности идентифицированы (ЕР 786519, WO 02/094868). То же верно и для S. epidermidis (WO 01/34809). Совершенствуя этот подход, другие идентифицировали белки, которые распознаются гипериммунными сыворотками от пациентов, которые перенесли стафилококковую инфекцию (WO 01/98499, WO 02/059148).

Первое поколение вакцин, направленных против S. aureus или против экзопротеинов, которые он продуцирует, не дало больших результатов (Lee 1996 Trends Microbiol. 4; 162). Все еще сохраняется потребность в эффективных вакцинах против стафилококковых инфекций.

Соответственно, в настоящем изобретении предложена иммуногенная композиция, содержащая по меньшей мере два разных белка или их иммуногенных фрагмента, выбранных из по меньшей мере двух групп белков или иммуногенных фрагментов, выбранных из следующих групп:

Группа (а): по меньшей мере одного стафилококкового белка, связывающего внеклеточный компонент, или его иммуногенного фрагмента, выбранного из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase (нейтральной фосфатазы), IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig и MAP.

Группа (б): по меньшей мере одного стафилококкового транспортного белка или его иммуногенного фрагмента, выбранного из группы, состоящей из иммунодоминантного ABC-транспортера, IsdA, IsdB, Mg2+ транспортера, Site и Ni ABC-транспортера.

Группа (в): по меньшей мере одного стафилококкового регулятора вирулентности, токсин или его иммуногенного фрагмента, выбранного из группы, состоящей из альфа-токсина (HIa), мутанта альфа-токсина H35R, РНК Ill-активирующего белка (RAP).

Описание графических материалов

Фиг.1. Полипептидные последовательности предпочтительных белков. В Таблице 1 приведена информация, какой белок представлен каждой SEQ ID.

Фиг.2. Нуклеотидные последовательности, кодирующие предпочтительные белки. В Таблице 1 приведена информация, какой белок кодируется каждой SEQ ID.

Фиг.3. Очистка альфа-токсина в нативных условиях. На панели А показан ПААГ-ДСН (полиакриламидный гель с додецил сульфатом натрия), окрашенный кумасси, образцов, полученных в процессе очистки альфа-токсина. Дорожка 1 - маркеры молекулярной массы, дорожка 2 - растворимая фракция, содержащая сверхэкспрессированный альфа-токсин, дорожка 3 - проскок из Ni-NTA колонки, дорожка 4 - фракции, элюированные 10%-ным буфером В, дорожка 5 - фракции, элюированные 20%-ным буфером В, дорожка 6 - фракции, элюированные 30%-ным буфером В, дорожка 7 - фракции, элюированные 50%-ным буфером В, дорожка 8 - фракции, элюированные 75%-ным буфером В, дорожка 9 и 10 - фракции, элюированные 100%-ным буфером В, дорожка 11 - бактерии при Т=0 перед индукцией, дорожка 12 - бактерии при Т=4 часа после индукции, дорожка 13 - клеточный лизат, дорожка 14 - растворимая фракция, дорожка 15 - нерастворимая фракция.

На панели В показан окрашенный кумасси ПААГ-ДСН 10, 5, 2 и 1 мкл очищенного альфа-токсина.

Фиг.4. Очистка SdrC в денатурирующих условиях. На панели А показан окрашенный кумасси ПААГ-ДСН образцов, полученных в процессе очистки альфа-токсина. Дорожка М - маркеры молекулярной массы, дорожка Старт - супернатант, полученный из нерастворимой фракции, содержащей сверхэкспрессированный SdrC, дорожка FT1 - проскок из Ni-NTA колонки, дорожка С - фракции, элюированные промывочным буфером С, дорожка D - фракции, элюированные буфером D, дорожка Е - фракции, элюированные буфером Е. На панели В показан окрашенный кумасси ПААГ-ДСН 1, 2, 5 и 10 мкл очищенного SdrC.

Фиг.5. Результаты ELISA для антисывороток против стафилококковых белков в планшетах, покрытых очищенными белками.

Pool mice pre - результат с использованием объединенных сывороток, взятых у мышей перед вакцинацией. Pool mice Post III - результат с использованием объединенных мышиных сывороток, взятых после иммунизации. Pool rabbit pre - результат с использованием объединенных сывороток, взятых у кроликов перед вакцинацией. Pool rabbit Post III - результат с использованием объединенных кроличьих сывороток, взятых после иммунизации. BIc - отрицательный контроль.

Фиг.6 - результаты ELISA для мышиных антисывороток, полученных против стафилококковых белков, в планшетах, покрытых убитыми стафилококками.

Для панели А используют планшеты, покрытые убитыми целыми клетками S. aureus серотипа 5. Для панели В используют планшеты, покрытые убитыми целыми клетками S. aureus серотипа 8. Для панели С используют планшеты, покрытые убитыми целыми клетками S. epidermidis.

Линия, обозначенная квадратиками, показывает результат ELISA с использованием антисывороток от мышей, иммунизированных три раза указанным стафилококковым белком. Линия, обозначенная ромбиками, показывает результат ELISA для преиммунных мышиных сывороток.

Фиг.7 - результаты ELISA для кроличьих антисывороток, полученных против стафилококковых белков, в планшетах, покрытых убитыми стафилококками.

Для панели А используют планшеты, покрытые убитыми целыми клетками S. aureus серотипа 5. Для панели В используют планшеты, покрытые убитыми целыми клетками S. aureus серотипа 8. Для панели С используют планшеты, покрытые убитыми целыми клетками S. epidermidis.

Линия, обозначенная квадратиками, показывает результат ELISA с использованием антисывороток от кроликов, иммунизированных три раза указанным стафилококковым белком (за исключением HarA, где осуществляли только одну иммунизацию). Линия, обозначенная ромбиками, показывает результат ELISA для преиммунных кроличьих сывороток.

Подробное описание

В настоящем изобретении раскрыты конкретные комбинации стафилококковых антигенов, которые при объединении приводят к получению иммуногенной композиции, которая эффективна при лечении или предупреждении стафилококковой инфекции. Иммуногенные композиции по изобретению соответственно включают антигены, которые вовлечены в разные функции стафилококков. Такие иммуногенные композиции нацеливают иммунный ответ на разные аспекты функции стафилококков и поэтому способны индуцировать особенно эффективный иммунный ответ.

Стафилококковые инфекции проходят через несколько разных стадий. Например, жизненный цикл стафилококков включает комменсальную колонизацию, инициацию инфекции путем обеспечения доступа к прилежащим тканям или в кровоток, энаэробное размножение в крови, взаимодействие между эпитопами вирулентности S. aureus и защитными механизмами хозяина, и индукцию осложнений, включающих эндокардит, образование метастатического абсцесса и септический синдром. Различные молекулы на поверхности бактерии будут вовлекаться в разные стадии инфекционного цикла. Нацеливая иммунный ответ против эффективного количества комбинации конкретных антигенов, вовлеченных в разные процессы стафилококковой инфекции, можно получить стафилококковую иммуногенную композицию или вакцину с повышенной эффективностью.

В частности, комбинации некоторых антигенов из разных классов, некоторые из которых вовлечены в адгезию к клеткам хозяина, некоторые из которых вовлечены в поглощение железа или другие транспортные функции, некоторые из которых представляют собой токсины или регуляторы вирулентности, и иммунодоминантных антигенов могут вызывать иммунный ответ, который защищает против многих стадий инфекции.

Эффективность иммунного ответа может быть измерена или в анализах на животных моделях, как описано в примерах, и/или с использованием опсонофагоцитарного анализа, как описано в примерах.

Дополнительное преимущество изобретения состоит в том, что комбинация антигенов по изобретению из разных семейств белков в иммуногенной композиции будет способна защищать против более широкого диапазона штаммов.

Изобретение относится к иммуногенным композициям, содержащим множество белков, выбранных из по меньшей мере двух разных категорий белка, имеющих разные функции в стафилококках. Примерами таких категорий белков являются внеклеточные связывающие белки, транспортные белки, такие как белки, осуществляющие захват Fe; токсины или регуляторы вирулентности и другие иммунодоминантные белки. Вакцинные комбинации по изобретению эффективны против гомологичных штаммов стафилококков (штаммов, из которых происходят данные антигены) и предпочтительно также против гетерологичных штаммов стафилококков.

Иммуногенная композиция по изобретению содержит некоторые белки, количество которых равно или больше 2, 3, 4, 5 или 6, выбранных из 2 или 3 следующих групп:

- группы (а) - по меньшей мере одного стафилококкового белка, связывающего внеклеточный компонент, или его иммуногенного фрагмента, выбранного из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig и MAP;

- группы (б) - по меньшей мере одного стафилококкового транспортного белка или его иммуногенного фрагмента, выбранного из группы, состоящей из иммунодоминантного ABC-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC и Ni ABC-транспортера;

- группы (в) - по меньшей мере одного стафилококкового регулятора вирулентности, токсина или его иммуногенного фрагмента, выбранного из группы, состоящей из альфа-токсина (HIa), мутанта альфа-токсина H35R, РНК III-активирующего белка (RAP).

Например, первый белок выбран из группы (а), (б) или (в), и второй белок выбран из группы, выбранной из группы (а), (б) и (в), которая не включает в себя второй белок.

В предпочтительном воплощении иммуногенная композиция по изобретению содержит по меньшей мере один белок, выбранный из группы (а), и дополнительный белок, выбранный из группы (б) и/или группы (в).

В другом воплощении иммуногенная композиция по изобретению содержит по меньшей мере один антиген, выбранный из группы (б), и дополнительный белок, выбранный из группы (в) и/или группы (а).

В другом воплощении иммуногенная композиция по изобретению содержит по меньшей мере один антиген, выбранный из группы (в), и дополнительный белок, выбранный из группы (а) и/или группы (б).

Иммуногенная композиция по изобретению соответственно содержит белки из S. aureus и/или S. epidermidis.

Белки

Иммуногенные композиции по изобретению содержат выделенный белок, содержащий аминокислотную последовательность, которая имеет по меньшей мере 85%-ную идентичность, предпочтительно по меньшей мере 90%-ную идентичность, более предпочтительно по меньшей мере 95%-ную идентичность, наиболее предпочтительно по меньшей мере 97-99%-ную или строгую идентичность с любой последовательностью из фиг.1.

Когда белок конкретно упоминается в данном описании, предпочтительной является ссылка на нативный или рекомбинантный, полноразмерный белок или, возможно, зрелый белок, в котором была удалена сигнальная последовательность. Данный белок может быть выделен непосредственно из стафилококкового штамма или получен методами рекомбинантных ДНК. Иммуногенные фрагменты белка могут быть включены в иммуногенную композицию по изобретению. Они представляют собой фрагменты, содержащие по меньшей мере 10 аминокислот, предпочтительно 20 аминокислот, более предпочтительно 30 аминокислот, более предпочтительно 40 аминокислот или 50 аминокислот, наиболее предпочтительно 100 аминокислот, взятых непрерывно из аминокислотной последовательности белка. Кроме того, такие иммуногенные фрагменты иммунологически реагируют с антителами, полученными против стафилококковых белков, или с антителами, индуцируемыми инфицированием млекопитающего хозяина стафилококками. Иммуногенные фрагменты также включают в себя фрагменты, которые при введении в эффективной дозе (либо отдельно, либо в виде гаптена, связанного с носителем), вызывают защитный иммунный ответ против стафилококковой инфекции, более предпочтительно он является защитным против инфекции S. aureus и/или S. epidermidis. Такой иммуногенный фрагмент может включать, например, белок, не содержащий N-концевой лидерной последовательности, и/или трансмембранного домена, и/или С-концевого якорного домена. В предпочтительном аспекте иммуногенный фрагмент согласно изобретению содержит по существу весь внеклеточный домен белка, который имеет по меньшей мере 85%-ную идентичность, предпочтительно по меньшей мере 90%-ную идентичность, более предпочтительно по меньшей мере 95%-ную идентичность, наиболее предпочтительно по меньшей мере 97-99%-ную идентичность с последовательностью, которая выбрана из фиг.1, по сравнению с полной длиной последовательности фрагмента.

В иммуногенные композиции по изобретению также включены слитые белки, состоящие из стафилококковых белков, или иммуногенные фрагменты стафилококковых белков. Такие слитые белки могут быть получены рекомбинантно и могут содержать один участок из по меньшей мере 2, 3, 4, 5 или 6 стафилококковых белков. Альтернативно, слитый белок может содержать множество участков из по меньшей мере 2, 3, 4 или 5 стафилококковых белков. Они могут объединять разные стафилококковые белки или их иммуногенные фрагменты в одном и том же белке. Альтернативно, изобретение также включает отдельные слитые белки стафилококковых белков или их иммуногенных фрагментов в виде слитого белка с гетерологичными последовательностями, такими как источник Т-клеточных эпитопов или метки для очистки, например: β-галактозидаза, глутатион-8-трансфераза, зеленые флуоресцентные белки (GFP), эпитопные метки, такие как FLAG, myc-метка, полигистидин, или вирусные поверхностные белки, такие как гемагглютинин вируса гриппа, или бактериальные белки, такие как столбнячный анатоксин, дифтерийный анатоксин, CRM197.

Таблица 1

В следующей таблице представлены SEQ ID номера предпочтительных белковых последовательностей и последовательностей ДНК, которые находятся на фиг.1 и фиг.2 соответственно. SA указывает на последовательность из S. aureus, и SE указывает на последовательность из S. epidermidis.

Название Белковая последовательность Последовательность ДНК
Иммунодоминантный АВС-транспортер
SA SEQ ID 1 SEQ ID 34
SE SEQ ID 2 SEQ ID 35
Рецептор ламинина
SA SEQ ID3 SEQ ID 36
SE SEQ ID 4 SEQ ID 37
Секреторный антиген A SsaA
SA1 SEQ ID 5 SEQ ID 38
SA2 SEQ ID 6 SEQ ID 39
SEQ ID 7 SEQ ID 40
SitC
SA SEQ ID 8 SEQ ID 41
SE SEQ ID 9 SEQ ID 42
IsaA/PisA (IssA)
SA SEQID10 SEQ ID 43
SE SEQID11 SEQ ID 44
EbhA/B
SA EbhA SEQID12 SEQ ID 45
SA EbhB SEQID 13 SEQ ID 46
SE EbhA SEQ ID 14 SEQ ID 47
SE EbhB SEQID 15 SEQ ID 48
Белок, ассоциированный с накоплением Аар
SA SEQ ID 16 SEQ ID 49
SE SEQ ID 17 SEQ ID 50
РНК III-активирующий белок RAP
SA SEQ ID 18 SEQ ID 51
SE SEQ ID 19 SEQ ID 52
FIG/SdrG
SA SEQ ID 20 SEQ ID 53
SE SEQ ID 21 SEQ ID 54
Эластин-связывающий белок EbpS
SA SEQ ID 22 SEQ ID 55
SE SEQ ID 23 SEQ ID 56
Внеклеточный белок EFB SA SEQ ID 24 SEQ ID 57
альфа-токсин SA SEQ ID 25 SEQ ID 58
SBI SA SEQ ID 26 SEQ ID 59
IsdA SA SEQ ID 27 SEQ ID 60
IsdB SA SEQ ID 28 SEQ ID 61
SdrC SA SEQ ID 29 SEQ ID 62
ClfA SA SEQ ID 30 SEQ ID 63
FnbA SA SEQ ID 31 SEQ ID 64
ClfB SA SEQ ID 32 SEQ ID 65
Коагулаза SA SEQ ID 33 SEQ ID 66
FnbB SA SEQ ID 67 SEQ ID 71
MAP SA SEQ ID 68 SEQ ID 72
SdrC SA SEQ ID 69 SEQ ID 73
SdrG SA SEQ ID 70 SEQ ID 74

Белки, связывающие внеклеточные компоненты

Белки, связывающие внеклеточные компоненты, представляют собой белки, которые связываются с внеклеточными компонентами хозяина. Термин включает, но не ограничивается адгезинами.

Примеры белков, связывающих внеклеточные компоненты, включают в себя рецептор ламинина (Naidu et al. J. Med. Microbiol. 1992, 36; 177), SitC/MntC/связывающий белок слюны (US5801234, Wiltshire and Foster Infec. Immun. 2001, 69; 5198), EbhA (Williams et al. Infect. Immun. 2002, 70; 6805), EbhB, эластин-связывающий белок (EbpS) (Park et al., 1999, J. Biol. Chem. 274; 2845), EFB (FIB) (Wastfelt and Flock 1995, J. Clin. Microbiol. 33; 2347), SBI (Zhang et al. FEMS Immun. Med. Microbiol. 2000, 28; 211), аутолизин (Rupp et al., 2001, J. Infect. Dis. 183; 1038), ClfA (US6008341, McDevitt et al. Mol. Microbiol. 1994, 11; 237), SdrC, SdrG (McCrea et al. Microbiology 2000, 146; 1535), SdrH (McCrea et al. Microbiology 2000, 146; 1535), липазу GehD (US2002/0169288), SasA, FnbA (Flock et al. Mol Microbiol. 1994, 12; 599, US6054572), FnbB (WO 97/14799, Booth et al., 2001 Infec. Immun. 69; 345), коллаген-связывающий белок Cna (Visai et al., 2000, J. Biol. Chem. 275; 39837), ClfB (WO 99/27109), FbpA (Phonimdaeng et al., 1988 J. Gen Microbiol. 134; 75), Npase (Flock 2001 J. Bacteriol. 183; 3999), IsaA/PisA (Lonenz et al. FEMS Immuno. Med. Microbiol. 2000, 29; 145), SsaA (Lang et al. FEMS Immunol. Med. Microbiol. 2000, 29; 213), EPB (Hussain and Hermann symposium on Staph Denmark 14-17th 2000), SSP-1 (Veenstra et al., 1996, J. Bacteriol. 178; 537), SSP-2 (Veenstra et al., 1996, J. Bacteriol. 178; 537), гепарин-связывающий белок HBP 17 кДа (Fallgren et al., 2001, J. Med. Microbiol. 50; 547), витронектин-связывающий белок (Li et al., 2001, Curr. Microbiol. 42; 361), фибриноген-связывающий белок, коагулазу, Fig (WO 97/48727) и MAP (US 5648240) SitC/MntC/связывающий белок слюны

Он представляет собой ABC-транспортный белок, который является гомологом адгезина PsaA в S. pneumoniae. Он представляет собой высоко иммуногенный липопротеин 32 «Да, который распределен по бактериальной клеточной стенке (Cockayne et al. Infect. Immun. 1998 66; 3767). Он экспрессируется в S. aureus и S. epidermidis в виде липопротеина 32 «Да, а гомолог 40 кДа присутствует в S. hominis. В S. epidermidis он представляет собой компонент железо-регулируемого оперона. Он демонстрирует значительную гомологию для обоих адгезинов, включая FimA Streptococcus parasanguis, и с липопротеинами семейства ABC-транспортеров с доказанными или предполагаемыми транспортными функциями металла железа. Поэтому SitC включают в качестве внеклеточного связывающего белка и в качестве транспортера ионов металлов.

Связывающий белок слюны, раскрытый в US 5801234, также представляет собой форму SitC и может быть включен в иммуногенную композицию по изобретению.

ClfA и ClfB

Оба этих белка обладают фибриноген-связывающей активностью и стимулируют S. aureus к образованию колоний в присутствии плазмы. Они содержат LPXTG-мотив, общий для белков, ассоциированных со стенкой.

ClfA описан в US6008341, и ClfB описан в WO 99/27109. Коагулаза (FppA)

Она представляет собой фибриноген-связывающий белок, который индуцирует S. aureus к образованию колоний в присутствии плазмы. Она описана в ссылках, относящихся к коагулазам: Phonimdaeng et al.. (J. Gen. Microbio. 1988, 134:75-83), Phonimdaeng et al. (Mol Microbiol 1990; 4:393-404), Cheung et al. (Infect Immun 1995; 63:1914-1920) и Shopsin et al. (J. Clin. Microbiol. 2000; 38:3453-3456).

Предпочтительные фрагменты для включения в иммуногенную композицию по изобретению включают в себя зрелый белок, в котором был удален сигнальный пептид (аминокислоты от 27 до С-конца).

Коагулаза имеет три разных домена. Аминокислоты 59-297, которые представляют собой биспиральный участок, аминокислоты 326-505, которые представляют собой пролин- и глицин-обогащенный участок, и С-концевой домен из аминокислот 506-645, который имеет бета-слойную конформацию. Каждый из этих доменов является предпочтительным фрагментом по изобретению.

SdrG - Fbe - EfB/FIG

Fbe представляет собой фибриноген-связывающий белок, который обнаружен во многих изолятах S. epidermidis и имеет выведенную молекулярную массу 119 кДа (Nilsson et al., 1998. Infect, Immun. 66; 2666). Его последовательность родственна последовательности фактора агглютинации из S. aureus (ClfA). Антитела против Fbe могут блокировать связывание S. epidermidis с фибриноген-покрытыми планшетами и с катетерами (Pei and Flock 2001, J. Infect. Dis. 184; 52). Этот белок также описан как SdrG в WO 00/12689. SdrG обнаружен в коагулазо-отрицательных стафилококках и представляет собой ассоциированный с клеточной стенкой белок, содержащий LPXTG-последовательность.

SdrG содержит сигнальный пептид (аминокислоты 1-51), участок, содержащий фибриноген-связывающие сайты и коллаген-связывающие сайты (аминокислоты 51-825), два CnaB домена (аминокислоты 627-698 и 738-809), повторяющийся участок SD (аминокислоты 825-1000) и якорный домен (аминокислоты 1009-1056).

Fbe имеет предполагаемую сигнальную последовательность с сайтом расщепления между аминокислотами 51 и 52. Поэтому предпочтительный фрагмент Fbe содержит зрелую форму Fbe, продолжающуюся от аминокислоты 52 до С-конца (аминокислота 1092).

Домен Fbe от аминокислоты 52 до аминокислоты 825 отвечает за связывание с фибриногеном. Поэтому предпочтительный фрагмент Fbe состоит из аминокислот 52-825 или содержит их.

Участок между аминокислотами 373 и 516 Fbe демонстрирует наибольшую консервативность между Fbe и ClfA. Поэтому предпочтительный фрагмент будет содержать аминокислоты 373-516 Fbe.

Аминокислоты 825-1041 Fbe содержат высоко повторяющийся участок, состоящий из тандемно повторяющихся остатков аспарагиновой кислоты и серина.

Предпочтительные фрагменты SdrG включают в себя полипептиды, в которых сигнальный пептид и/или повторы SD и якорный домен были удалены. Они включают в себя полипептиды, содержащие или состоящие из аминокислот 50-825, аминокислот 50-633, аминокислот 50-597 (SEQ ID NO 2 из WO 03/76470), аминокислот 273-597 (SEQ ID NO 4 из WO 03/76470), аминокислот 273-577 (SEQ ID NO 6 из WO 03/76470) аминокислот 1-549, аминокислот 219-549, аминокислот 225-549, аминокислот 219-528, аминокислот 225-528 из SEQ ID ON:70.

Предпочтительно, полипептид SdrG, имеющий последовательность, по меньшей мере на 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% или 100% гомологичную последовательности из SEQ ID 70, 20 или 21, включен в иммуногенную композицию по изобретению.

Композиции по изобретению возможно содержат фрагмент полипептидов SdrG, описанных выше.

Предпочтительные фрагменты имеют делетированный сигнальный пептид и/или повторяющийся домен SD, и/или якорный домен. Например, последовательности, соответствующие аминокислотам 1-713, 1-549, 225-549, 225-529, 24-717, 1-707, 1-690, 1-680, 1-670, 1-660, 1-650, 1-640, 1-630, 1-620, 1-610, 1-600, 34-707, 44-697, 36-689 из SEQID 76 или последовательностей, имеющих 85%-, 90%-, 92%-, 95%-, 97%-, 98%-, 99%- или 100%-ную идентичность с SEQ ID 70, или 20, или 21.

Предпочтительный фрагмент с делетированным сигнальным пептидом имеет метиониновый остаток на N-конце фрагмента для обеспечения правильной трансляции.

Более предпочтительный фрагмент имеет следующую последовательность:

MEENSVQDVKDSNTDDELSDSNDQSSDEEKNDVINNNQSINTDDNNQIIKKEETNNYDGIEKRSEDRTESTINVDENEATFLQKTPQDNTHLTEEEVKESSSVESSNSSIDTAQQPSHTTINREESVQTSDNVEDSHVSDFANSKIKESNTESGKEENTIEQPNKVKEDSTTSQPSQYTNIDEKISNQDE

LLNLPINEYENKARPLSTTSAQPSIKRVTVNQLAAEQGSNVNHLIKVTDQSITEGYDDSEGVIKAHDAENLIYDVTFEVDDKVKSGDTMTVDIDKNTVPSDLYDSFTIPKIKDNSDEIIATGTYDNKNKQITYTFTDYVDKYENIKAHLKLTSYIDKSKVPNNNTKLDVEYKTALSSVNKTITVEYQRPNENRTANLQSMFTNIDTKNHTVEQTIYINPLRYSAKETNVNISGNGDEDST

IIDDSTIIKVYKVGDNQNLPDSNRIYDYSEYEDVTNDDYAQLGNNNDVNINFGNIDSPYIIKVISKYDPNKDDYTTIQQYVTNQTTINEYTGEFRTASYDNTIAFSTSSGQGQGDLPPEKTYKIGDYVWEDVDKDGIQNTNDNEQPLSNVLVTLTYPDGTSKSVRTDEDGKYQFDGLKNGLTYKITFETPEGYTPTLKHSGTMPALDSEGNSVWVTINGQDDNTIDSGFYQTPKYSLGNY

VWYDTNKDGIQGDDEKDISGVKVTLKDENGNIISTTTTDENGKYQFDNLNSGNYIVHFDKPSGMTQTTTDSGDDDEQDADGEEVHVTITDHDDFSIDNGYYDDE

EbhA и EbhB

EbhA и EbhB представляют собой белки, которые экспрессируются как в S. aureus, так и в S. epidermidis (Clarke and Foster Infect. Immun. 2002, 70; 6680, Williams et al. Infect. Immun. 2002, 20; 6805), и которые связываются с фибронектином. Поскольку фибронектин является важным компонентом внеклеточного матрикса, EbhA и EbhB осуществляют важную функцию в прикреплении стафилококков к внеклеточному матриксу хозяина.

Белки Ebh являются большими, имеющими молекулярную массу 1,1 мегадальтон. Предпочтительно использовать фрагмент белка Ebh, а не полную последовательность из-за легкости получения и приготовления в виде препарата. Центральный участок белка содержит неполные повторы, которые содержат фибронектин-связывающие сайты. Фрагменты, содержащие один или более повторяющихся доменов, описанных ниже, представляют собой предпочтительные фрагменты для включения в иммуногенную композицию по изобретению.

Белки Ebh содержат неполные повторяющиеся единицы длиной 127 аминокислот, которые характеризуются содержанием консенсусной последовательности:

L.G.{10}А.{13}Q.{26}L...M..L.{33}A

Предпочтительно,

.{19}L.G.{10}A.{13}Q. {26}L...M..L.{33}A.{12}

Более предпочтительно,

.....I/V..A...I/V..AK.ALN/DG..NL..AK..A.{6}L..LN.AQK..L..QI/V..A..V..V.{6}A..LN/D.AM..L...I/V.D/E...TK.S.NY/F.N/DAD..K..AY/F..AV..A..I/V.N/D.......

Где '.' означает любую аминокислоту, а '.{10}' означает любые 10 аминокислот, и I/V указывает на альтернативный выбор аминокислоты.

Посредством ссылки на последовательность, раскрытую в Kuroda et al., (2001) Lancet 357; 1225-1240, и Таблицу 2, легко выводят повторяющиеся последовательности в белках Ebh.

Предпочтительные фрагменты, которые могут быть включены в иммуногенную композицию по изобретению, включают в себя полипептиды, содержащие одну, две, три, четыре, пять, шесть, семь, восемь, девять, десять или более 10 127-аминокислотных повторяющихся единиц. Такие фрагменты могут состоять из 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более повторов 127-аминокислотного повторяющегося участка или могут состоять из 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более повторов с дополнительными аминокислотными остатками, присутствующими либо на одном, либо на обоих концах данного фрагмента. Другой предпочтительный фрагмент представляет собой полипептид Н2 примерно 44 кДа, охватывающий три повтора (аминокислоты 3202-3595), как описано в Clarke et al. Infection and Immunity 70, 6680-6687, 2002. Такие фрагменты предпочтительно будут способны связывать фибронектин и/или активировать антитела, которые являются реактивными против целого белка Ebh.

Полипептиды Ebh способны связываться с фибронектином. Предпочтительные фрагменты этих полипептидных последовательностей сохраняют способность связываться с фибронектином. Связывание с фибронектином можно оценить с помощью ELISA, как описано у Clarke с соавт.(Infection and Immunity 70; 6680-6687 2002).

Еще одни предпочтительные фрагменты представляют собой фрагменты, которые содержат В-клеточный или Т-хелперный эпитоп, например те фрагменты/пептиды, которые описаны в Таблицах 3 и 4.

ТАБЛИЦА 2. Повторяющиеся последовательности в полноразмерной последовательности Ebh.

Полноразмерная последовательность Ebh раскрыта в Kuroda et al. (2001) Lancet 357; 1225-1240. В следующей таблице показаны аминокислотные остатки, в которых 127-аминокислотные повторы начинаются и заканчиваются в пределах полноразмерной последовательности.

Начало Конец
1 3204 3330
2 3331 3457
3 3457 3583
4 3583 3709
5 3709 3835
6 3835 3961
7 3961 4087
8 4200 4326
9 4326 4452
10 4452 4578
11 4578 4704
12 4704 4830
13 4830 4956
14 4956 5082
15 5082 5208
16 5208 5334
17 5334 5460
18 5460 5586
19 5585 5711
20 5711 5837
21 5837 5963
22 5963 6089
23 6089 6215
24 6215 6341
25 6341 6467
26 6467 6593
27 6593 6719
28 6719 6845
29 6845 6971
30 6971 7097
31 7097 7223
32 7223 7349
33 7349 7475
34 7475 7601
35 7601 7727
36 7727 7853
37 7852 7978
38 7978 8104
39 8104 8230
40 8230 8356
41 8356 8482
42 8482 8608
43 8604 8730
44 8858 8984

Таблица 3. Предсказание В-клеточного эпитопа для 127-аминокислотного повтора:

Полноразмерная последовательность раскрыта в Kuroda et al. (2001) Lancet 357; 1225-1240. Один из этих повторов, кодируемый аминокислотами 3204-3331 полноразмерной последовательности, был выбран для осуществления предсказания эпитопов:

MDVNTVNQKAASVKSTKDALDGQQNLQRAKTEATNAITHASDLNQAQKNALTQQVNSAQNVHAVNDIKQTTQSLNTAMTGLKRGVANHNQVVQSDNYVNADTNKKNDYNNAYNHANDIINGNAQHPVI

Начало Конец Последовательность эпитопа Старт Стоп
5 10 TVNQKA 3208 3213
14 19 KSTKDA 3217 3222
21 33 DGQQNLQRAKTEA 3224 3236
42 51 DLNQAQKNAL 3245 3254
66 74 DIKQTTQSL 3269 3277
100 112 ADTNKKNDYNNAY 3303 3315
117 123 DIINGNA 3320 3326

- Колонки “Начало” и “Конец” представляют положение предсказанных В-клеточных эпитопов в 127-аминокислотном повторе

- Колонки “Старт” и “Стоп” представляют положение предсказанных В-клеточных эпитопов в полноразмерной последовательности Ebh

Таблица 4. Предсказание Т-хелперного клеточного эпитопа в Ebh: Полноразмерная последовательность раскрыта в базе данных TrEMBL, ссылка на последовательность Q8NWQ6. Один из этих повторов, кодируемый аминокислотами 3204-3331 полноразмерной последовательности, был выбран для осуществления предсказания эпитопов:

MDVNTVNQKAASVKSTKDALDGQQNLQRAKTEATNAITHASDLNQAQKNALTQQVNSAQNVHAVNDIKQTTQSLNTAMTGLKRGVANHNQVVQSDNYVNADTNKKNDYNNAYNHANDIINGNAQHPVI

Положение повтора Последовательность эпитопа Положение последовательности
1 MDVNTVNQK 3204
3 VNTVNQKAA 3206
6 VNQKAASVK 3209
26 LQRAKTEAT 3229
37 ITHASDLNQ 3240
43 LNQAQKNAL 3246
51 LTQQVNSAQ 3254
55 VNSAQNVHA 3258
61 VHAVNDIKQ 3264
64 VNDIKQTTQ 3267
67 IKQTTQSLN 3270
74 LNTAMTGLK 3277
78 MTGLKRGVA 3281
81 LKRGVANHN 3284
85 VANHNQWQ 3288
91 WQSDNYVN 3294
92 VQSDNYVNA 3295
97 YVNADTNKK 3301
98 VNADTNKKN 3302
108 YNNAYNHAN 3311
112 YNHANDIIN 3315
118 IINGNAQHP 3321
119 INGNAQHPV 3322

- Колонка “Положение повтора” представляет положение предсказанных Т-клеточных эпитопов в повторе

- Колонка “Положение последовательности” представляет положение предсказанных Т-клеточных эпитопов в полноразмерной последовательности Ebh

Фрагменты полипептидов по изобретению могут быть использованы для получения соответствующего полноразмерного полипептида посредством пептидного синтеза; поэтому эти фрагменты могут быть использованы в качестве промежуточных для получения полноразмерных полипептидов по изобретению.

Особенно предпочтительными являются варианты, в которых несколько, 5-10, 1-5, 1-3, 1-2 или 1 аминокислот(а) замещены, делетированы или добавлены в любой комбинации.

Эластин-связывающий белок (EbpS)

EbpS представляет собой белок, содержащий 486 аминокислот, с молекулярной массой 83 кДа. Он связан с цитоплазматической мембраной S. aureus и имеет три гидрофобных участка, которые удерживают данный белок в мембране (Downer et al., 2002, J. Biol. Chem. 277; 243; Park et al., 1996, J. Biol. Chem. 271; 15803).

Два участка между аминокислотами 1-205 и 343-486 поверхностно экспонированы на наружной стороне цитоплазматической мембраны. Лиганд-связывающий домен EbpS расположен между остатками 14-34 на N-конце (Park et al., 1999, J. Biol. Chem. 274; 2845).

Предпочтительный фрагмент, который может быть включен в иммуногенную композицию по изобретению, может представлять собой поверхностно-экспонированный фрагмент, содержащий эластин-связывающий участок (аминокислоты 1-205). Некоторые предпочтительные фрагменты не содержат полную экспонированную петлю, но должны содержать эластин-связывающий участок (аминокислоты 14-34). Альтернативный фрагмент, который можно было бы использовать, состоит из аминокислот, образующих вторую поверхностно-экспонированную петлю (аминокислоты 343-486). Также возможны альтернативные фрагменты, содержащие вплоть до 1, 2, 5, 10, 20, 50 и менее аминокислот на одном или обоих концах.

Рецепторы ламинина

Рецептор ламинина из S. aureus играет важную роль в патогенности. Отличительным признаком инфекции является инвазия в кровоток, которая делает возможным системное распространение метастатического абсцесса. Для инвазии в кровоток необходима способность проникать через базальную мембрану сосудов. Это достигается посредством связывания с ламинином через рецептор ламинина (Lopes et al. Science 1985, 229; 275).

Рецепторы ламинина экспонированы на поверхности и присутствуют во многих штаммах стафилококков, включая S. aureus и S. epidermidis.

SBI

Sbi представляет собой белок, имеющий lgG-связывающий участок и аролипопротеин Н-связывающий домен, и он экспрессируется в большинстве штаммов S. aureus (Zhang et al., 1998, Microbiology 144; 985).

N-конец последовательности Sbi имеет типичную сигнальную последовательность с сайтом расщепления после аминокислоты 29. Поэтому предпочтительный фрагмент Sbi, который может быть включен в иммуногенную композицию по изобретению, начинается в аминокислотном остатке 30, 31, 32 или 33 и продолжается до С-конца Sbi, например из SEQ ID NO: 26.

lgG-связывающий домен Sbi был идентифицирован в виде участка около N-конца белка из аминокислот 41-92. Этот домен гомологичен lgG-связывающим доменам протеина А.

Минимальный lgG-связывающий домен Sbi содержит следующую последовательность:

QTTQNNYVTDQQKAFYQVLHLKGITEEQRNQYIKTLREHPERAQEVFSESLK

∗∗ ∗∗∗ ∗ ∗∗∗ ∗ ∗ ∗ ∗ ∗

∗ - означает аминокислоты, которые аналогичны между lgG-связывающими доменами

Предпочтительный фрагмент Sbi, подлежащий включению в иммуногенную композицию по изобретению, содержит lgG-связывающий домен. Этот фрагмент содержит консенсусную последовательность для lgG-связывающего домена, обозначенную ∗, как показано в вышеупомянутой последовательности. Предпочтительно, данный фрагмент содержит или состоит из полной последовательности, приведенной выше. Более предпочтительно, данный фрагмент содержит или состоит из аминокислот 30-92, 33-92, 30-94, 33-94, 30-146, 33-146, 30-150, 33-150, 30-160, 33-160, 33-170, 33-180, 33-190, 33-200, 33-205 или 33-210 Sbi, например из SEQ ID NO:26.

Предпочтительный фрагмент может содержать 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 аминокислотных замен из указанных последовательностей.

Предпочтительные фрагменты могут содержать множественные повторы (2, 3, 4, 5, 6, 7, 8, 9 или 10) lgG-связывающего домена.

EFB-FIB

Fib представляет собой фибриноген-связывающий белок 19 кДа, который секретируется во внеклеточную среду S. aureus. Он продуцируется всеми тестируемыми изолятами S. aureus (Wastfelt and Flock 1995, J. Clin. Microbiol. 33; 2347).

S. aureus агрегирует в присутствии фибриногена и связывается с фибриноген-покрытыми поверхностями. Эта способность облегчает стафилококковую колонизацию катетеров и эндотелиальных клеток.

Fib содержит сигнальную последовательность на N-конце белка с предполагаемым сайтом расщепления примерно в аминокислоте 30. Поэтому предпочтительный фрагмент, который подлежит введению в иммуногенную композицию по изобретению, будет содержать последовательность зрелого белка (от примерно аминокислоты 30 до С-конца белка).

IsaA/PisA

IsaA представляет собой белок 29 кДа, также известный как PisA, который, как было показано, является иммунодоминантным стафилококковым белком во время сепсиса у госпитальных пациентов (Lorenz et al., 2000, FEMS Immunol. Med. Microb. 29; 145).

Полагают, что первые 29 аминокислот последовательности IsaA представляют собой сигнальную последовательность. Поэтому предпочтительный фрагмент IsaA, подлежащий включению в иммуногенную композицию по изобретению, будет содержать аминокислотные остатки с 30 до конца кодируемой последовательности.

Фибронектин-связывающий белок

Фибронектин-связывающий белок A (FnbA) описан в US 5320951 и Schennings с соавт.(1993, Microb. Pathog. 15; 227). Фибронектин-связывающий белок А содержит несколько доменов, которые вовлечены в связывание с фибронектином (WO 94/18327). Они называются D1, D2, D3 и D4. Предпочтительные фрагменты фибронектин-связывающего белка А или В содержат или состоят из D1, D2, D3, D4, D1-D2, D2-D3, D3-D4, D1-D3, D2-D4 или D1-D4 (как описано в WO 94/18327).

Фибронектин-связывающий белок содержит сигнальную последовательность из 36 аминокислот. Например:

VKNNLRYGIRKHKLGAASVFLGTMIWGMGQDKEAA

Возможно, зрелый белок, за исключением этой сигнальной последовательности, включают в иммуногенную композицию по изобретению.

Транспортные белки

Клеточная стенка грамположительных бактерий действует в качестве барьера, предотвращающего свободную диффузию метаболитов в бактерию. Семейство белков контролирует переход необходимых питательных веществ в бактерию и поэтому необходимо для жизнеспособности бактерии. Термин “транспортный белок” охватывает белки, вовлеченные в первоначальную стадию связывания с метаболитами, такими как железо, а также белки, вовлеченные по существу в транспортировку метаболита в бактерию.

Молекулярное железо является незаменимым кофактором для бактериального роста. Секретируются сидерофоры, которые связывают свободное железо и затем захватываются бактериальными поверхностными рецепторами, которые доставляют железо для транспорта через цитоплазматическую мембрану. Поглощение железа является критическим для установления человеческих инфекций, так что выработка иммунного ответа против этого класса белков приводит к потере жизнеспособности стафилококков.

Примеры транспортных белков включают в себя иммунодоминантный ABC-транспортер (Burnie et al., 2000 Infect. Imun. 68; 3200), IsdA (Mazmanian et al., 2002 PNAS 99; 2293), IsdB (Mazmanian et al., 2002 PNAS 99; 2293), Mg2+ транспортер, SitC (Wiltshire and Foster 2001 Infect. Immun. 69; 5198) и Ni ABC-транспортер.

Иммунодоминантный ABC-транспортер

Иммунодоминантный ABC-транспортер представляет собой очень консервативный белок, который может вызывать иммунный ответ, который перекрестно защищает против разных штаммов стафилококков (Mei et al., 1997, Mol. Microbiol. 26; 399). Антитела против этого белка были обнаружены у пациентов с септицемией (Burnie et al., 2000, Infect. Immun. 68; 3200).

Предпочтительные фрагменты иммунодоминантного ABC-транспортера будут включать в себя пептиды DRHFLN, GNYD, RRYPF, KTTLLK, GVTTSLS, VDWLR, RGFL, более предпочтительно KIKVYVGNYDFWYQS, TVIWSHDRHFLYNNV и/или TETFLRGFLGRMLFS, поскольку эти последовательности содержат эпитопы, которые распознаются человеческой иммунной системой.

IsdA-IsdB

Гены isd (железо-регулируемого поверхностного эпитопа) S. aureus кодируют белки, отвечающие за связывание с гемоглобином и переход железа гема в цитоплазму, где оно действует в качестве необходимого питательного элемента. IsdA и IsdB расположены в клеточной стенке стафилококков. IsdA, по-видимому, экспонирован на поверхности бактерии, поскольку он чувствителен к перевариванию протеиназой К. IsdB частично переваривался, что предполагает, что он частично экспонирован на поверхности бактерии (Mazmanian et al., 2003 Science 299; 906).

IsdA и IsdB оба представляют собой белки 29 кДа, которые связывают гем. Их экспрессия регулируется доступностью железа через Fur репрессор. Их экспрессия будет высокой во время инфекции в хозяине, где концентрация железа будет низкой.

Они также известны как FrpA и FrpB (Morrissey et al., 2002, Infect. Immun. 70; 2399). FrpA и FrpB представляют собой главные поверхностные белки с большим зарядом. Было показано, что они обеспечивают основной вклад в адгезию к пластику.

В одном воплощении иммуногенная композиция по изобретению содержит фрагмент IsdA и/или IsdB, который описан в WO 01/98499 или WO 03/11899.

Токсины и регуляторы вирулентности

Члены этого семейства белков включают в себя токсин, такой как альфа-токсин, гемолизин, энтеротоксин В и TSST-1, а также белки, которые регулируют продукцию токсинов, такие как RAP.

Альфа-токсин (Hla)

Альфа-токсин представляет собой важный эпитоп вирулентности, продуцируемый большинством штаммов S. aureus. Он представляет собой порообразующий токсин с гемолитической активностью. Показано, что антитела против альфа-токсина нейтрализуют вредные и летальные эффекты альфа-токсина в животных моделях (Adlam et al., 1977 Infect. Immun. 17; 250). Человеческие тромбоциты, эндотелиальные клетки и мононуклеарные клетки чувствительны к воздействию альфа-токсина.

Высокая токсичность альфа-токсина требует его детоксификации перед использованием в качестве иммуногена. Этого можно достичь путем химической обработки, например путем обработки формальдегидом, глутаральдегидом или другими сшивающими реагентами, или путем его химического конъюгирования с бактериальными полисахаридами, как описано ниже.

Другой путь удаления токсичности состоит во введении точечных мутаций, которые удаляют токсичность, сохряняя при этом антигенность токсина. Введение точечной мутации по аминокислоте 35 альфа-токсина, где гистидиновый остаток замещают лейциновым остатком, приводит к удалению токсичности, тогда как иммуногенность сохраняется (Menzies and Kernodle 1996; Infect. Immun. 64; 1839). Гистидин 35, по-видимому, является критическим для правильной олигомеризации, необходимой для порообразования, и мутация этого остатка приводит к потере токсичности.

При включении в иммуногенные композиции по изобретению альфа-токсин предпочтительно детоксифицируют посредством мутации His 35, наиболее предпочтительно путем замещения His 35 на Leu или Arg. В альтернативном воплощении альфа-токсин детоксифицируют путем конъюгирования с другими компонентами иммуногенной композиции, предпочтительно капсульными полисахаридами, наиболее предпочтительно полисахаридом типа V из S. aureus и/или полисахаридом типа VIII и/или PNAG из S. aureus.

РНК III-активирующий белок (RAP)

RAP сам по себе не является токсином, но представляет собой регулятор экспрессии факторов вирулентности. RAP продуцируется и секретируется стафилококками. Он активирует agr регуляторную систему других стафилококков и активирует экспрессию и последующее высвобождение факторов вирулентности, таких как гемолизин, энтеротоксин В и TSST-1.

Иммунный ответ, вызванный против RAP, не будет убивать бактерию, но будет препятствовать их патогенности. Это имеет преимущество в обеспечении менее селективного давления на появление новых устойчивых штаммов.

Это будет иметь второе преимущество в получении иммунного ответа, который будет выполнять роль инструмента в уменьшении заболеваемости инфекцией.

Особенно предпочтительно объединить RAP с другими антигенами в вакцине, в частности там, где дополнительный антиген будет обеспечивать иммунный ответ, который способен убивать бактерию.

Другие белки

Белок, ассоциированный с накоплением (Аар)

Аар представляет собой белок 140 кДа, который является необходимым для накопления штаммов S. epidermidis на поверхности (Hussain et al. Infect. Immun. 1997, 65; 519). Штаммы, экспрессирующие этот белок, продуцировали значительно большие количества биопленки, и Аар, по-видимому, вовлечен в образование биопленки. Антитела против Аар способны ингибировать образование биопленки и ингибировать накопление S. epidermidis.

Предпочтительным фрагментом Аар является консервативный домен, содержащий или состоящий из аминокислот 550-1069.

Стафилококковый секреторный антиген SsaA

SsaA представляет собой сильно иммуногенный белок 30 кДа, обнаруженный как в S. aureus, так и в S. epidermidis (Lang et al., 2000 FEMS Immunol. Med. Microbiol. 29; 213). Его экспрессия при эндокардите навела на мысль о роли вирулентности, характерной для патогенеза инфекционного заболевания.

SsaA содержит N-концевую лидерную последовательность и сайт расщепления сигнальной пептидазы. За лидерным пептидом следует гидрофильный участок из приблизительно 100 аминокислот от остатка 30 до остатка 130.

Предпочтительный фрагмент SsaA, который подлежит включению в иммуногенную композицию по изобретению, состоит из зрелого белка (аминокислоты от 27 до С-конца или аминокислоты от 30 до С-конца).

Другие предпочтительные фрагменты содержат гидрофильную область SsaA от аминокислоты 30 до аминокислоты 130.

Предпочтительные комбинации

Предпочтительная комбинация белков в иммуногенной композиции по изобретению включает рецептор ламинина и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SitC и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает EbhA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает EbhB и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает EbpS и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает EFB(FIB) и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SBI и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает аутолизин и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает ClfA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SdrC и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SdrG и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R и RAP.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SdrH и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает липазы GehD и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SasA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает FnbA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает FnbB и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает Cna и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает ClfB и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает FbpA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает Npase и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает IsaA/PisA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SsaA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает ЕРВ и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SSP-1 и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает SSP-2 и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает НРВ и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает витронектин-связывающий белок и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает фибриноген-связывающий белок и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает коагулазу и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает Fig и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белков в иммуногенной композиции по изобретению включает MAP и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает иммунодоминантный ABC-транспортер и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает IsdA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает IsdB и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает SitC и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, альфа-токсина, мутанта альфа-токсина H35L или H35R, RAP, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает альфа-токсин и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает вариант альфа-токсина H35L или H35R и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает RAP и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, Аар и SsaA.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает Аар и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, RAP, альфа-токсина и H35L или H35R альфа-токсина.

Другая предпочтительная комбинация белка в иммуногенной композиции по изобретению включает SsaA и 1, 2, 3, 4 или 5 других антигенов, выбранных из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig, MAP, иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, RAP, альфа-токсина и H35L или H35R альфа-токсина.

Изобретатели продемонстрировали, что некоторые антигены продуцируют особенно эффективный иммунный ответ в контексте смеси антигенов. Соответственно, одно воплощение по изобретению представляет собой иммуногенную композицию, содержащую IsaA и стафилококковый транспортный белок, или IsaA и стафилококковый регулятор вирулентности или токсин, или содержащую Sbi и стафилококковый транспортный белок, или Sbi и стафилококковый регулятор вирулентности или токсин, или содержащую SdrC и стафилококковый транспортный белок, или SdrC и стафилококковый регулятор вирулентности или токсин, или IsaA и Sbi, или IsaA и SdrC, или IsaA и аутолизин, или IsaA и Ebh, или Sbi и SdrC, или Sbi и аутолизин, или Sbi и Ebh, или SdrC и аутолизин, или SdrC и Ebh, или аутолизин-глюкозаминидазу и Ebh. Для каждой из этих комбинаций белки могут быть полноразмерными или фрагментами, имеющими последовательности, по меньшей мере на 85%, 90%, 95%, 98% или 100% идентичные последовательностям на фиг.1.

В указанных выше и ниже комбинациях указанные белки, возможно, могут присутствовать в иммуногенной композиции по изобретению в виде фрагмента или слитого белка, как описано выше.

Предпочтительные иммуногенные композиции по изобретению не включают белковые последовательности, раскрытые в WO 02/094868.

Комбинации трех белков

Предпочтительная иммуногенная композиция по изобретению включает три белковых компонента в комбинации альфа-токсина, белка, связывающего внеклеточный компонент (предпочтительно адгезина), и транспортного белка (предпочтительно железо-связывающего белка).

В такой комбинации альфа-токсин может быть химически детоксифицирован или генетически детоксифицирован путем введения точечной(ых) мутации(й), предпочтительно точечной мутации His35Leu. Альфа-токсин присутствует в виде свободного белка или, альтернативно, конъюгирован с полисахаридом или LTA-компонентом иммуногенной композиции.

Предпочтительные комбинации включают:

Иммуногенную композицию, содержащую альфа-токсин, IsdA и белок, связывающий внеклеточный компонент, выбранный из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig и MAP.

Иммуногенную композицию, содержащую альфа-токсин, IsdB и белок, связывающий внеклеточный компонент, выбранный из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, липазы GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig и MAP.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и адгезии, выбранный из группы, состоящей из рецептора ламинина, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), ClfA, SdrC, SdrG, SdrH, аутолизина, FnbA, FnbB, Cna, ClfB, FbpA, Npase, SSP-1, SSP-2, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig и MAP.

Иммуногенную композицию, содержащую альфа-токсин, IsdB и адгезии, выбранный из группы, состоящей из рецептора ламинина, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), аутолизина, ClfA, SdrC, SdrG, SdrH, FnbA, FnbB, Cna, ClfB, FbpA, Npase, SSP-1, SSP-2, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig и MAP.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и рецептор ламинина.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и EbhA.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и EbhB.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и EbpS.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и EFB (FIB).

Иммуногенную композицию, содержащую альфа-токсин, IsdA и SdrG.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и ClfA.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и ClfB.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и FnbA.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и коагулазу.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и Fig.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и SdrH.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и SdrC.

Иммуногенную композицию, содержащую альфа-токсин, IsdA и MAP.

Иммуногенную композицию, содержащую IsaA и Sbi.

Иммуногенную композицию, содержащую IsaA и IsdB.

Иммуногенную композицию, содержащую IsaA и IsdA.

Иммуногенную композицию, содержащую IsaA и SdrC.

Иммуногенную композицию, содержащую IsaA и Ebh или его фрагмент, как описано выше.

Иммуногенную композицию, содержащую Sbi и SdrC.

Иммуногенную композицию, содержащую Sbi и Ebh или его фрагмент, как описано выше.

Иммуногенную композицию по изобретению, содержащую IsaA, Sbi или SdrC.

Отбор антигенов, экспрессирующихся в различных клональных линиях

Анализ встречаемости факторов вирулентности в соответствии с популяционной структурой Staphylococcus aureus показал различное присутствие генов вирулентности в природных популяциях S. aureus.

Показано, что среди клинических изолятов Staphylococcus aureus по меньшей мере пять клональных линий являются широко распространенными (Booth et al., 2001 Infect Immun. 69(1):345-52). Показано, что альфа-гемолизин (л/а), фибронектин-связывающий белок A (fnbA) и фактор агглютинации A (clfA) присутствуют в большинстве изолятов независимо от типа линии, что говорит о важной роли этих белков в выживании S. aureus (Booth et al., 2001 Infect Immun. 69(1):345-52). Более того, согласно Peacock с соавт.(2002), распространение fnbA, clfA, коагулазы, spa, map, pvl (лейкоцидин Пантона-Валентайна, англ. Panton-Valentine leukocidin), hlg (гамма-токсин), альфа-токсина и ica, по-видимому, не связано с основной клональной структурой, что предполагает значительный горизонтальный перенос этих генов.

В противоположность этому, другие гены вирулентности, такие как фибронектин-связывающий белок В (fnbB), бета-гемолизин (hlb), коллаген-связывающий белок (cna), TSST-1 (tst) и ген устойчивости к метициллину (тесА), строго ассоциированы с конкретными линиями (Booth et al., 2001 Infect Immun. 69(1):345-52). Аналогично, Peacock с соавт. в 2002 г. (Infect Immun. 70(9):4987-96) показали, что распределение энтеротоксинов, tst, эксфолатинов (eta и etb), бета- и дельта-токсинов, sdr генов (sdrD, sdrE и bbp), cna, ebpS и efb в популяции в значительной степени связано с MLST-происходящими клональными комплексами.

Данные MLST (Multilocus sequence typing, Мультилокусное типирование последовательностей) не дают никаких доказательств, что штаммы, отвечающие за внутрибольничное заболевание, представляют особую субпопуляцию штаммов, вызывающих внебольничное заболевание, или штаммов, извлеченных из бессимптомных носителей (Feil et al., 2003 J Bacteriol. 185(11):3307-16).

Предпочтительные иммуногенные композиции по изобретению эффективны против стафилококков из разных клональных линий.

В одном воплощении это достигается путем включения 1, 2, 3, 4, предпочтительно по меньшей мере 1 белка, который экспрессируется в большинстве изолятов стафилококков. Примеры таких белков включают в себя альфа-гемолизин (hla), фибронектин-связывающий белок A (fnhA) и фактор агглютинации A (clfA), коагулазу, spa, map, pvl (лейкоцидин Пантона-Валентайна, англ. Panton-Valentine leukocidin), hlg (гамма-токсин) и ica. Авторы изобретения также идентифицировали иммунодоминантный АВС-транспортер, RAP, аутолизин (Rupp et al., 2001, J. Infect. Dis. 183; 1038), рецепторы ламинина, SitC, IsaA/PisA, SPOIIIE (), SsaA, EbpS, SasF (Roche et al., 2003, Microbiology 149; 643), EFB(FIB), SBI, ClfB, IsdA, IsdB, FnbB, Npase, EBP, сиало-связывающий белок II кости, IsaB/PisB (Lorenz et al. FEMS Immuno. Med. Microb. 2000, 29; 145), SasH (Roche et al., 2003, Microbiology 149; 643), MRPI, SasD (Roche et al., 2003, Microbiology 149; 643), SasH (Roche et al., 2003, Microbiology 149; 643), предшественник ауреолизина (AUR)/Sepp1 и новый аутолизин.

В альтернативном воплощении 2 или более белков, которые экспрессируются в разных группах клональных штаммов, включают в иммуногенную композицию по изобретению. Предпочтительно, комбинация антигенов позволит индуцировать иммунный ответ, который будет эффективен против многих клональных штаммов, наиболее предпочтительно, против всех клональных штаммов. Предпочтительные комбинации включают в себя FnbB и бета-гемолизин, FnbB и Cna, FnbB и TSST-1, FnbB и mecA, FnbB и SdrD, FnbB и SdrF, FnbB и EbpS, FnbB и Efb, бета-гемолизин и Cna, бета-гемолизин и TSST-1, бета-гемолизин и mecA, бета-гемолизин и SdrD, бета-гемолизин и SdrF, бета-гемолизин и EbpS, бета-гемолизин и Efb, Cna и TSST-1, Cna и mecA, Cna и SdrD, Cna и SdrF, Cna и EbpS, Cna и Efb, TSST-1 и mecA, TSST-1 и SdrD, TSST-1 и SdrF, TSST-1 и EbpS, TssT-1 и Efb, MecA и SdrD, MecA и SdrF, MecA и EbpS, MecA и Efb, SdrD и SdrF, SdrD и EbpS, SdeD и Efb, SdrF и EbpS, SdrF и Efb, и EbpS и Efb.

Предпочтительные комбинации, описанные выше, могут быть объединены с дополнительными компонентами, описанными ниже.

Отбор антигенов, экспрессирующихся во время различных фаз роста

Стафилококки проходят через экспоненциальную фазу роста, во время которой будет экспрессироваться определенный набор белков. Они включают в себя множество белков, связывающих внеклеточные компоненты, и транспортные белки. После периода экспоненциального роста стафилококки возвращаются в постэкспоненциальную фазу, во время которой рост замедляется, и экспрессия белков изменяется. Многие белки, экспрессирующиеся во время экспоненциальной фазы роста, подавляются, тогда как другие белки, такие как ферменты и большинство токсинов, включая альфа-токсин, экспрессируются на более высоких уровнях.

Предпочтительные иммуногенные композиции по изобретению содержат белок, экспрессирующийся на более высоких уровнях во время экспоненциальной фазы роста, и белок, экспрессирующийся на более высоких уровнях во время постэкспоненциальной фазы.

Термин “более высокие уровни” относится к уровню экспрессии, который выше в одной фазе по сравнению с другой фазой.

В предпочтительном воплощении иммуногенная композиция по изобретению содержит альфа-токсин и белок, связывающий внеклеточный компонент (предпочтительно FnbA, FnbB, ClfA и ClfB), или транспортный белок.

Более предпочтительно, он содержит альфа-токсин, или Cna, или липазу GehD и белок, выбранный из группы, состоящей из рецептора ламинина, SitC/MntC/связывающего белка слюны, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrG, SdrH, SasA, FnbA, FnbB, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, фибриноген-связывающего белка, коагулазы, Fig и MAP, иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC, Ni АВС-транспортера, Аар и SsaA.

В комбинациях, описанных выше, альфа-токсин может быть генетически или химически детоксифицирован, как описано выше, и может быть не конъюгирован или конъюгирован с полисахаридом, как описано ниже.

Полисахариды

Иммуногенные композиции по изобретению предпочтительно дополнительно содержат капсульные полисахариды, включающие один или более чем один PIA (также известный как PNAG), и/или капсульный полисахарид типа V и/или типа VIII S. aureus, и/или капсульный полисахарид типа I, и/или типа II, и/или типа III S. epidermidis.

PIA (PNAG)

В настоящее время очевидно, что различные формы стафилококковых поверхностных полисахаридов, идентифицированых как PS/A, PIA и SAA, имеют одинаковую химическую структурную единицу - PNAG (Maira-Litran et al. Vaccine 22; 872-879 (2004)). Поэтому термин PIA или PNAG охватывает все эти полисахариды или олигосахариды, происходящие из них.

PIA представляет собой полисахаридный межклеточный адгезии и состоит из полимера β-(1→6)-связанного глюкозамина, замещенного N-ацетильными и О-сукцинильными компонентами. Этот полисахарид присутствует как в S. aureus, так и в S. epidermidis и может быть выделен из того и другого источника (Joyce et al., 2003, Carbohydrate Research 338; 903; Maira-Litran et al., 2002, Infect. Imun. 70; 4433). Например, PNAG может быть выделен из штамма S. aureus MN8m (WO 04/43407).

PIA, выделенный из S. epidermidis, является неотъемлемым компонентом биопленки. Он отвечает за опосредование клеточно-клеточной адгезии и, возможно, также функции защиты растущей колонии от иммунного ответа хозяина.

Недавно было показано, что полисахарид, ранее известный как поли-N-сукцинил-β-(1→6)-глюкозамин (PNSG), не имеет предполагаемой структуры, поскольку идентификация N-сукцинилирования была неправильной (Maira-Litran et al., 2002, Infect. Imun. 70; 4433). Поэтому полисахарид, формально известный как PNSG и, как теперь обнаружено, представляющий собой PNAG, также охвачен термином PIA.

PIA (или PNAG) может иметь разные размеры, варьирующие от более 400 «Да до 75-400 кДа до 10-75 кДа для олигосахаридов, состоящих из вплоть до 30 повторяющихся единиц (β-(1→6)-связанного глюкозамина, замещенного N-ацетильными и О-сукцинильными компонентами). Любой размер PIA полисахарида или олигосахарида может быть использован в иммуногенной композиции по изобретению, однако предпочтительным является размер более 40 кДа. Размеры могут быть определены любым способом, известным в данной области, например, посредством микрофлюидизации, обработки ультразвуком или путем химического расщепления (WO 03/53462, ЕР 497524, ЕР 497525).

Предпочтительные диапазоны размеров PIA (PNAG) составляют 40-400 кДа, 40-300 кДа, 50-350 кДа, 60-300 кДа, 50-250 кДа и 60-200 кДа.

PIA (PNAG) может иметь разную степень ацетилирования в результате замены по аминогруппам ацетатом. PIA, полученный in vitro, почти полностью замещен по аминогруппам (95-100%). Альтернативно, может быть использован деацетилированный PIA (PNAG), имеющий менее 60%, предпочтительно менее 50%, 40%, 30%, 20%, 10% ацетилирования. Применение деацетилированного PIA (PNAG) является предпочтительным, поскольку неацетилированные эпитопы PNAG эффективны в опосредовании опсонического лизиса грамположительных бактерий, предпочтительно S. aureus и/или S. epidermidis. Наиболее предпочтительно, PIA (PNAG) имеет размер от 40 кДа до 300 кДа и деацетилирован таким образом, что менее 60%, 50%, 40%, 30% или 20% аминогрупп ацетилированы.

Термин деацетилированный PNAG (dPNAG) относится к PNAG полисахариду или олигосахариду, в котором менее 60%, 50%, 40%, 30%, 20% или 10% аминогрупп ацетилированы.

В одном воплощении PNAG деацетилирован с образованием dPNAG путем химической обработки нативного полисахарида. Например, нативный PNAG обрабатывают щелочным раствором, так что рН становится выше 10. Например, PNAG обрабатывают 0,1-5 М, 0,2-4 М, 0,3-3 М, 0,5-2 М, 0,75-1,5 М или 1 М NaOH, КОН или NH4OH. Обработку осуществляют в течение по меньшей мере 10 или 30 мин, или 1, 2, 3, 4, 5,10, 15 или 20 ч при температуре 20-100, 25-80, 30-60 или 30-50 или 35-45°С. dPNAG может быть получен, как описано в WO 04/43405.

Полисахарид(ы), включенные в иммуногенную композицию по изобретению, предпочтительно конъюгированы с белком-носителем, как описано ниже или, альтернативно, не конъюгированы.

Полисахариды типа 5 и типа 8 из S. aureus

Большинство штаммов S. aureus, которые вызывают инфекцию у людей, содержат полисахариды либо типа 5, либо типа 8. Приблизительно 60% человеческих штаммов представляют собой тип 8 и приблизительно 30% представляют собой тип 5. Структуры капсульных полисахаридных антигенов типа 5 и типа 8 описаны в Moreau et al. Carbohydrate Res. 201; 285 (1990) и Fournier et al. Infect. Immun. 45; 87 (1984). Оба имеют FucNAcp в своей повторяющейся единице, а также ManNAcA, который может быть использован для введения сульфгидрильной группы. Структуры известны как:

Тип 5

→4)-β-D-ManNAcA(3OAc)-(1→4)-α-L-FucNAc(1→3)-β-D-FucNAc-(1→

Тип 8

→3)-(3-D-ManNAcA(4OAc)-(1→3)-α-L-FucNAc(1→3)-β-D-FucNAc-(1→

Недавно (Jones Carbohydrate Research 340, 1097-1106 (2005)) ЯМР-спектроскопия уточнила структуры до:

Тип 5

→4)-β-D-ManNAcA-(1→4)-α-L-FucNAc(3OAc)-(1→3)-β-D-FucNAc-(1→

Тип 8

→3)-β-D-ManNAcA(4OAc)-(1→3)-α-L-FucNAc(1→3)-α-D-FucNAc(1→

Полисахариды могут быть выделены из подходящего штамма S. aureus с использованием способа, хорошо известного специалисту, например, как описано в US 6294177. Например, АТСС 12902 представляет собой штамм S. aureus типа 5, и АТСС 12605 представляет собой штамм S. aureus типа 8.

Полисахариды имеют нативный размер или, альтернативно, могут быть доведены до требуемого размера, например, посредством микрофлюидизации, обработки ультразвуком или путем химической обработки. Изобретение также охватывает олигосахариды, происходящие из полисахаридов типа 5 и 8 из S. aureus.

Полисахариды типа 5 и 8, включенные в иммуногенную композицию по изобретению, предпочтительно конъюгированы с белком-носителем, как описано ниже, или, альтернативно, являются неконъюгированными.

Иммуногенные композиции по изобретению альтернативно содержат полисахарид либо типа 5, либо типа 8.

Антиген 336 из S. aureus

В одном воплощении иммуногенная композиция по изобретению содержит антиген 336 из S. aureus, описанный в US6294177.

Антиген 336 содержит β-связанный гексозамин, не содержит О-ацетильных групп и специфически связывается с антителами к S. aureus типа 336, депонированному под номером АТСС 55804.

В одном воплощении антиген 336 представляет собой полисахарид, который имеет нативный размер или, альтернативно, может быть доведен до требуемого размера, например, посредством микрофлюидизации, обработки ультразвуком или путем химической обработки. Изобретение также охватывает олигосахариды, происходящие из антигена 336.

Антиген 336, включенный в иммуногенную композицию по изобретению, предпочтительно конъюгирован с белком-носителем, как описано ниже, или, альтернативно, является неконъюгированным.

Полисахариды типа I, II и III из S. epidermidis

Штаммы АТСС-31432, SE-360 и SE-10 S. epidermidis характеризуются тремя разными капсульными типами I, II и III соответственно (Ichiman and Yoshida 1981, J. Appl. Bacteriol. 51; 229). Капсульные полисахариды, выделенные из каждого серотипа S. epidermidis, представляют собой полисахариды типа I, II и III. Полисахариды могут быть выделены несколькими способами, включая способ, описанный в US4197290, или как описано в Ichiman et al., 1991, J. Appl. Bacteriol. 71; 176.

В одном воплощении изобретения иммуногенная композиция содержит полисахариды или олигосахариды типа I, и/или II, и/или III из S. epidermidis.

Полисахариды имеют нативный размер или, альтернативно, могут быть доведены до требуемого размера, например, посредством микрофлюидизации, обработки ультразвуком или химического расщепления. Изобретение также охватывает олигосахариды, выделенные из штаммов S. epidermidis.

Эти полисахариды являются неконъюгированными или предпочтительно конъюгированными, как описано ниже.

Конъюгирование полисахаридов

Одной из проблем, связанных с применением полисахаридов при вакцинации, является тот факт, что полисахариды сами по себе являются слабыми иммуногенами. Стратегии, которые были разработаны для преодоления этого отсутствия иммуногенности, включают в себя связывание полисахарида с большими белками-носителями, которые обеспечивают помощь неспецифических Т-клеток. Предпочтительно, чтобы полисахариды, используемые в изобретении, были связаны с белком-носителем, который обеспечивает помощь неспецифических Т-клеток. Примеры таких носителей, которые могут быть конъюгированы с полисахаридными иммуногенами, включают в себя дифтерийный и столбнячный анатоксины (DT, DT crm197 и ТТ соответственно), гемоцианин лимфы улитки (KLH) и очищенное белковое производное туберкулина (PPD), экзопротеин A Pseudomonas aeruginosa (rEPA), протеин D из Haemophilus influenzae, пневмолизин или фрагменты любого из вышеупомянутых. Фрагменты, подходящие для применения, включают в себя фрагменты, охватывающие Т-хелперные эпитопы. В частности, фрагмент протеина D будет предпочтительно содержать N-концевую 1/3 этого белка. Протеин D представляет собой lgD-связывающий белок из Haemophilus influenzae (ЕР 0594610 В1) и является потенциальным иммуногеном.

Кроме того, стафилококковые белки могут быть использованы в качестве белка-носителя в полисахаридных конъюгатах по изобретению. Стафилококковые белки, описанные ниже, могут быть использованы в качестве белка-носителя; например, рецептор ламинина, SitC/MntC/связывающий белок слюны, EbhA, EbhB, эластин-связывающий белок (EbpS), EFB (FIB), SBI, ClfA, SdrC, SdrG, SdrH, липаза GehD, SasA, FnbA, FnbB, Cna, ClfB, FbpA, Npase, IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающий белок, фибриноген-связывающий белок, коагулаза, Fig, MAP, иммунодоминантный ABC-транспортер, IsdA, IsdB, Mg2+ транспортер, SitC, Ni АВС-транспортер альфа-токсина (Hla), мутант альфа-токсина H35R, РНК III-активирующий белок (RAP), или их фрагменты.

Новый белок-носитель, который был бы особенно предпочтительным для применения в случае стафилококковой вакцины, представляет собой стафилококковый альфа-анатоксин. Нативная форма может быть конъюгирована с полисахаридом, поскольку процесс конъюгирования снижает токсичность. Предпочтительно, генетически детоксифицированный альфа токсин, такой как варианты His35Leu или His 35 Arg, используют в качестве носителей, поскольку остаточная токсичность меньше. Альтернативно, альфа-токсин химически детоксифицируют путем обработки сшивающим реагентом, формальдегидом или глутаральдегидом. Генетически детоксифицированный альфа-токсин возможно химически детоксифицируют, предпочтительно путем обработки сшивающим реагентом, формальдегидом или глутаральдегидом, для дополнительного уменьшения токсичности.

Полисахариды могут быть связаны с белком(ами)-носителем(ями) любым известным способом (например, Likhite, патент США №4372945, Armor et al., патент США №4474757, и Jennings et al., патент США №4356170). Предпочтительно, осуществляют химию конъюгирования с CDAP (смотри WO 95/08348).

В CDAP, цианилирующий реагент 1-циано-диметиламинопиридиния тетрафторборат (CDAP) предпочтительно используют для синтеза полисахарид-белковых конъюгатов. Реакция цианилирования может быть осуществлена в относительно мягких условиях, которые избегают гидролиза чувствительных к щелочи полисахаридов. Этот синтез делает возможным прямое связывание с белком-носителем.

Полисахарид солюбилизируют в воде или физиологическом растворе. CDAP растворяют в ацетонитриле и добавляют непосредственно к полисахаридному раствору. CDAP реагирует с гидроксильными группами полисахарида с образованием сложного эфира циановой кислоты. После стадии активации добавляют белок-носитель. Аминогруппы лизина реагируют с активированным полисахаридом с образованием изомочевинной ковалентной связи. После реакции сочетания большой избыток глицина затем добавляют для гашения оставшихся активированных функциональных групп. Продукт затем пропускают через колонку для гель-проникающей хроматографии для того, чтобы удалить непрореагировавший белок-носитель и оставшиеся реагенты.

Конъюгирование предпочтительно включает получение прямой связи между белком-носителем и полисахаридом. Между белком-носителем и полисахаридом возможно можно ввести спейсер (такой как адипиновый дигидрид (ADH)).

Защита против S. aureus и S. epidermidis

В предпочтительном воплощении по изобретению иммуногенная композиция обеспечивает эффективный иммунный ответ против более чем одного штамма стафилококков, предпочтительно против штаммов как S. aureus, так и S. epidermidis. Более предпочтительно, защитный иммунный ответ индуцируется против S. aureus серотипов типа 5 и 8. Более предпочтительно, защитный иммунный ответ индуцируется против многочисленных штаммов S. epidermidis, например штаммов по меньшей мере двух серотипов I, II и III S. epidermidis.

Одно из применений иммуногенной композиции по изобретению состоит в предупреждении внутрибольничных инфекций путем прививки перед лечением в больнице. На этой стадии трудно точно предсказать, воздействию каких штаммов стафилококков будет подвергаться пациент. Поэтому предпочтительно прививать вакциной, которая способна вызывать эффективный иммунный ответ против различных штаммов стафилококков.

Эффективный иммунный ответ определяют как иммунный ответ, который дает значительную защиту в мышиной модели заражения или в анализе опсонофагоцитоза, как описано в примерах. Значительную защиту в мышиной модели заражения, например модели из примера 5, определяют как увеличение LD50 в сравнении с мышами, вакцинированными носителем, по меньшей мере на 10%, 20%, 50%, 100% или 200%. Значительную защиту в модели заражения хлопкового хомяка, например модели из примера 8, определяют как уменьшение среднего измеренного LogKOE/нос по меньшей мере на 10%, 20%, 50%, 70% или 90%. Присутствие опсонизирующих антител, как известно, коррелирует с защитой, поэтому на значительную защиту указывает уменьшение количества бактерий по меньшей мере на 10%, 20%, 50%, 70% или 90% в анализе опсонофагоцитоза, например, в анализе из примера 7.

Некоторые белки, включая иммунодоминантный ABC-транспортер, РНК Ill-активирующий белок, рецепторы ламинина, SitC, IsaA/PisA, SsaA, EbhA/EbhB, EbpS и Аар, являются очень консервативными между S. aureus и S. epidermidis, и пример 8 показывает, что IsaA, ClfA, IsdB, SdrG, HarA, FnbpA и Sbi могут вызывать перекрестный иммунный ответ (например, перекрестную реакцию между по меньшей мере одним штаммом S. aureus и по меньшей мере одним штаммом S. epidermidis). PIA является также очень консервативным между S. aureus и S. epidermidis и способен индуцировать перекрестный защитный иммунный ответ.

Поэтому в предпочтительном воплощении иммуногенная композиция по изобретению будет содержать два, три или четыре вышеупомянутых белка, предпочтительно дополнительно содержащих PIA (PNAG).

Полинуклеотидные вакцины

В другом аспекте настоящее изобретение относится к применению полинуклеотидов из фиг.2 в лечении, предупреждении или диагностике стафилококковой инфекции. Такие полинуклеотиды включают в себя выделенные полинуклеотиды, содержащие нуклеотидную последовательность, кодирующую полипептид, который имеет по меньшей мере 70%-ную идентичность, предпочтительно по меньшей мере 80%-ную идентичность, более предпочтительно по меньшей мере 90%-ную идентичность, еще более предпочтительно по меньшей мере 95%-ную идентичность с аминокислотной последовательностью из фиг.1 относительно полноразмерной последовательности. В этом отношении полипептиды, которые имеют по меньшей мере 97%-ную идентичность, являются весьма предпочтительными, тогда как полипептиды с по меньшей мере 98-99%-ной идентичностью являются более предпочтительными, а полипептиды с по меньшей мере 99%-ной идентичностью являются наиболее предпочтительными.

Другие полинуклеотиды, которые находят применение в настоящем изобретении, включают в себя выделенные полинуклеотиды, содержащие нуклеотидную последовательность, которая имеет по меньшей мере 70%-ную идентичность, предпочтительно по меньшей мере 80%-ную идентичность, более предпочтительно по меньшей мере 90%-ную идентичность, еще более предпочтительно по меньшей мере 95%-ную идентичность с нуклеотидной последовательностью, кодирующей белок по изобретению, относительно полного кодирующего участка. В этом отношении полинуклеотиды, которые имеют по меньшей мере 97%-ную идентичность, являются весьма предпочтительными, тогда как полинуклеотиды с по меньшей мере 98-99%-ной идентичностью являются более предпочтительными, а полинуклеотиды с по меньшей мере 99%-ной идентичностью являются наиболее предпочтительными.

Другие полинуклеотиды включают в себя выделенные полинуклеотиды, содержащие нуклеотидную последовательность, которая имеет по меньшей мере 70%-ную идентичность, предпочтительно по меньшей мере 80%-ную идентичность, более предпочтительно по меньшей мере 90%-ную идентичность, еще более предпочтительно по меньшей мере 95%-ную идентичность с последовательностями из фиг.1. В этом отношении полинуклеотиды, которые имеют по меньшей мере 97%-ную идентичность, являются весьма предпочтительными, тогда как полинуклеотиды с по меньшей мере 98-99%-ной идентичностью являются более предпочтительными, а полинуклеотиды с по меньшей мере 99%-ной идентичностью являются наиболее предпочтительными. Указанный полинуклеотид может быть встроен в подходящую плазмиду или рекомбинантный микроорганизменный вектор и использован для иммунизации (см., например, Wolff et. al., Science 247:1465-1468 (1990); Corr et. al., J. Exp. Med. 184:1555-1560 (1996); Doe et. al., Proc. Natl. Acad. Sci. 93:8578-8583 (1996)).

В настоящем изобретении также предложены нуклеиновая кислота, кодирующая вышеупомянутые белки по настоящему изобретению, и их применение в медицине. В предпочтительных воплощениях выделенные полинуклеотиды согласно изобретению могут быть одноцепочечными (кодирующими или антисмысловыми) или двухцепочечными и могут представлять собой молекулы ДНК (геномные, кДНК или синтетические) или РНК. Дополнительные кодирующие или некодирующие последовательности могут быть представлены, но не обязательно, в пределах полинуклеотида по настоящему изобретению. В других родственных воплощениях в настоящем изобретении предложены полинуклеотидные варианты, имеющие значительную идентичность с последовательностями, раскрытыми в данном описании на фиг.2; полинуклеотидные варианты, содержащие по меньшей мере 70%-ную идентичность последовательностей, предпочтительно по меньшей мере 75%-, 80%-, 85%-, 90%-, 95%-, 96%-, 97%-, 98%- или 99%-ную или более высокую идентичность последовательностей по сравнению с полинуклеотидной последовательностью по этому изобретению с использованием способов, описанных в данном описании (например, BLAST-анализа с использованием стандартных параметров). В родственном воплощении выделенный полинуклеотид по изобретению будет содержать нуклеотидную последовательность, кодирующую полипептид, который имеет по меньшей мере 90%-ную, предпочтительно 95%-ную и выше идентичность с аминокислотной последовательностью на фиг.1 относительно полноразмерной последовательности на фиг.1; или нуклеотидную последовательность, комплементарную указанному выделенному полинуклеотиду.

В изобретении также предложено применение полинуклеотидов, которые комплементарны всем вышеописанным полинуклеотидам.

В изобретении также предложено применение фрагмента полинуклеотида по изобретению, который при введении субъекту обладает теми же иммуногенными свойствами, что и полинуклеотид на фиг.1.

В изобретении также предложено применение полинуклеотида, кодирующего иммунологический фрагмент белка на фиг.1, как определено в данном описании выше. Также предполагается применение таких фрагментов, которые имеют уровень иммуногенной активности по меньшей мере примерно 50%, предпочтительно по меньшей мере примерно 70% и более предпочтительно по меньшей мере примерно 90% от уровня иммуногенной активности полипептидной последовательности, кодируемой полинуклеотидной последовательностью, приведенной на фиг.2.

Полипептидные фрагменты для применения согласно изобретению предпочтительно содержат по меньшей мере примерно 5, 10, 15, 20, 25, 50 или 100 смежных аминокислот или более, включая все промежуточные длины, полипептидной композиции, изложенной в данном описании, такие как те, которые приведены выше.

Полинуклеотиды для применения в изобретении могут быть получены с использованием методов стандартного клонирования и скрининга из библиотеки «ДНК, полученной из мРНК в клетках человеческой пренеопластической или опухолевой ткани (например, легких) (например, Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)). Полинуклеотиды пo изобретению также могут быть получены из природных источников, таких как библиотеки геномной ДНК, или могут быть синтезированы с использованием хорошо известных и коммерчески доступных методов.

Существует несколько способов, доступных и хорошо известных специалистам в данной области для получения полноразмерных «ДНК или для удлинения коротких кДНК, например способов на основе быстрой амплификации концов кДНК (RACE) (см., например, Frohman et al., PNAS USA 85, 8998-9002,1988). Современные модификации этого метода, приведенные в качестве примера в технологии Marathon™ (Clontech Laboratories Inc.), например, имеют значительно упрощенный поиск более длинных кДНК. В технологии Marathon™, кДНК были получены из мРНК, экстрагированной из выбранной ткани, и “адапторной” последовательности, лигированной по каждому концу. Амплификацию нуклеиновых кислот (ПЦР) затем осуществляют для амплификации “недостающего” 5'-конца кДНК с использованием комбинации ген-специфических и адаптор-специфических олигонуклеотидных праймеров. Реакцию ПЦР затем повторяют, используя "гнездовые" праймеры, т.е. праймеры, предназначенные для гибридизации в пределах амплифицированного продукта (типично адаптор-специфический праймер, который гибридизуется дополнительно с 3' в адапторной последовательности, и ген-специфический праймер, который гибридизуется дополнительно с 5' в известной генной последовательности). Продукты этой реакции затем могут быть проанализированы с помощью секвенирования ДНК и полноразмерной кДНК, сконструированной либо путем присоединения продукта непосредственно к существующей кДНК с получением полной последовательности, либо путем осуществления отдельной полноразмерной ПЦР с использованием информации о новой последовательности для конструирования 5'-праймера.

Векторы, содержащие такие ДНК, хозяева, трансформированные ими, и сами по себе укороченные или гибридные белки, экспрессирующиеся, как описано в данном изобретении ниже, все являются частью изобретения.

Экспрессирующая система также может представлять собой рекомбинантный живой микроорганизм, такой как вирус или бактерия. Интересующий ген может быть встроен в геном живого рекомбинантного вируса или бактерии. Иммунизация и инфицирование in vivo этим живым вектором будет приводить к экспрессии антигена in vivo и индукции иммунных ответов.

Поэтому в некоторых воплощениях полинуклеотиды, кодирующие иммуногенные полипептиды для применения согласно настоящему изобретению, вводят в подходящие хозяйские клетки млекопитающих для экспрессии с использованием любой из множества известных вирусных систем. В одном иллюстративном воплощении ретровирусы обеспечивают удобную и эффективную основу для систем генной доставки. Выбранная нуклеотидная последовательность, кодирующая полипептид для применения в настоящем изобретении, может быть встроена в вектор и упакована в ретровирусные частицы с использованием методов, известных в данной области. Рекомбинантный вирус затем может быть выделен и доставлен субъекту. Описан целый ряд иллюстративных ретровирусных систем (например, патент США №5219740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; и Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop.3:102-109.

Кроме того, был описан также целый ряд иллюстративных аденовирусных систем. В отличие от ретровирусов, которые интегрируют в хозяйский геном, аденовирусы персистируют внехромосомно, минимизируя таким образом риски, связанные с инсерционным мутагенезом (Haj-Ahmad and Graham (1986) J. Virol. 57:267-274; Bett et al. (1993) J. Virol. 67:5911-5921; Mittereder et al. (1994) Human Gene Therapy 5:717-729; Seth et al. (1994) J. Virol. 68:933-940; Barr et al. (1994) Gene Therapy 1:51-58; Berkner, K. L. (1988) BioTechniques 6:616-629; и Rich et al. (1993) Human Gene Therapy 4:461-476).

Для доставки полинуклеотидов были разработаны также различные адено-ассоциированные вирусные (AAV) векторные системы. AAV-векторы могут быть легко сконструированы с использованием методов, хорошо известных в данной области. См., например, патенты США №№5173414 и 5139941; международные публикации №№ WO 92/01070 и WO 93/03769; Lebkowski et al. (1988) Molec. Cell. Biol. 8:3988-3996; Vincent et al. (1990) Vaccines 90 (Cold Spring Harbor Laboratory Press); Carter, B.J. (1992) Current Opinion in Biotechnology 3:533-539; Muzyczka, N. (1992) Current Topics in Microbiol, and Immunol. 158:97-129; Kotin, R.M. (1994) Human Gene Therapy 5:793-801; Shelling and Smith (1994) Gene Therapy 1:165-169; и Zhou et al. (1994) J. Exp. Med. 179:1867-1875.

Дополнительные вирусные векторы, полезные для доставки молекул нуклеиновой кислоты, кодирующих полипептиды для применения в настоящем изобретении, путем генного переноса, включают в себя молекулы, происходящие из семейства поксвирусов, таких как вирус осповакцины и птичий поксвирус. В качестве примера, рекомбинанты на основе вируса осповакцины, экспрессирующие интересующие молекулы, могут быть сконструированы следующим образом. ДНК, кодирующую полипептид, сначала встраивают в подходящий вектор, так что он граничит с промотором вируса осповакцины и фланкирующими последовательностями ДНК вируса осповакцины, такими как последовательность, кодирующая тимидинкиназу (ТК). Этот вектор затем используют для трансфекции клеток, которые одновременно инфицируют вирусом осповакцины. Гомологичная рекомбинация служит для вставки промотора вируса осповакцины плюс гена, кодирующего интересующий полипептид, в вирусный геном. Полученный TK.sup.(-) рекомбинант может быть выбран посредством культивирования клеток в присутствии 5-бромдезоксиуридина и отбора вирусных бляшек, устойчивых с нему.

Система инфекции/трансфекции на основе вируса осповакцины может быть удобно использована для получения индуцибельной, временной экспрессии или коэкспрессии одного или более полипептидов, описанных в данном изобретении, в хозяйских клетках организма. В этой конкретной системе клетки сначала инфицируют in vitro рекомбинантом на основе вируса осповакцины, который кодирует РНК-полимеразу бактериофага Т7. Эта полимераза демонстрирует сильную специфичность в том, что она транскрибирует только матрицы, несущие промоторы Т7. После инфицирования клетки трансфицируют интересующим(и) полинуклеотидом или полинуклеотидами, управляемыми промотором Т7. Полимераза, экспрессирующаяся в цитоплазме из рекомбинанта на основе вируса осповакцины, транскрибирует трансфицированную ДНК в РНК, которая затем транслируется в полипептид трансляционным аппаратом хозяина. Способ обеспечивает высокоуровневую временную цитоплазматическую продукцию больших количеств РНК и продуктов ее трансляции. См., например, Elroy-Stein and Moss, Proc. Natl. Acad. Sci. USA (1990) 87:6743-6747; Fuerst et al. Proc. Natl. Acad. Sci. USA (1986) 83:8122-8126.

Альтернативно, авипоксвирусы, такие как вирусы оспы-дифтерита птиц и оспы канареек, также могут быть использованы для доставки интересующих кодирующих последовательностей. Рекомбинантные авипоксвирусы, экспрессирующие иммуногены из патогенов млекопитающих, как известно, обеспечивают защитный иммунитет при введении видам, не относящимся к птицам. Применение вектора на основе авипоксвирусов особенно желательно у человека и других видов млекопитающих, поскольку члены рода Avipox могут только эффективно реплицироваться в чувствительных видах птиц и поэтому являются неинфекционными в клетках млекопитающих. Способы получения рекомбинантных авипоксвирусов известны в данной области и используют генетическую рекомбинацию, как описано выше в отношении продукции вирусов осповакцины. См., например, WO 91/12882, WO 89/03429 и WO 92/03545.

Любой из множества альфавирусных векторов также могут быть использованы для доставки полинуклеотидных композиций для применения в настоящем изобретении, такие как векторы, описанные в патентах США №№5843723; 6015686; 6008035 и 6015694. Некоторые векторы, основанные на вирусе венесуэльского энцефаломиелита лошадей (VEE), также могут быть использованы, иллюстративные примеры их могут быть найдены в патентах США №№5505947 и 5643576.

Более того, молекулярные конъюгированные векторы, такие как аденовирусные химерные векторы, описанные в Michael et al. J. Biol. Chem. (1993) 268:6866-6869 и Wagner et al. Proc. Natl. Acad. Sci. USA (1992) 89:6099-6103, также могут быть использованы для генной доставки согласно изобретению.

Дополнительная иллюстративная информация об этих и других известных системах доставки на основе вирусов может быть найдена, например, в Fisher-Hoch et al., Proc. Natl. Acad. Sci. USA 86:317-321, 1989; Flexner et al., Ann. N.Y. Acad. Sci. 569:86-103, 1989; Flexner et al., Vaccine 8:17-21, 1990; патенты США №№4603112, 4769330 и 5017487; WO 89/01973; патент США №4777127; GB 2200651; ЕР 0345242; WO 91/02805; Berkner, Biotechniques 6:616-627, 1988; Rosenfeld et al., Science 252:431-434, 1991; Kolls et al., Proc. Natl. Acad. Sci. USA 91-215-219, 1994; Kass-Eisler et al., Proc. Natl. Acad. Sci. USA 90:11498-11502, 1993; Guzman et al., Circulation 88:2838-2848, 1993; и Guzman et al., Cir. Res. 73:1202-1207, 1993.

Рекомбинантные живые микроорганизмы, описанные выше, могут быть вирулентными или аттенуированными различными путями для получения живых вакцин. Такие живые вакцины также являются частью изобретения.

В некоторых воплощениях полинуклеотид может быть интегрирован в геном клетки-мишени. Эта интеграция может происходить в конкретном положении и ориентации посредством гомологичной рекомбинации (замещение гена), или он может встраиваться в случайное, неспецифическое положение (генное усиление). В других воплощениях полинуклеотид может стабильно поддерживаться в клетке в виде отдельного эписомного сегмента ДНК. Такие полинуклеотидные сегменты или “эписомы” кодируют последовательности, достаточные для обеспечения поддержания и репликации, независимой или синхронизированной с клеточным циклом хозяина. Способ, при котором экспрессирующую конструкцию доставляют в клетку, и при котором полинуклеотид остается в клетке, зависит от типа используемой экспрессирующей конструкции.

В другом воплощении изобретения полинуклеотид вводят/доставляют в виде “голой” ДНК, например, как описано в Ulmer et al., Science 259:1745-1749, 1993, и рассмотрено Cohen, Science 259:1691-1692,1993. Захват голой ДНК можно увеличить путем нанесения ДНК на биодеградируемые шарики, которые эффективно транспортируются в клетки.

В еще одном воплощении композиция по настоящему изобретению может быть доставлена с помощью подхода, заключающегося в бомбардировке частицами, многие из которых уже были описаны. В одном иллюстративном примере ускорение частиц в потоке газа может быть достигнуто с помощью устройств, таких как устройства, производимые фирмой Powderject Pharmaceuticals PLC (Oxford, UK) и Powderject Vaccines Inc. (Madison, Wl), некоторые примеры которых описаны в патентах США №№5846796, 6010478, 5865796, 5584807 и патенте ЕР 0500799. Этот подход предлагает безыгольный способ доставки, где сухой порошковый препарат микроскопических частиц, таких как полинуклеотидные или полипептидные частицы, ускоряется до высокой скорости в газовой струе гелия, производимой портативным устройством, проталкивающим частицы в интересующую ткань-мишень.

В родственном воплощении другие устройства и способы, которые могут быть полезны для безыгольной инъекции композиций по настоящему изобретению в потоке газа, включают в себя те, которые предложены фирмой Bioject, Inc. (Portland, OR), некоторые примеры которых описаны в патентах США №№4790824, 5064413, 5312335, 5383851, 5399163, 5520639 и 5993412.

Вакцины

В предпочтительном воплощении иммуногенную композицию по изобретению смешивают с фармацевтически приемлемым эксципиентом, более предпочтительно с адъювантом, с образованием вакцины.

Вакцины по настоящему изобретению предпочтительно содержат адъювант. Подходящие адъюванты включают в себя соль алюминия, такую как гель гидроксида алюминия (квасцы) или фосфат алюминия, но могут представлять собой также соль кальция, магния, железа или цинка, или могут представлять собой нерастворимую суспензию ацилированного тирозина, или ацилированные сахара, катионные или анионные производные полисахаридов или полифосфазены.

Предпочтительно, чтобы был выбран адъювант, который является предпочтительным индуктором либо ТН1-, либо ТН2-типа ответа. Высокие уровни цитокинов Th1-типа обычно способствуют индукции клеточно-опосредованных иммунных ответов на данный антиген, тогда как высокие уровни цитокинов Th2-типа обычно способствуют индукции гуморальных иммунных ответов на данный антиген.

Важно помнить, что различие иммунного ответа Th1- и Th2-типа не является абсолютным. В действительности индивидуум будет поддерживать иммунный ответ, который описывают как являющийся преимущественно Th1 или преимущественно Th2. Однако часто удобно рассматривать семейства цитокинов в контексте того, что описано в мышиных CD4 +ve Т-клеточных клонах Мосманном и Коффманом (Mosmann, T.R. and Coffman, R.L. (1989) TH1-и ТН2-клетки: разные картины секреции лимфокинов приводят к разным функциональным свойствам. Annual Review of Immunology, 7, p145-173). Традиционно, ответы ТМ-типа связаны с продукцией цитокинов INF-γ и IL-2 Т-лимфоцитами. Другие цитокины, часто непосредственно связанные с индукцией иммунных ответов Th1-типа, не продуцируются Т-клетками, например IL-12. В отличие от этого, ответы Th2-типа связаны с секрецией IL-4, IL-5, IL-6, IL-10. Подходящие адъювантные системы, которые стимулируют преимущественно Th1-ответ, включают в себя: монофосфориллипид А или его производное, особенно 3-де-О-ацилированный монофосфориллипид A (3D-MPL) (относительно его приготовления см. GB 2220211 А); и комбинацию монофосфориллипида А, предпочтительно 3-де-О-ацилированного монофосфориллипида А, вместе либо с солью алюминия (например, фосфатом алюминия или гидроксидом алюминия), либо с эмульсией масло в воде. В таких комбинациях антиген и 3D-MPL содержатся в одинаковых дисперсных носителях, обеспечивающих более эффективную доставку антигенных и иммуностимулирующих сигналов. Исследования показали, что 3D-MPL способен дополнительно увеличивать иммуногенность антигена, адсорбированного на квасцах [Thoelen et al. Vaccine (1998) 16:708-14; ЕР 689454-В1].

Улучшенная система включает комбинацию монофосфориллипида А и производного сапонина, в частности комбинацию QS21 и 3D-MPL, как раскрыто в WO 94/00153, или менее реактогенную композицию, где QS21 ослабляют холестерином, как раскрыто в WO 96/33739. Особенно сильный адъювантный препарат, включающий QS21, 3D-MPL и токоферол в эмульсии масло в воде, описан в WO 95/17210, и представляет собой предпочтительный препарат. Предпочтительно, вакцина дополнительно содержит сапонин, более предпочтительно QS21. Препарат также может содержать эмульсию масло в воде и токоферол (WO 95/17210). В настоящем изобретении также предложен способ получения вакцинного препарата, включающий смешивание белка по настоящему изобретению вместе с фармацевтически приемлемым эксципиентом, таким как 3D-MPL. Неметилированные CpG-содержащие олигонуклеотиды (WO 96/02555) также являются предпочтительными индукторами ТН1-ответа и подходят для применения в настоящем изобретении.

Предпочтительными композициями по изобретению являются композиции, образующие липосомную структуру. Композиции, в которых стерин/иммунологически активная сапониновая фракция образует структуру ISCOM, также составляют аспект изобретения.

Соотношение QS21:стерин будет типично находиться в диапазоне от 1:100 до 1:1 мас./мас.

Предпочтительно, когда присутствует избыток стерина, соотношение QS21:стерин составляет по меньшей мере 1:2 мас./мас. Типично, что касается введения человеку, QS21 и стерин будут присутствовать в вакцине в диапазоне от примерно 1 мкг до примерно 100 мкг, предпочтительно от примерно 10 мкг до примерно 50 мкг на дозу.

Липосомы предпочтительно содержат нейтральный липид, например фосфатидилхолин, который при комнатной температуре является предпочтительно некристаллическим, например фосфатидилхолин яичного желтка, диолеоилфосфатидилхолин или дилаурилфосфатидилхолин. Липосомы также могут содержать заряженный липид, который увеличивает стабильность структуры липосома-QS21 для липосом, состоящих из насыщенных липидов. В этих случаях количество заряженного липида составляет предпочтительно 1-20% мас./мас., наиболее предпочтительно 5-10%. Соотношение стерина к фосфолипиду составляет 1-50% (мол./мол.), наиболее предпочтительно 20-25%.

Предпочтительно, композиции по изобретению содержат MPL (3-деацилированный монофосфориллипид А, также известный как 3D-MPL). 3D-MPL известен из GB 2220211 (Ribi) как смесь 3 типов де-О-ацилированного монофосфориллипида А с 4, 5 или 6 ацилированными цепями и производится фирмой Ribi Immunochem, Montana. Предпочтительная форма раскрыта в международной заявке на патент 92/116556.

Подходящими композициями по изобретению являются композиции, в которых липосомы сначала получают без MPL, и MPL затем добавляют, предпочтительно в виде частиц 100 нм. Поэтому MPL не содержится в везикулярной мембране (известен как MPL “снаружи”). Композиции, в которых MPL содержится в везикулярной мембране (известен как MPL “внутри”), также составляют аспект изобретения. Антиген может содержаться внутри везикулярной мембраны или содержаться с наружной стороны везикулярной мембраны. Предпочтительно, растворимые антигены находятся снаружи, а гидрофобные или липидированные антигены содержатся либо внутри, либо снаружи мембраны.

Вакцинные препараты по настоящему изобретению могут быть использованы для защиты или лечения млекопитающего, восприимчивого к инфекции, посредством введения указанной вакцины через системный путь или через слизистые оболочки. Эти введения могут включать в себя инъекцию через внутримышечный, внутрибрюшинный, интрадермальный или подкожный пути; или введение через слизистые оболочки в ротовой/пищеварительный тракт, дыхательные, мочеполовые пути. Интраназальное введение вакцин для лечения пневмонии или отита среднего уха является предпочтительным (поскольку можно более эффективно предупреждать носоглоточное носительство пневмококков, ослабляя таким образом инфекцию на ее самой ранней стадии). Хотя вакцину по изобретению можно вводить в виде однократной дозы, ее компоненты можно также вводить одновременно или в разное время (например, пневмококковые полисахариды можно вводить отдельно, одновременно или через 1-2 недели после введения любого бактериального белкового компонента вакцины для оптимальной координации иммунных ответов относительно друг друга). Что касается совместного введения, то оптимальный ТМ-адъювант может присутствовать в любом из или во всех разных введениях, однако предпочтительно, если он присутствует в комбинации с бактериальным белковым компонентом вакцины. Помимо одного способа введения можно использовать 2 различных способа введения. Например, полисахариды могут быть введены в/м (или интрадермально), и бактериальные белки могут быть введены интраназально (или интрадермально). Кроме того, вакцины по изобретению могут быть введены в/м для первичных доз и интраназально для повторных доз.

Количество конъюгированного антигена в каждой вакцинной дозе выбрано как количество, которое индуцирует иммунозащитный ответ без значительных неблагоприятных побочных эффектов типичных вакцин. Такое количество будет варьировать в зависимости от того, какой специфический иммуноген будут использовать и в каком количестве. Обычно ожидают, что каждая доза будет содержать 0,1-100 мкг полисахарида, предпочтительно 0,1-50 мкг полисахаридных конъюгатов, предпочтительно 0,1-10 мкг, более предпочтительно 1-10 мкг, из которых 1-5 мкг составляют более предпочтительный диапазон.

Содержание белковых антигенов в вакцине будет типично находиться в диапазоне 1-100 мкг, предпочтительно 5-50 мкг, наиболее типично в диапазоне 5-25 мкг. После первоначальной вакцинации субъекты могут получать одну или несколько бустерных иммунизаций, соответствующим образом разнесенных во времени.

Вакцинный препарат в общих чертах описан в Vaccine Design (“Субъединичный и адъювантный подход” (eds Powell M.F. & Newman M.J.) (1995) Plenum Press New York). Инкапсуляция в липосомы описана Fullerton, патент США №4235877.

Вакцины по настоящему изобретению можно хранить в растворе или лиофилизировать. Предпочтительно, раствор лиофилизируют в присутствии сахара, такого как сахароза, трегалоза или лактоза. Еще более предпочтительно, что их лиофилизируют и растворяют непосредственно перед применением. Лиофилизация может давать более стабильную композицию (вакцину) и может, возможно, приводить к более высоким титрам антител в присутствии 3D-MPL и в отсутствие адъюванта на основе алюминия.

Антитела и пассивная иммунизация

Другим аспектом изобретения является способ получения иммуноглобулина для применения в предупреждении или лечении стафилококковой инфекции, включающий стадии иммунизации реципиента вакциной по изобретению и выделения иммуноглобулина из реципиента. Иммуноглобулин, полученный этим способом, является другим аспектом изобретения. Фармацевтическая композиция, содержащая иммуноглобулин по изобретению и фармацевтически приемлемый носитель, является другим аспектом изобретения, которое можно использовать в изготовлении лекарственного средства для лечения или предупреждения стафилококкового заболевания. Способ лечения или предупреждения стафилококковой инфекции, включающий стадию введения пациенту эффективного количества фармацевтического препарата по изобретению, является другим аспектом изобретения.

Инокуляты для получения поликлональных антител типично приготавливают путем диспергирования антигенной композиции в физиологически приемлемом растворителе, таком как физиологический раствор или другие адъюванты, подходящие для применения у человека, с образованием водной композиции. Иммуностимулирующее количество инокулята вводят млекопитающему, и привитое млекопитающее затем поддерживают в течение времени, достаточного для того, чтобы антигенная композиция индуцировала защитные антитела.

Антитела могут быть выделены в желательной степени хорошо известными методами, такими как аффинная хроматография (Harlow and Lane Antibodies; A laboratory manual 1988).

Антитела могут включать в себя препараты антисывороток из множества традиционно используемых животных, например коз, приматов, ослов, свиней, лошадей, морских свинок, крыс или людей. У животных берут кровь и получают сыворотку.

Иммуноглобулин, полученный согласно настоящему изобретению, может включать в себя целые антитела, фрагменты антител или субфрагменты. Антитела могут представлять собой целые иммуноглобулины любого класса, например IgG, IgM, IgA, IgD или IgE, химерные антитела или гибридные антитела с двойной специфичностью к двум или более антигенам по изобретению. Они также могут представлять собой фрагменты, например F(ab')2, Fab', Fab, Fv и тому подобные, включая гибридные фрагменты. Иммуноглобулин также включает в себя природные, синтетические или генетически сконструированные белки, которые действуют подобно антителу путем связывания со специфическими антигенами с образованием комплекса.

Вакцина по настоящему изобретению может быть введена реципиенту, который затем действует в качестве источника иммуноглобулина, продуцируемого в ответ на стимул из специфической вакцины. Субъект, которого обрабатывают таким образом, будет служить донором плазмы, из которой будет получен гипериммуноглобулин с помощью стандартной методологии фракционирования плазмы. Гипериммуноглобулин будут вводить другому субъекту для придания устойчивости против стафилококковой инфекции или для ее лечения. Гипериммуноглобулины по изобретению особенно полезны для лечения или предупреждения стафилококкового заболевания у младенцев, индивидуумов с иммунными нарушениями или там, где требуется лечение, а у индивидуума нет времени продуцировать антитела в ответ на вакцинацию.

Дополнительный аспект изобретения касается фармацевтической композиции, содержащей два или более моноклональных антител (или их фрагментов; предпочтительно человеческих или гуманизированных), реагирующих по меньшей мере с двумя компонентами иммуногенной композиции по изобретению, которая может быть использована для лечения или предупреждения инфекции, вызванной грамположительными бактериями, предпочтительно стафилококками, более предпочтительно S. aureus или S. epidermidis.

Такие фармацевтические композиции содержат моноклональные антитела, которые могут представлять собой целые иммуноглобулины любого класса, например IgG, IgM, IgA, IgD или IgE, химерные антитела или гибридные антитела со специфичностью к двум или более антигенам по изобретению. Они также могут представлять собой фрагменты, например F(ab')2, Fab', Fab, Fv и тому подобные, включая гибридные фрагменты.

Способы получения моноклональных антител хорошо известны в данной области и могут включать в себя слияние спленоцитов с миеломными клетками (Kohler and Milstein 1975 Nature 256; 495; Antibodies - a laboratory manual Harlow and Lane 1988). Альтернативно, моноклональные Fv-фрагменты могут быть получены путем скрининга подходящей фаговой дисплейной библиотеки (Vaughan TJ et al., 1998, Nature Biotechnology 16; 535). Моноклональные антитела могут быть гуманизированы или частично гуманизированы известными способами.

Способы

Изобретение также охватывает способ изготовления иммуногенных композиций и вакцин по изобретению.

Предпочтительный способ по изобретению представляет собой способ изготовления вакцины, включающий стадии смешивания антигенов с получением иммуногенной композиции по изобретению и добавления фармацевтически приемлемого эксципиента.

Способы лечения

Изобретение также охватывает способ лечения стафилококковой инфекции, особенно нозокомиальных инфекций, приобретенных в больнице.

Эта иммуногенная композиция или вакцина по изобретению особенно предпочтительна для применения в случаях плановой операции. Такие пациенты будут знать дату операции заранее и могут быть привиты заблаговременно. Поскольку не известно, будет ли пациент подвергаться инфекции S. aureus или S. epidermidis, предпочтительно прививать вакциной по изобретению, которая защищает против обоих, как описано выше. Предпочтительно, взрослых после 16 лет, ожидающих плановой операции, лечат иммуногенными композициями и вакцинами по изобретению.

Также предпочтительно прививать медицинских работников вакциной по изобретению.

Вакцинные препараты по настоящему изобретению могут быть использованы для защиты или лечения млекопитающего, восприимчивого к инфекции, посредством введения указанной вакцины через системный путь или через слизистые оболочки. Эти введения могут включать в себя инъекцию через внутримышечный, внутрибрюшинный, интрадермальный или подкожный пути; или введение через слизистые оболочки в ротовой/пищеварительный тракт, дыхательные, мочеполовые пути.

Количество антигена в каждой вакцинной дозе выбирают как количество, которое индуцирует иммунозащитный ответ без значительных неблагоприятных побочных эффектов типичных вакцин. Такое количество будет варьировать в зависимости от того, какой специфический иммуноген будут использовать и в каком количестве. Содержание белка в вакцине будет типично находиться в диапазоне 1-100 мкг, предпочтительно 5-50 мкг, наиболее типично в диапазоне 10-25 мкг. Обычно ожидают, что каждая доза будет содержать 0,1-100 мкг полисахарида, если присутствует, предпочтительно 0,1-50 мкг, предпочтительно 0,1-10 мкг, из которых 1-5 мкг составляют наиболее предпочтительный диапазон. Оптимальное количество для конкретной вакцины определено стандартными исследованиями, включающими наблюдение подходящих иммунных ответов у субъектов. После первоначальной вакцинации субъекты могут получать одну или несколько бустерных иммунизаций, соответствующим образом разнесенных во времени.

Хотя вакцины по настоящему изобретению можно вводить любым путем, введение описанных вакцин в кожу (интрадермально) образует одно из воплощений настоящего изобретения. Человеческая кожа содержит наружную “ороговевшую” кутикулу, называемую роговым слоем, который покрывает эпидермис. Под этим эпидермисом находится слой, называемый дермой, которая, в свою очередь, покрывает подкожную ткань. Исследователи показали, что инъекция вакцины в кожу и, в частности, в дерму стимулирует иммунный ответ, который также может быть ассоциирован с рядом дополнительных преимуществ. Интрадермальная вакцинация вакцинами, описанными в данном описании, является предпочтительным признаком настоящего изобретения.

Традиционный метод интрадермальной инъекции, “реакция Манту”, включает стадии очистки кожи и затем ее растяжения одной рукой, и концевым срезом узкой иглы (калибр 26-31) обращенную наверх иглу вставляют под углом от 10 до 15°. После того как вставили концевой срез иглы, цилиндр иглы опускают и дополнительно продвигают, обеспечивая легкое надавливание для продвижения ее под кожей. Жидкость затем впрыскивают очень медленно, образуя при этом пузырек или бугорок на поверхности кожи, с последующим медленным удалением иглы.

Совсем недавно были описаны устройства, которые специально сконструированы для введения жидких агентов в или через кожу, например, устройства, описанные в WO 99/34850 и ЕР 1092444, а также устройства для струйных инъекций, описанные, например, в WO 01/13977; US 5480381, US 5599302, US 5334144, US 5993412, US 5649912, US 5569189, US 5704911, US 5383851, US 5893397, US 5466220, US 5339163, US 5312335, US 5503627, US 5064413, US 5520639, US 4596556, US 4790824, US 4941880, US 4940460, WO 97/37705 и WO 97/13537. Альтернативные способы интрадермального введения вакцинных препаратов могут включать в себя традиционные шприцы и иглы или устройства, предназначенные для баллистической доставки твердых вакцин (WO 99/27961), или трансдермальные пластыри (WO 97/48440; WO 98/28037); или приложенные к поверхности кожи (трансдермальная или чрескожная доставка WO 98/20734; WO 98/28037).

Когда вакцины по настоящему изобретению предназначены для введения в кожу или, более конкретно, в дерму, тогда вакцина находится в малом объеме жидкости, в частности объем составляет от примерно 0,05 мл до 0,2 мл.

Содержание антигенов в кожных или интрадермальных вакцинах по настоящему изобретению может быть похожим на традиционные дозы, как обнаружено во внутримышечных вакцинах (см. выше). Однако особенность кожных или интрадермальных вакцин состоит в том, что препараты могут быть “низкодозовыми”. Соответственно, белковые антигены в “низкодозовых” вакцинах предпочтительно присутствуют в количестве от 0,1 до 10 мкг, предпочтительно 0,1-5 мкг на дозу; и полисахаридные (предпочтительно конъюгированные) антигены могут присутствовать в диапазоне 0,01-1 мкг, и предпочтительно от 0,01 до 0,5 мкг полисахарида на дозу.

Как использовано в данном описании, термин “интрадермальная доставка” означает доставку вакцины в участок дермы в коже. Однако вакцину не обязательно помещать исключительно в дерму. Дерма представляет собой слой в коже, расположеный от примерно 1,0 до примерно 2,0 мм от поверхности человеческой кожи, но существует некоторое варьирование между индивидуумами и в разных частях организма. В большинстве случаев можно ожидать достижения дермы при прохождении на 1,5 мм ниже поверхности кожи. Дерма расположена между роговым слоем и эпидермисом на поверхности и подкожным слоем ниже. В зависимости от способа доставки, вакцина может быть в конечном счете размещена исключительно или главным образом в дерме, или она может быть распределена в конечном счете в эпидермисе и дерме.

Предпочтительное воплощение изобретения представляет собой способ предупреждения или лечения стафилококковой инфекции или заболевания, включающий стадию введения иммуногенной композиции или вакцины по изобретению пациенту, нуждающемуся в этом.

В предпочтительном воплощении пациент ожидает плановой операции.

Другое предпочтительное воплощение изобретения представляет собой применение иммуногенной композиции по изобретению в изготовлении вакцины для лечения или предупреждения стафилококковой инфекции или заболевания, предпочтительно послеоперационной стафилококковой инфекции.

Термин “стафилококковая инфекция” охватывает инфекцию, вызванную S. aureus и/или S. epidermidis и другими штаммами стафилококков, способными вызывать инфекцию у млекопитающих, предпочтительно у человека-хозяина.

Термины “содержащий”, “содержат” и “содержит” в данном описании предназначены изобретателями для возможной замены в каждом случае соответственно терминами “состоящий из”, "состоят из" и “состоит из”.

Все ссылки или заявки на патент, процитированные в описании этой заявки, включены в данное описание путем ссылки.

Для лучшего понимания данного изобретения приводятся следующие примеры. Эти примеры представлены только для целей иллюстрации и не предназначены для ограничения объема изобретения каким-либо образом.

Примеры

Пример 1. Конструирование плазмиды для экспрессии рекомбинантных белков

А: Клонирование.

Подходящие рестрикционные сайты, сконструированные в олигонуклеотидах, специфических для стафилококкового гена, позволили осуществить направленное клонирование ПЦР-продукта в экспрессирующую плазмиду Е. coli pET24d или pQE-30 так, что белок может экспрессироваться в виде слитого белка, содержащего (His)6 метку для аффинной хроматографии на N- или С-конце.

Использовали праймеры:

Альфа-токсин - 5'-CGCGGATCCGCAGATTCTGATATTAATATTAAAAC-3, и 5'CCCAAGCTTTTAATTTGTCATTTCTTCTTTTTC-3'

EbpS - 5'-CGCGGATCCGCTGGGTCTAATAATTTTAAAGATG-3' и 5'CCCAAGCTTTTATGGAATAACGATTTGTTG-3'

ClfA - 5'-CGCGGATCCAGTGAAAATAGTGTTACGCAATC-3' и 5'CCCAAGCTTTTACTCTGGAATTGGTTCAATTTC-3'

FnbpA - 5'-CGCGGATCCACACAAACAACTGCAACTAACG-3' и 5'CCCAAGCTTTTATGCTTTGTGATTCTTTTTCAAAC3'

Sbi - 5'-CGCGGATCCAACACGCAACAAACTTC-3' и 5'GGAACTGCAGTTATTTCCAGMTGATMTAMTTAC-3'

SdrC - 5'-CGCGGATCCGCAGAACATACGAATGGAG-3' и 5'CCCAAGCTTTTATGTTTCTTCTTCGTAGTAGC-3'

SdrG - 5'-CGCGGATCCGAGGAGAATTCAGTACAAG-3' и 5'CCCAAGCTTTTATTCGTCATCATAGTATCCG-3'

Ebh - 5'-AAAAGTACTCACCACCACCACCACC-3' и 5'AAAAGTACTCACTTGATTCATCGCTTCAG-3,

Aaa - 5'-GCGCGCCATGGCACAAGCTTCTACACAACATAC-3' и 5'GCGCGCTCGAGATGGATGAATGCATAGCTAGA-3'

IsaA - 5'-GCATCCATGGCACCATCACCATCACCACGAAGTAAACGTTGATCAAGC-3' и 5'-AGCACTCGAGTTAGAATCCCCAAGCACCTAAACC-3'

HarA - 5'-GCACCCATGGCAGAAAATACAAATACTTC-3' и 5TTTTCTCGAGCATTTTAGATTGACTAAGTTG-3'

Аутолизинглюкозаминидаза - 5'-CAAGTCCCATGGCTGAGACGACACAAGATCAAC-3' и 5'-CAGTCTCGAGTTTTACAGCTGTTTTTGGTTG-3'

Аутолизинамидаза - 5'-AGCTCATATGGCTTATACTGTTACTAAACC-3' и 5'GCGCCTCGAGTTTATATTGTGGGATGTCG-3'

IsdA - 5'-CAAGTCCCATGGCAACAGAAGCTACGAACGCAAC-3' и 5'ACCAGTCTCGAGTAATTCTTTAGCTTTAGAGCTTG-3'

IsdB - 5'-TATTCTCGAGGCTTTGAGTGTGTCCATCATTTG-3, и 5'GAAGCCATGGCAGCAGCTGAAGAAACAGGTGG-31

MRPII - S'-GATTACACCATGGTTAAACCTCAAGCGAAA-S' и 5'AGGTGTCTCGAGTGCGATTGTAGCTTCATT-3'

ПЦР-продукты сначала вводили в клонирующий вектор pGEM-T (Novagen), используя бактериальные клетки Top10, согласно инструкциям производителя. Эту промежуточную конструкцию делали для облегчения дальнейшего клонирования в экспрессирующий вектор. Трансформанты, содержащие вставку ДНК, выбирали с помощью рестриктазного анализа. После переваривания аликвоту реакции ~20 мкл анализировали с помощью гель-электрофореза в агарозе (0,8% агарозы в Трис-ацетат-EDTA (ТАЕ) буфере). Фрагменты ДНК визуализировали УФ светом после гель-электрофореза и окрашивания бромистым этидием. Стандарт молекулярной массы ДНК (1 т.п.н. лестница, Life Technologies) подвергали электрофорезу параллельно с анализируемыми образцами и использовали для оценки размера фрагментов ДНК. Плазмиду, очищенную от выбранных трансформантов, для каждого клонирования затем последовательно переваривали до завершения подходящими рестрикционными ферментами, как рекомендовано производителем (Life Technologies). Переваренный фрагмент ДНК затем очищали, используя центрифужные (spin) колонки с силикагелем, перед лигированием с плазмидой pET24d или pQE-30. Клонирование Ebh (Н2 фрагмента), АаА, IsdA, IsdB, HarA, Atl-амидазы, Atl-глюкозамина, MRP, IsaA осуществляли, используя плазмиду pET24d, а клонирование ClfA, SdrC, SdrE, FnbpA, SdrG/Fbe, альфа-токсина и Sbi осуществляли, используя плазмиду pQE-30.

В: Получение экспрессирующего вектора.

Для того чтобы получить экспрессирующую плазмиду pET24d или pQE-30 для лигирования, ее аналогично переваривали до завершения подходящими рестрикционными ферментами. Приблизительно 5-кратный молярный избыток переваренных фрагментов относительно полученного вектора использовали для программирования реакции лигирования. Стандартную реакцию лигирования в объеме ~20 мкл (~16°С, ~16 ч), используя способы, хорошо известные в данной области, осуществляли с использованием ДНК-лигазы Т4 (~2,0 единицы на реакцию, Life Technologies). Аликвоту лигирования (~5 мкл) использовали для трансформации M15(pREP4) или электрокомпетентных клеток BT21::DE3 согласно способам, хорошо известным в данной области. После ~2-3 ч периода роста при 37°С в ~1,0 мл бульона LB, трансформированные клетки сеяли на чашки с агаром LB, содержащие ампициллин (100 мкг/мл) и/или канамицин (30 мкг/мл). Антибиотики включали в селекцию. Чашки инкубировали в течение ночи при 37°С в течение ~16 ч. Индивидуальные колонии ApR/KanR отбирали стерильными зубочистками и использовали для локального (“patch”) заражения свежих LB ApR/KanR чашек, а также ~1,0 мл LB Ap/Kan бульонной культуры. Как локально зараженные (patch) чашки, так и бульонную культуру инкубировали в течение ночи при 37°С либо в стандартном инкубаторе (чашки), либо в водяной бане-шейкере. ПЦР-анализ на основе целых клеток использовали для подтверждения, что трансформанты содержали вставку ДНК. На этой стадии ~1,0 мл ночной LB Ap/Kan бульонной культуры переносили в 1,5 мл полипропиленовую пробирку, и клетки собирали путем центрифугирования в микроцентрифуге Beckmann (~3 мин, комнатная температура, ~12000 X g). Клеточный осадок суспендировали в ~200 мкл стерильной воды и аликвоту ~10 мкл использовали для программирования ПЦР-реакции с конечным объемом ~50 мкл, содержащей как прямые, так и обратные праймеры для амплификации. Первоначальную стадию денатурации при 95°С увеличивали до 3 мин для обеспечения термического разрушения бактериальных клеток и высвобождения плазмидной ДНК. Для амплификации ВА8 В203-фрагмента из образцов лизированных трансформантов использовали термоциклер ABI Модель 9700 и 32-циклический профиль трехстадийной термической амплификации, т.е. 95°С, 45 с; 55-58°С, 45 с, 72°С, 1 мин. После термической амплификации аликвоту реакции ~20 мкл анализировали с помощью гель-электрофореза в агарозе (0,8% агарозы в Трис-ацетат-EDTA (ТАЕ) буфере). Фрагменты ДНК визуализировали УФ светом после гель-электрофореза и окрашивания бромистым этидием. Стандарт молекулярной массы ДНК (1 т.п.н. лестница, Life Technologies) подвергали электрофорезу параллельно с анализируемыми образцами и использовали для оценки размера ПЦР-продуктов. Трансформанты, которые продуцировали ПЦР-продукт ожидаемого размера, идентифицировали как штаммы, содержащие белковую экспрессирующую конструкцию. Штаммы, содержащие экспрессирующую плазмиду, затем анализировали в отношении индуцибельной экспрессии рекомбинантного белка.

С: Анализ экспрессии ПЦР-положительных трансформантов.

Аликвоту ночной посевной культуры (~1,0 мл) инокулировали в 125 мл колбу Эрленмейера, содержащую ~25 мл бульона LB Ap/Kan, и выращивали при 37°С с встряхиванием (~250 об/мин) до тех пор, пока мутность культуры не достигала ~0,5 при OD600, т.е. середины логарифмического роста (обычно примерно 1,5-2,0 ч). На этом этапе приблизительно половину культуры (~12,5 мл) переносили во вторую 125 мл колбу, и экспрессию рекомбинантного белка индуцировали путем добавления IPTG (1,0 М исходный раствор приготавливали в стерильной воде, Sigma) до конечной концентрации 1,0 мМ. Инкубацию как IPTG-индуцированных, так и неиндуцированных культур продолжали в течение еще ~4 ч при 37°С с встряхиванием. Образцы (~1,0 мл) как индуцированных, так и неиндуцированных культур удаляли после периода индукции, и клетки собирали путем центрифугирования в микроцентрифуге при комнатной температуре в течение ~3 мин. Отдельные клеточные осадки суспендировали в ~50 мкл стерильной воды, затем смешивали с равным объемом 2Х Laemelli ПААГ-ДСН буфера для образцов, содержащего 2-меркаптоэтанол, и помещали в кипящую водяную баню на ~3 мин для денатурации белка. Равные объемы (~15 мкл) обоих неочищенных IPTG-индуцированных и неиндуцированных клеточных лизатов наносили на дублированный 12%-ный Трис/глициновый полиакриламидный гель (Минигели толщиной 1 мм, Novex). Образцы индуцированного и неиндуцированного лизата подвергали электрофорезу вместе с предварительно окрашенными маркерами молекулярной массы (SeeBlue, Novex) в стандартных условиях, используя стандартный ДСН/Трис/глициновый буфер для разделения (BioRad). После электрофореза один гель окрашивали кумасси бриллиантовым голубым R250 (BioRad) и затем обесцвечивали для визуализации нового(ых) IPTG-индуцибельного(ых) белка(ов). Второй гель подвергали электроблоттингу на мембрану PVDF (размер пор 0,45 микрон, Novex) в течение ~2 ч при 4°С, используя аппарат для блоттинга BioRad Mini-Protean II и метанол-содержащий буфер для переноса по Таубину (Towbin). Блокирование мембраны и инкубации с антителами осуществляли согласно способам, хорошо известным в данной области. Моноклональное анти-RGS (His)3 антитело, затем второе кроличье анти-мышиное антитело, конъюгированное с HRP (QiaGen), использовали для подтверждения экспрессии и идентификации рекомбинантного белка. Визуализации картины, специфичной для анти-His антитела, достигали, используя либо нерастворимый субстрат АВТ, либо Hyperfilm с хемилюминесцентной системой Amersham ECL.

Пример 2: Получение рекомбинантного белка

Бактериальный штамм

Рекомбинантный экспрессирующий штамм Е. coli M15(pREP4), содержащий плазмиду (pQE30), или BL21::DE3, содержащий плазмиду pET24d, кодирующую стафилококковый белок, использовали для продуцирования клеточной массы с целью очистки рекомбинантного белка.

Среды

Ферментационная среда, используемая для продуцирования рекомбинантного белка, состояла из 2Х YT бульона (Difco), содержащего 100 мкг/мл Ар и/или 30 мкг/мл Km. Пеногаситель добавляли в среду для ферментера в концентрации 0,25 мл/л (Antifoam 204, Sigma). Для индукции экспрессии рекомбинантного белка в ферментер добавляли IPTG (изопропил-β-D-тиогактопиранозид) (1 мМ, конечный).

Получение рекомбинантных белков

В нативных условиях

IPTG добавляли в конечной концентрации 1 мМ, и культуру выращивали в течение еще 4 ч. Культуру затем центрифугировали при 6000 об/мин в течение 10 мин, и осадок ресуспендировали в фосфатном буфере (50 мМ K2HPO4, KH2PO4, рН 7), включающем коктейль протеазных ингибиторов. Этот образец подвергали лизису под давлением (French), используя давление 1500 бар (150 МПа) (2 прохода). После центрифугирования в течение 30 мин при 15000 об/мин супернатант запасали для дополнительной очистки и добавляли NaCl до 0,5 М. Образец затем наносили на Ni-NTA смолу (колонка ХК 16 Pharmacia, Ni-NTA смола Qiagen), уравновешенную в 50 мМ К2НРО4, КН2РО4, рН 7. После нанесения образца колонку промывали буфером А (0,2 М NaH2PO4 рН 7, 0,3 М NaCl, 10% глицерина). Для элюции связанного белка использовали ступенчатый градиент, где разные пропорции буфера В (0,2 М NaH2PO4, рН 7, 0,3 М NaCl, 10% глицерина и 200 мМ имидазол) добавляли к буферу А. Пропорция буфера В постепенно увеличивалась от 10% до 100%. После очистки элюированную фракцию, содержащую белок, собирали, концентрировали и диализовали против 0,002 М КН2РО42НРО4, рН 7, 0,15 М NaCl.

Этот способ использовали для очистки ClfA, SdrG, IsdA, IsaB, HarA, Atl-глюкозамина и альфа-токсина.

В денатурирующих условиях

IPTG добавляли в конечной концентрации 1 мМ, и культуру выращивали в течение еще 4 ч. Культуру затем центрифугировали при 6000 об/мин в течение 10 минут, и осадок ресуспендировали в фосфатном буфере (50 мМ K2HPO4, KH2PO4, рН 7), включающем коктейль протеазных ингибиторов. Этот образец подвергали лизису под давлением (French), используя давление 1500 бар (150 МПа) (2 прохода). После центрифугирования в течение 30 мин при 15000 об/мин, осадок промывали фосфатным буфером, включающим 1 М мочевину. Образец центрифугировали в течение 30 мин при 15000 об/мин, и осадок ресуспендировали в 8 М мочевине, 0,1 М NaH2PO4, 0,5 М NaCl, 0,01 М Трис-HCl, рН 8, и хранили в течение ночи при комнатной температуре. Образец центрифугировали в течение 20 мин при 15000 об/мин, и супернатант собирали для дополнительной очистки. Образец затем наносили на Ni-NTA смолу (колонка ХК 16 Pharmacia, Ni-NTA смола Qiagen), уравновешенную в 8 М мочевине, 0,1 М NaH2PO4, 0,5 М NaCl, 0,01 М Трис-HCl, рН 8. После прохождения потока, колонку промывали последовательно буфером А (8 М мочевина, 0,1 М NaH2PO4, 0,5 М NaCl, 0,01 М Трис, рН 8,0), буфером С (8 М мочевина, 0,1 М NaH2PO4, 0,5 М NaCl, 0,01 М Трис, рН 6,3), буфером D (8 М мочевина, 0,1 М NaH2PO4, 0,5 М NaCl, 0,01 М Трис, рН 5,9) и буфером Е (8 М мочевина, 0,1 М NaH2PO4, 0,5 М NaCl, 0,01 М Трис, рН 4,5). Рекомбинантный белок элюировали из колонки во время промывок буфером D и Е. Денатурированный рекомбинантный белок можно было солюбилизировать в растворе без мочевины. Для этой цели денатурированный белок, содержащийся в 8 М мочевине, постепенно диализовали против 4 М мочевины, 0,1 М Na2PO4, 0,01 М Трис-HCl, рН 7,1, 2 М мочевины, 0,1 М NaH2PO4, 0,01 М Трис-HCl, рН 7,1, 0,5 М аргинина и 0,002 М KH2PO4/K2HPO4, рН 7,1, 0,15 М NaCl, 0,5 М аргинина.

Этот способ использовали для очистки Ebh (Н2 фрагмента), АаА, SdrC, FnbpA, Sbi, Atl-амидазы и IsaA.

Очищенные белки анализировали с помощью ПААГ-ДСН. Результаты для одного белка, очищенного в нативных условиях (альфа-токсин), и одного белка, очищенного в денатурирующих условиях (SdrC), показаны на фиг.3 и 4.

Пример 3. Получение полисахаридов

PIA (PNAG) получают, как описано в Joyce et al., 2003, Carbohydrate Research 338; 903-922.

Полисахариды типа 5 и типа 8 экстрагируют из S. aureus, как описано в Infection and Immunity 58(7); 2367.

Химия активации и сочетания:

Нативный полисахарид растворяют в 2 М NaCl или в воде. Оптимальную концентрацию полисахарида оценивают для всех серотипов и от 2 мг/мл до 5 мг/мл.

Из 100 мг/мл исходного раствора в ацетонитриле CDAP (CDAP/PS соотношение:0,75 мг/мг PS) добавляют к полисахаридному раствору. Через 1,5 мин 0,2 М триэтиламин добавляют для получения специфической активации рН (рН 8,5-10,0). Активацию полисахарида осуществляют при этом рН в течение 2 мин при 25°С. Белок-носитель добавляют к активированному полисахариду в количестве, достаточном для получения молярного соотношения 1/1, и реакцию сочетания осуществляют при конкретном рН в течение 1 ч.

Затем реакцию гасят глицином в течение 30 мин при 25°С и в течение ночи при 4°С.

Конъюгаты очищают гель-фильтрацией, используя гель-фильтрационную колонку Sephacryl 500HR, уравновешенную 0,2 М NaCl.

Определяют содержание углеводов и белка в элюированных фракциях. Конъюгаты объединяют и стерильно фильтруют на стерилизующей мембране 0,22 мкм. Определяют соотношения PS/белок в препаратах конъюгатов.

Характеристика:

Каждый конъюгат характеризуют содержанием белка и полисахаридов.

Содержание полисахаридов измеряют с помощью резорцинового теста, а содержание белка - методом Лоури. Конечное соотношение PS/PD (мас./мас.) определяют по соотношению концентраций.

Остаточное содержание DMAP (нг/мкг PS):

Активация полисахарида с помощью CDAP вводит цианатную группу в полисахарид и высвобождает DMAP (4-диметиламинопиридин). Остаточное содержание DMAP определяют специфическим анализом, разработанным и проверенным на GSK.

Содержание свободного полисахарида (%):

Содержание свободного полисахарида в конъюгатах, хранящихся при 4°С или хранящихся 7 суток при 37°С, определяют в супернатанте, полученном после инкубации с α-несущими антителами и насыщенным сульфатом аммония, с последующим центрифугированием.

α-PS/α-PS ELISA используют для колличественного определения свободного полисахарида в супернатанте. Отсутствие конъюгата также контролируется с помощью α-носитель/α-PS ELISA.

Пример 4. Препарат

Адъювантные композиции

Белок, либо отдельно, либо вместе, из вышеуказанных примеров может быть приготовлен в виде препарата с комбинацией стафилококковых полисахаридов и в виде адъюванта, препарат может содержать смесь 3-де-О-ацилированного монофосфориллипида A (3D-MPL) и гидроксида алюминия, или 3-де-О-ацилированного монофосфориллипида A (3D-MPL) и фосфата алюминия, или 3D-MPL и/или QS21, возможно, в эмульсии масло в воде, и, возможно, приготовлен в виде препарата с холестерином, или только соль алюминия, предпочтительно фосфат алюминия.

3D-MPL: представляет собой химически детоксифицированную форму липополисахарида (LPS) грамотрицательных бактерий Salmonella minnesota.

Эксперименты, осуществленные на GSK Biologicals, показали, что 3D-MPL, объединенный с различными носителями, резко усиливает как гуморальный, так и ТН1 тип клеточного иммунитета.

QS21: представляет собой один сапонин, очищенный из грубого экстракта коры мыльного дерева Quillaja Saponaria Molina, который имеет сильную адъювантную активность: как антиген-специфическую лимфопролиферацию, так и CTL (цитотоксические Т-лимфоциты) к нескольким антигенам.

Вакцина, содержащая антиген по изобретению, содержащая 3D-MPL и квасцы, может быть получена аналогично тому, как описано в WO 93/19780 или 92/16231. Эксперименты, осуществленные на GSK Biologicals, продемонстрировали отчетливый синергический эффект комбинаций 3D-MPL и QS21 в индукции как гуморальных, так и клеточных иммунных ответов ТН1-типа. Вакцины, содержащие антиген, такие антигены описаны в US 5750110.

Эмульсия масло в воде может состоять из 2 масел (токоферола и сквалена), и PBS, содержащего Tween 80 в качестве эмульгатора. Эмульсия содержала 5% сквалена, 5% токоферола, 0,4% Tween 80 и имела средний размер частиц 180 нм и известна как SB62 (см. WO 95/17210).

Эксперименты, осуществленные на GSK Biologicals, доказали, что добавление этой О/W эмульсии к MPL/QS21 дополнительно увеличивает их иммуностимулирующие свойства.

Приготовление эмульсии SB62 (2-кратный концентрат)

Tween 80 растворяют в фосфатно-солевом буфере (PBS) с получением 2%-ного раствора в PBS. Чтобы получить 100 мл двухкратной концентрированной эмульсии, 5 г DL альфа-токоферола и 5 мл сквалена встряхивают для тщательного смешивания. Добавляют 90 мл раствора PBS/Tween и тщательно смешивают. Полученную эмульсию затем пропускают через шприц и в конце подвергают микрофлюидизации с использованием аппарата для микрофлюидизации M110S. Полученные капли масла имеют размер приблизительно 180 нм.

Пример 5

Эксперименты на животных.

Мышей-самок CD-1 в возрасте 8-10 недель получают из Charles River Laboratories, Kingston, Mass. Для исследований летальности, пять групп из 9-11 мышей CD-1 заражали внутрибрюшинно (в/б) последовательными разведениями S. aureus, выращенного на планшетах CSA. Количества инокулята варьируют от ~1010 до 108 КОЕ/мышь. Летальность оценивают ежесуточно в течение 3 суток. 50%-ные летальные дозы (LD50) оценивают с использованием пробит-модели зависимости доза-ответ. Нулевую гипотезу общих LD50 тестировали с помощью критерия отношения вероятностей. Сублетальную бактериемию инициировали путем заражения групп из 8-20 мышей внутривенным (в/в) введением ~2×106 КОЕ/мышь или в/б введением ~2×107 КОЕ/мышь. После заражения у отдельных групп животных берут кровь из хвоста в заданные временные точки, и уровни бактериемии оценивают путем определения количества бактерий чашечным методом, осуществляемым в двойных повторностях на чашках с триптическим соевым агаром с 5% бараньей крови (Becton Dickinson Microbiology Systems). Статистическую значимость определяют с помощью непарного f-критерия Стьюдента в модификации Велча (Welch).

Пример 6

Общая методология определения антительных ответов у различных млекопитающих

Сыворотки тестировали на наличие IgG антител к стафилококковым полисахаридам с помощью ELISA. Кратко, очищенные капсульные полисахариды из АТСС (Rockville, Md, 20852) наносят в концентрации 25 мкг/мл в фосфатно-солевом буфере (PBS) на микротитрационные планшеты с высоким связыванием (Nunc Maxisorp) в течение ночи при 4°С. Планшеты блокируют с помощью 10% фетальной телячьей сыворотки (FCS), 1 ч при 37°С.Образцы сыворотки предварительно инкубируют с 20 мкг/мл полисахарида клеточной стенки (Statens Serum Institute, Копенгаген) и 10% FCS при комнатной температуре в течение 30 мин для нейтрализации антител на этот антиген. Образцы затем разбавляют в два раза на микропланшете в 10% FCS в PBS и уравновешивают при комнатной температуре в течение 1 ч с перемешиванием. После промывки микропланшеты уравновешивают с Fc-фрагментом моноклонального антитела к IgG человека, меченным пероксидазой (НР6043-HRP, Stratech Scientific Ltd), разбавленным 1:4000, в 10% FCS в PBS в течение 1 ч при комнатной температуре с перемешиванием. ELISA осуществляют для измерения IgG крысы с использованием конъюгированных с пероксидазой, аффинно очищенных антител козы против IgG (H+L) крысы от Jackson ImmunoLaboratories Inc. (код 112-035-003) при 1:5000. Кривые титрования снабжены ссылками на стандартные сыворотки для каждого серотипа с использованием логистического log сравнения с помощью SoftMax Pro. Концентрации полисахаридов, используемые для покрытия планшетов для ELISA, составляют 10-20 мкг/мл. Цвет развивается при использовании 4 мг OPD (орто-фенилендиамин) (Sigma) на 10 мл 0,1 М цитратного буфера, рН 4,5, с 14 мкл Н2О2 в течение 15 мин в темноте при комнатной температуре. Реакцию останавливают с помощью 50 мкл HCl, и оптическую плотность регистрируют при 490 нм относительно 650 нм. Концентрации IgG определяют посредством ссылки на точки титрования на калибровочной кривой, смоделированной с использованием 4-параметрического логистического log уравнения, определенного с помощью программного обеспечения SoftMax Pro.

ELISA для измерения мышиных и крысиных IgG к стафилококковым полисахаридам похожа со следующими исключениями. Конъюгированные с пероксидазой, аффинно очищенные антитела (H+L) козы против IgG мыши и аффинно очищенные антитела (H+L) козы против IgG крысы от Jackson ImmunoLaboratories Inc. использовали для опреления связанного IgG.

HP6043-HRP реагирует в равной степени с человеческими и резус-очищенными IgG, и поэтому этот реагент используют для резус-антисыворотки.

Белковую ELISA осуществляют аналогично полисахаридной ELISA со следующими модификациями. Белок наносят в течение ночи при 2,0 мкг/мл в PBS. Образцы сыворотки разбавляют в PBS, содержащем 10% фетальной телячьей сыворотки и 0,1% поливинилового спирта. Связанное человеческое антитело определяют с использованием конъюгированного с пероксидазой, аффинно очищенного антитела козы к Fc IgG человека от Sigma (ссылка А-2290).

Пример 7

Анализ опсонофагоцитоза.

Опсонофагоцитозный киллинг in vitro S. aureus человеческими полиморфноядерными лейкоцитами (PMN) осуществляют, как описано в Xu et al., 1992 Infect. Immun. 60; 1358. Человеческие PMN получают из гепаринизированной крови путем осаждения в 3%-ном декстране Т-250. Реакционная смесь для опсонизации (1 мл) содержит ~106 PMN в среде RPMI 1640, дополненной 10% инактивированной нагреванием фетальной телячьей сыворотки, ~108 КОЕ S. aureus и 0,1 мл анализируемой сыворотки или препарата IgG. Гипериммунизированную кроличью сыворотку используют в качестве положительного контроля, и 0,1 мл неиммунной кроличьей сыворотки использовали в качестве исчерпывающего источника образцов IgG. Реакционные смеси инкубируют при 37°С, и бактериальные образцы переносят при 0, 60 и 120 мин в воду и затем разбавляют, наносят на чашки с триптическим соевым агаром и инкубируют при 37°С для подсчета бактерий после ночной инкубации.

Пример 8

Иммуногенность стафилококковых белков у мышей и кроликов

Животных иммунизировали очищенными стафилококковыми белками для получения гипериммунных сывороток. Мышей иммунизировали три раза (сутки 0, 14 и 28) 10 мкг каждого из белков в адъюванте Specol. Кроликов иммунизировали три раза (сутки 0, 21 и 42) 20 мкг каждого из белков в адъюванте Specol. Иммунные сыворотки собирали и оценивали в ELISA против белка и против убитых целых клеток.

ELISA против белка:

Очищенный белок наносили в концентрации 1 мкг/мл в фосфатно-солевом буфере (PBS) на микротитрационные планшеты с высоким связыванием (Nunc Maxisorp) в течение ночи при 4°С. Планшеты блокировали с помощью 1% БСА в PBS в течение 30 мин при комнатной температуре с перемешиванием. Анализируемые образцы затем разбавляли 1/1000 и инкубировали при комнатной температуре в течение 1 ч с перемешиванием. После промывки связанное мышиное или кроличье антитело определяли с использованием конъюгированных с пероксидазой, аффинно очищенных антител козы против IgG (H+L) мыши от Jackson ImmunoLaboratories Inc. (ссылка: 115-035-003) или аффинно очищенных антител козы против IgG (H+L) кролика (ссылка: 11-035-003), разбавленных 1:5000 в PBS с 0,05% tween. Антитела для детекции инкубировали в течение 30 мин при комнатной температуре с перемешиванием. Цвет развивался при использовании 4 мг OPD (Sigma)+5 мкл Н2О2 на 10 мл 0,1 М цитратного буфера, рН 4,5, в течение 15 мин в темноте при комнатной температуре. Реакцию останавливали с помощью 50 мкл HCI, и оптическую плотность регистрировали при 490 нм относительно 650 нм. OD для 1/1000 разведения Post III сравнивали с OD, полученной с таким же разведением преиммунных сывороток.

Результаты, полученные с мышиными и кроличьими сыворотками, представлены на фиг.5. Наблюдали хорошую сероконверсию против каждого антигена. Оценка сывороток, направленных против SBI, была искажена из-за lg-связывающей активности этого белка.

ELISA против убитых целых клеток:

Убитые целые клетки (инактивированные нагреванием или формальдегидом) из S. aureus типа 5 и 8 или S. epidermidis штамма Hay наносили в концентрации 20 мкг/мл в фосфатно-солевом буфере (PBS) на микротитрационные планшеты с высоким связыванием (Nunc Maxisorp) в течение ночи при 4°С с испарением. Планшеты блокировали с помощью 1% БСА в PBS 30 мин при комнатной температуре с перемешиванием. Протеин А нейтрализовали путем добавления 10 мкг/мл аффинно очищенных антител курицы против протеина A (ICL ссылка: СРА-65А-2), разбавленных в PBS с 0,05% tween с последующей инкубацией в течение 1 ч при комнатной температуре. Анализируемые образцы затем разбавляли в два раза на микропланшете в PBS-0,05% из исходного разведения 1/10 и инкубировали 1 ч при комнатной температуре с перемешиванием. После промывки связанное мышиное или кроличье антитело определяли с использованием конъюгированных с пероксидазой, аффинно очищенных антител козы против IgG (H+L) мыши от Jackson ImmunoLaboratories Inc. (ссылка: 115-035-003) или аффинно очищенных антител козы против IgG (H+L) кролика (ссылка: 11-035-003), разбавленных 1:5000 в PBS с 0,05% tween. Эти антитела для детекции инкубировали в течение 30 мин при комнатной температуре с перемешиванием. Цвет развивался при использовании 4 мг OPD (Sigma)+5 мкл H2O2 на 10 мл 0,1 М цитратного буфера, рН 4,5, в течение 15 мин в темноте при комнатной температуре. Реакцию останавливали с помощью 50 мкл HCl, и оптическую плотность регистрировали при 490 нм относительно 650 нм.

Следует отметить, что уровни экспрессии белков в стафилококках будут варьировать в зависимости от условий культивирования. Поэтому отрицательный результат может свидетельствовать о неправильных условиях культивирования, а не об отсутствии иммуногенности.

Результаты с использованием мышиных сывороток показаны в Таблице 5, и некоторые графики показаны на фиг.6. Слабое распознавание S. aureus штамма 5 наблюдают с сыворотками, направленными против SdrC, FnbpA, Ebh, Sbi и IsaA. Распознавание S. aureus штамма 8 наблюдают только с сывороткой, направленной против Sbi. Слабое распознавание S. epidermidis Hay наблюдают с сыворотками, направленными против Atl-амидазы, MRP, IsdA, IsaA, Ebh, Ааа и Sbi.

Выборка результатов, полученных с использованием кроличьих сывороток, показана на фиг.7 и просуммирована в Таблице 6. Очень хорошее распознавание трех штаммов наблюдали с IsaA и IsdB. Слабое распознавание трех штаммов наблюдали с HarA, хотя животные получили только одну инъекцию, а не три инъекции, используемые для других белков.

Таблица 5
Название белка Реакция на SA5 Реакция на SA8 Реакция на SE Hay
IsaA (+) (+) (+)
ClfA (+) (+)
Atl-амидаза - - ++
SdrG - -
Глюкозамидаза - - -
IsdA - - ++
Альфа-токсина - - -
SrdC ++ (+)
Ebh + - +
AaA - ++
MRP - - ++
Sbi ++ ++ +++
FnbpA + + (+)
Таблица 6
Название белка Реакция на SA5 Реакция на SA8 Реакция на SE Hay
IsaA +++ +++ +++
ClfA + ++ ++
Atl-амидаза - ++ +
IsdB +++ +++ +++
SdrG + + +
Глюкозамидаза -
HarA (1 инъекция) + + +
IsdA -
Альфа-токсин - - +
SrdC - -
Ebh - + -
AaA - - -
MRP - ++
Sbi - +++ -
FnbpA - ++ ++

Пример 8

Эффективность комбинаций стафилококковых белков в модели назальной колонизации.

Пятнадцать групп хлопковых хомяков прививали комбинациями из восьми стафилококковых антигенов, и пять хлопковых хомяков, которые служили в качестве контролей, обрабатывали без антигенов. Эти шестнадцать групп представляют собой следующее:

Группа 1 - Atl-глюкозамин, Atl-амидаза, AAA, альфа-токсин, SdrC, SdrG, Ebh, Sbi

Группа 2 - Atl-глюкозамин, Atl-амидаза, IsdA, IsdB, ClfA, SdrC, Ebh, FnbpA

Группа 3 - Atl-глюкозамин, Atl-амидаза, HarA, IsdA, MRP, IsdB, AAA, альфа-токсина

Группа 4 - Atl-глюкозамин, HarA, IsdA, AAA, ClfA, IsaA, Ebh, Sbi

Группа 5 - HarA, MRP, AAA, альфа-токсин, ClfA, SdrC, Ebh, FnbpA

Группа 6 - IsdA, IsdB, AAA, альфа-токсин, ClfA, SdrG, Sbi, FnbpA

Группа 7 - Atl-аминидаза, IsdA, MRP, AAA, IsaA, SdrG, Ebh, FnbpA

Группа 8 - Контроль

Группа 9 - Atl-глюкозамин, IsdA, MRP, альфа-токсин, IsaA, SdrC, Sbi, FnbpA

Группа 10 - Atl-глюкозамин, MRP, IsdB, AAA, ClfA, IsaA, SdrC, SdrG

Группа 11 - Atl-аминидаза, MRP, IsdB, альфа-токсин, ClfA, IsaA, Ebh, Sbi

Группа 12 - Atl-глюкозамин, HarA, IsdB, альфа-токсин, IsaA, SdrG, Ebh, FnbpA

Группа 13 - Atl-амидаза, HarA, IsdB, AAA, IsaA, SdrC, Sbi, FnbpA

Группа 14 - Atl-глюкозамин, Atl-амидаза, HarA, MRP, ClfA, SdrG, Sbi, FnbpA

Группа 15 - Atl-амидаза, HarA, IsdA, альфа-токсин, ClfA, IsaA, SdfC, SdrG

Группа 16 - HarA, IsdA, MRP, IsdB, SdrC, SdrG, Ebh, Sbi

Каждую смесь антигенов, содержащую 3 мкг каждого антигена, смешивали с адъювантом, состоящим из липосом, содержащих MPL и QS21. Хлопковых хомяков прививали три раза на 1, 14 и 28 сутки эксперимента. Через две недели после прививки оценивали эффективность иммунизации, используя анализ назальной колонизации, как описано в Kokai-Kun et al., (2003) Antimicrob.Agents.Chemother. 47; 1589-1597.

Классический множественный регрессионный анализ осуществляли на данных с использованием программного обеспечения “Design Expert 6”. Присутствие антигена кодировали как +1, а отсутствие антигена как -1. Используя уравнение данной модели, можно определить, какие антигены были ключевыми антигенами, которые давали значительное снижение количества колоний в носу.

Результаты

Результаты анализа назальной колонизации показаны в Таблице 7. Контрольная группа имела средний logKOE/нос 3,51335, и уменьшение назальной колонизации можно было наблюдать для всех групп хлопковых хомяков, привитых стафилококковыми белками. Группы 4, 9 и 13 показали наибольшее уменьшение назальной колонизации с уменьшением более 2 логарифмов в КОЕ/нос. Группы 12 и 16 также дали хорошие результаты, демонстрирующие уменьшение около 2 логарифмов в КОЕ/нос.

Таблица 7
Группа Средний наблюдаемый LogKOE/нос Предсказанный LogKOE/нос
1 1,77527 2,03560
2 2,90435 2,52684
3 1,96556 2,23033
4 1,27748 1,21872
5 1,67304 1,93128
6 2,79745 2,98193
7 2,21481 2,30705
8 3,51355 3,47317
9 1,22480 1,44080
10 2,03085 1,93204
11 2,02522 1,81581
12 1,53402 1,70996
13 1,36063 1,49100
14 2,31201 1,73909
15 2,22979 1,98223
16 1,58109 1,44004

Вклад конкретных антигенов в смеси антигенов определяли с использованием множественного регрессионного анализа данных назальной колонизации. Конечная модель содержит семь лучших антигенов. Результаты для этих антигенов показаны в Таблице 8. В контексте смеси белков включение HarA давало наибольшее уменьшение назальной колонизации, затем следуют IsaA, Sbi, SdrC, аутолизин-глюкозамин, MRP и Ebh.

Таблица 8
Эффекты в различии logKOE/нос и соотношении КОЕ/нос для семи лучших антигенов в модели и соответствующие р-значения.
антиген prob>F Оценка эффекта Кратность уменьшения Кумулятивный эффект Кумулятивное соотношение
HarA 0,033 -0,596 3,9 -0,596 3,9
IsaA 0,046 -0,558 3,6 -1,154 14,3
Sbi 0,077 -0,491 3,1 -1,645 44,2
SdrC 0,22 -0,337 2,2 -1,982 96,0
Atl-глюкоз 0,238 -0,324 2,1 -2,306 202,2
MRP 0,239 -0,323 2,1 -2,629 425,3
Ebh 0,297 -0,286 1,9 -2,914 821,0

prob - вероятность

1. Иммуногенная композиция для вакцинации против стафилококковой инфекции, содержащая эффективное количество по меньшей мере двух разных белков или их иммуногенных фрагментов, выбранных из по меньшей мере двух групп белков или иммуногенных фрагментов, выбранных из следующих групп:
Группа (а): по меньшей мере один стафилококковый белок, связывающий внеклеточный компонент, или его иммуногенный фрагмент, выбранный из группы, состоящей из SdrG, рецептора ламинина, EbhA, EbhB, эластин-связывающего белка (EbpS), EFB (FIB), SBI, аутолизина, ClfA, SdrC, SdrH, липазы GehD, FnbA, FnbB, Cna, ClfB, FbpA, Npase (нейтральной фосфатазы), IsaA/PisA, SsaA, EPB, SSP-1, SSP-2, HBP, витронектин-связывающего белка, коагулазы и MAP;
Группа (б): по меньшей мере один стафилококковый транспортный белок или его иммуногенный фрагмент, выбранный из группы, состоящей из иммунодоминантного АВС-транспортера, IsdA, IsdB, Mg2+ транспортера, SitC и Ni АВС-транспортера;
Группа (в): по меньшей мере один стафилококковый регулятор вирулентности, токсин или его иммуногенный фрагмент, выбранный из группы, состоящей из альфа-токсина (Hla), мутанта альфа-токсина H35L, мутанта альфа-токсина H35R и РНК III-активирующего белка (RAP);
при условии, что композиция не содержит по меньшей мере один белок или иммуногенный фрагмент, выбранный из группы (а), вместе с по меньшей мере одним белком или иммуногенным фрагментом, выбранным из группы (б).

2. Иммуногенная композиция по п.1, где по меньшей мере один белок или иммуногенный фрагмент выбран из группы (а) и по меньшей мере один белок или иммуногенный фрагмент выбран из группы (в).

3. Иммуногенная композиция по п.1, где по меньшей мере один белок или иммуногенный фрагмент выбран из группы (б) и по меньшей мере один белок или иммуногенный фрагмент выбран из группы (в).

4. Иммуногенная композиция по п.1, содержащая по меньшей мере один белок или иммуногенный фрагмент из S. aureus.

5. Иммуногенная композиция по п.1, содержащая по меньшей мере один белок или иммуногенный фрагмент из S. epidermidis.

6. Иммуногенная композиция по п.1, дополнительно содержащая PIA полисахарид или олигосахарид.

7. Иммуногенная композиция по п.1, дополнительно содержащая капсульный полисахарид или олигосахарид типа V и/или типа VIII из S. aureus.

8. Иммуногенная композиция по п.1, дополнительно содержащая капсульный полисахарид или олигосахарид типа I, и/или типа II, и/или типа III из S. epidermidis.

9. Иммуногенная композиция по п.6, где стафилококковый капсульный полисахарид конъюгирован с белком-носителем.

10. Иммуногенная композиция по п.9, где белок-носитель выбран из группы, состоящей из столбнячного анатоксина, дифтерийного анатоксина, CRM197, протеина D Haemophilus influenzae, пневмолизина и альфа-анатоксина.

11. Иммуногенная композиция по п.1, способная вызывать эффективный иммунный ответ как против S. aureus, так и против S. epidermidis.

12. Иммуногенная композиция по п.1, где по меньшей мере один белок или иммуногенный фрагмент, выбранный из группы (а), представляет собой ClfA или его иммуногенный фрагмент.

13. Иммуногенная композиция по п.1, где по меньшей мере один белок или иммуногенный фрагмент, выбранный из группы (в), представляет собой альфа-токсин (Hla), мутант альфа-токсина H35L, мутант альфа-токсина H35R или его иммуногенный фрагмент.

14. Иммуногенная композиция по п.1, содержащая ClfA или его иммуногенный фрагмент и альфа-токсин (Hla), мутант альфа-токсина H35L, мутант альфа-токсина H35R или его иммуногенный фрагмент.

15. Вакцина для вакцинации против стафилококковой инфекции, содержащая эффективное количество иммуногенной композиции по любому из пп.1-14 и фармацевтически приемлемый эксципиент.

16. Способ получения вакцины, включающий стадии смешивания антигенов с получением иммуногенной композиции по любому из пп.1-14 и добавления фармацевтически приемлемого эксципиента.

17. Способ предупреждения или лечения стафилококковой инфекции, включающий стадию введения вакцины по п.15 пациенту, нуждающемуся в этом.

18. Применение иммуногенной композиции по любому из пп.1-14 в изготовлении вакцины для лечения или предупреждения стафилококковой инфекции.

19. Способ получения иммуноглобулина для применения в предупреждении или лечении стафилококковой инфекции, включающий стадии иммунизации реципиента вакциной по п.15 и выделения иммуноглобулина из реципиента.

20. Фармацевтическая композиция для предупреждения или лечения стафилококковой инфекции, содержащая эффективное количество:
(1) моноклонального антитела или его фрагмента, которые реагируют со стафилококковым белком, связывающим внеклеточный компонент, группы (а), как определено в п.1, или его иммуногенным фрагментом;
(2) моноклонального антитела или его фрагмента, которые реагируют со стафилококковым транспортным белком группы (б), как определено в п.1, или его иммуногенным фрагментом; и
(3) моноклонального антитела или его фрагмента, которые реагируют со стафилококковым регулятором вирулентности или токсином группы (в), как определено в п.1, или его иммуногенным фрагментом;
при условии, что композиция не содержит одновременно (1) и (2).

21. Фармацевтическая композиция для предупреждения или лечения стафилококковой инфекции, содержащая эффективное количество иммуноглобулина, полученного способом по п. 19, и фармацевтически приемлемый эксципиент.

22. Способ лечения или предупреждения стафилококковой инфекции, включающий стадию введения пациенту эффективного количества фармацевтической композиции по п.20 или 21.

23. Применение фармацевтической композиции по п.20 или 21 для лечения или предупреждения стафилококковой инфекции.



 

Похожие патенты:
Изобретение относится к ветеринарии, в частности к ветеринарной микробиологии, и может быть использовано при производстве сыворотки для диагностики сибирской язвы.

Изобретение относится к новому токсину. .

Изобретение относится к биотехнологии и может быть использовано для получения моноклональных антител (МКА) к капсульному F1 антигену Yersinia pestis. .

Изобретение относится к полипептидам, содержащим последовательность -X-Y- или -Y-X-, в которой -X- представляет собой аминокислотную последовательность, определенную выше, а -Y- не является определенной выше последовательностью, т.е.

Изобретение относится к области медицины и может быть использовано для эффективного лечения инфекционных заболеваний, сопровождающихся нейротоксическими нарушениями.

Изобретение относится к фармацевтическим составам и предназначено для обеспечения бактерицидной эффективности. Фармацевтический состав содержит два различных антибиотика в качестве активных компонентов, присутствующих в виде синергичной комбинации фиксированной дозы в парентеральной лекарственной форме.
Изобретение относится к водорастворимой бактерицидной композиции. Композиция включает бактерицидную субстанцию катапол в количестве 2,1-2,5 мас.%, зостерин в количестве 1,1-5,0 мас.% и дистиллированную воду.

Изобретение относится к области органической химии и медицины и касается новых производных 4-(пирролидин-1-ил)хинолина, способа их получения и применения для лечения бактериальной или грибковой инфекции.

Изобретение относится к фармацевтической области, а именно представляет собой композиции для лечения нарушений ногтей и ногтевого ложа и способы лечения нарушения ногтей.

Изобретение относится к медицине и ветеринарии, а именно к медицинским и ветеринарным препаратам, предназначенным для профилактики и лечения кишечных инфекций различной этиологии у человека и животных.

Группа изобретений относится к медицине и касается композиции для местного наружного применения, характеризующейся тем, что она содержит синтетическую липоевую кислоту; спирт этиловый 95%; 1,2-пропиленгликоль, полиакриловую кислоту (любой другой гидрофильный гелеобразователь), триэтаноламин, воду очищенную; способа получения композиции для местного наружного применения, характеризующегося тем, что синтетическую липоевую кислоту растворяют при перемешивании в смеси спирта этилового и пропиленгликоля, одновременно полиакриловую кислоту диспергируют в рассчитанном количестве воды, необходимом для доведения соотношения ингредиентов композиции до 100 мас.%, и после 3-часового набухания к полученному раствору добавляют растворенную в смеси спирта и пропиленгликоля синтетическую липоевую кислоту и тщательно перемешивают, затем полученную композицию нейтрализуют раствором триэтаноламина до pH 5,5-6,5 и перемешивают до образования прозрачной гелеобразной массы светло-желтого цвета.
Изобретение относится к медицине, а именно к акушерству и гинекологии, и может быть использовано для предгравидарной подготовки при невынашивании беременности в ранние сроки гестации вследствие хронического воспалительного процесса гениталий либо недостаточности гормональной функции яичников воспалительного генеза.
Настоящее изобретение относится к медицине, а именно к композиции, содержащей инкапсулированную тритерпеновую кислоту: бетулиновую кислоту, урсоловую кислоту или их производные в виде солей и эфиров или тритерпеновый спирт - бетулин, которая может быть использована в медицине для лечения и профилактики вирусных инфекций, вызываемых ДНК- и РНК-содержащими вирусами, такими как вирусы гриппа, онковирусы, герпес, опоясывающий лишай, а также инфекций, вызываемых грамположительными и грамотрицательными бактериями: Staphylococcus spp., Streptococcus spp., Enterococcus spp., Shigella spp., Escherichia spp., Salmonella spp., Proteus spp., Acinetobacter spp., Citrobacter spp., Pseudomonas spp., Serratia spp., Klebsiella spp., Antracoides spp., Cryptococcus spp., патогенными грибами рода Microsporum, Trichophyton, Nocardia, Aspergillus, дрожжеподобными грибами рода Candida, в т.ч.
Изобретение относится к области пищевой промышленности, биотехнологии и касается композиции антибактериальной и штамма бактериофага Escherichia coli, используемого для получения такой композиции.
Группа изобретений относится к фармакологии и медицине и касается применения дипептида общей формулы Tyr-Pro-Х, где X - ОН, NH2, ОСН3, ОС2Н5, в качестве противовоспалительного, антибактериального, ранозаживляющего, регенеративного, анальгетического и противоожогового средства при наружном применении, а также лекарственная форма для наружного применения, содержащая такой дипептид.
Изобретение относится к области ветеринарной медицины и касается вакцины ассоциированной против сальмонеллеза, эшерихиоза и вирусной геморрагической болезни кроликов.
Наверх