Способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения

Изобретение относится к области биотехнологии, в частности к биотехнологии бактерий, и связано с получением полифункциональных магнитных наночастиц. В качестве настоящего изобретения предложен способ получения полифункциональных магнитных наночастиц на основе бактериальных магнетосом и гибридного белка MGG, позволяющий получать магнетосомы, связывающие иммуноглобулины класса IgG по фрагменту Fc. Задачей настоящего изобретения является получение полифункционального магнитного сорбента, несущего на поверхности магнитных наночастиц лиганды, позволяющие проводить присоединение к частицам иммуноглобулины класса IgG. Результат достигается тем, что в состав липидной мембраны бактериальных магнетосом посредством ультразвуковой обработки интегрируется гибридный белок MGG, аминокислотная последовательность которого содержит трансмембранный домен и область связывания иммуноглобулинов. 4 ил.

 

Изобретение относится к области биотехнологии, в частности к биотехнологии бактерий, и связано с получением полифункциональных магнитных наночастиц.

В качестве настоящего изобретения предложен способ встраивания иммуноглобулин-связывающих белков в естественную мембрану бактериальных магнитных наночастиц при помощи обработки суспензии частиц в растворе целевого белка ультразвуком.

Результаты реализации данного изобретения могут быть использованы при разработке методов магнитного иммуноферментного анализа с целью обнаружения целевых антигенов, а сами модифицированные магнитные частицы могут применяться в качестве сорбирующего агента для выделения иммуноглобулинов.

Известен способ проведения магнитного иммуноферментного анализа с помощью частиц оксида железа Fe2O3, при котором проводится модификация поверхности частиц путем химической сшивки антигенов с поверхностью частиц с помощью глютарового альдегида. Патент РФ RU (11) 2290641 (13) С1.

Известен способ получения модифицированных магнитных наночастиц бактериального происхождения, при котором встраивание целевых белковых молекул в мембрану наночастиц проводится путем генетической трансформации бактерий, продуцирующих магнитные наночастицы вектором, в состав которого входит ген, кодирующий встраиваемый белок. Встраивание требуемого белка в мембрану магнитных наночастиц осуществляется в результате природных биохимических процессов внутри живой клетки (Патент США US 20100292495).

Известен также способ получения модифицированных магнитных наночастиц бактериального происхождения, при котором встраивание целевых белковых молекул в мембрану наночастиц проводится путем экспрессии гибридного белка MagA/целевой белок в клетках магнитотактической бактерии АМВ-1, в чем данный способ сходен с предыдущим (Патент США US 5861285).

Известен способ получения модифицированных магнитных наночастиц бактериального происхождения, при котором проводится химическая сшивка антител против целевого белка (Bt-токсина бактерии Bacillus thuringiensis) с мембраной бактериальных магнетосом бактерии методом карбоксиаминофиксации (патент ЕС CN 1024193 70 (А)).

Недостатками перечисленных выше методов является либо недостаточная специфичность связывания целевых веществ с поверхностью магнитных частиц (как это имеет место при химической сшивке) или неконтролируемый уровень встраивания модифицирующих агентов в мембрану магнетосом (случай генетической модификации).

Проведенный анализ патентных источников показывает, что несмотря на непрерывно возрастающий поток информации о способах использования бактериальных магнитных наночастиц (магнетосом) имеется острая потребность в относительно простых и эффективных методах модификации поверхности магнетосом с целью размещения на внешней мембране искомых целевых веществ. Получаемые такими методами модифицированные магнетосомы могут использоваться в дальнейшем как для проведения исследований в области фундаментальной науки, так и для решения прикладных задач - адресной доставки лекарств, магнитно-резонансной терапии заболеваний, разработки методов магнитной иммуноферментной диагностики и проч.

Задачей предлагаемого метода является высокоэффективное встраивание иммуноглобулин-связывающих белков в природную мембрану магнетосом, что позволяет получать полифункциональные (за счет возможности дальнейшего связывания встроенным белком антител различной специфичности) магнитные наночастицы на основе магнетосом бактериального происхождения. В качестве источника магнетосом была выбрана бактерия Magnetospirillum штамм SO-1, выделенная из прибрежных осадков р.Ольховка (г.Кисловодск). Данный штамм отличает от известных культивируемых магнитотактических бактерий повышенная аэротолерантность, высокая скорость роста и устойчивая продукция магнетосом в широком диапазоне условий культивирования.

Таким образом, изобретение - способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения - должно:

а) обеспечивать встраивание гибридного белка MGG [1] (SEQ ID №1) в мембрану бактериальных магнетосом в результате ультразвуковой обработки.

N-конец этого гибридного белка (аминокислоты №№1-124) содержит последовательность аминокислот с гидрофобными свойствами, соответствующую белку Mam12 мембраны магнетосом бактерии Magnetospirillum magnetotacticum MS-1, что обеспечивает закрепление молекулы белка в липопротеиновой мембране бактериальных наночастиц. С-конец (аминокислоты №№130-284) представляет собой тандемно повторяющийся искусственный аналог фрагмента В иммуноглобулин-связывающего белка А бактерии Staphylococcus aureus. N- и С-концы белка связаны между собой глицин-сериновым шарниром (аминокислоты №№125-129), обеспечивающим независимость фолдинга двух доменов белка;

б) обеспечивать связывание антител класса IgG по Fc-фрагменту

Осуществление изобретения

Клеточные линии и питательные среды для роста клеток

Е. coli штамм BL21 (DE3) (F-ompT hsdSB (rB-mB-) gal dcm (DE3)) (Novagene, США), Magnetospirillum sp.SO-1.

Получение и исследование активности иммуноглобулин-связывающего белка MGG

Экспрессию белка MGG проводили в клетках Е. coli штамм BL21 (DE3), трансформированных экспрессионным вектором pET23a(+)/mGG методом автоиндукции [2].

Очистку гибридного белка MGG осуществляли с помощью металлохелатной аффинной хроматографии (МХАХ) из препарата мембранной фракции белков, который суспендировали в буфере А (20 мМ Tris-HCl, рН 8.0, 500 мМ NaCl, 5% глицерин, 10 мМ β-меркаптоэтанол, 10 мМ имидазол, 2 мМ PMSF, 1.5% лаурил саркозин), и инкубировали в течение часа при комнатной температуре. Солюбилизированную мембранную фракцию наносили на сорбент «Ni-NTA agarose» (Invitrogen, США), предварительно уравновешенный буфером А. Далее осуществляли промывку сначала буфером А (не менее 3 объемов сорбента), а затем буфером В: 20 мМ Tris-HCl, рН 8.0, 1 М NaCl, 5% глицерин, 5 мМ имидазол, 1% лаурил саркозин (не менее 3 объемов сорбента). Элюцию целевого белка проводили буфером С 20 мМ Tris-HCl, рН 7.5, 130 мМ NaCl, 5% глицерин, 500 мМ имидазол, 0.5% лаурил саркозин. Элюат диализовали в 20 мМ Tris-HCl, рН 7.5 буфере, содержащем 50 мМ NaCl, 10% глицерин; 14.6 мМ лаурилсаркозин в течение ночи при +4°С. Наличие гексагистидиновой последовательности на С-конце гибридных белков позволило одностадийно получить высокоочищенный препарат белков при помощи МХАХ.

Способность связывания модифицированным белком антител определяли с помощью ИФА. В лунках сорбировали 1 мг инсулина человека в течение ночи при +4°С. Остаточную сорбцию блокировали 1.5% раствором БСА в PBST буфере (137 мМ NaCl, 2.7 мМ КС1, 10 мМ Na2HPO4, 1.8 мМ KH2PO4, 0.01% NaN3, 0.05% Tween 20) в течение часа. Далее добавляли 100 мкл (1 мкг/мл) моноклональных антител мыши против инсулина человека (Имтек, Россия) и инкубировали в течение часа при комнатной температуре. Лунки отмывали 4 раза PBST буфером, после чего наносили с заданными разведениями гибридный белок и инкубировали при комнатной температуре в течение 1 ч. После аналогичной отмывки в течение 1 ч инкубировали 0.1 мкг антител мыши против гистидинового тага (Имтек, Россия); система детекции - перекись водорода/пероксидаза хрена, хромогенный субстрат ТМВ (Sigma, США). В качестве отрицательного контроля использовали полипептид, несущий гистидиновый таг на С-конце.

Специфичность взаимодействия определяли путем вычисления константы диссоциации комплекса гибридного белка с антителом согласно [3]. В каждую лунку наносили по 1 мкг гибридного белка. После блокирования поверхности лунки, добавляли антитела кролика к Fc-фрагменту иммуноглобулина G мыши, конъюгированные с пероксидазой хрена в заданных разведениях. Для сравнения уровня неспецифического связывания антител белком MGG, аналогичным образом был получен гибридный белок MZZ, состоящий из белка Мат 12 и двух доменов Z (широко используемые в биотехнологии синтетические аналоги домена В белка A S. Aureus). Показано, что белки MGG и MZZ проявляют высокий уровень специфичности взаимодействия с антителами: Kaff(MGG)=1.59±0.12 нМ Kaff(MZZ)=1.44±0.16 нМ. На основе полученных данных сделан вывод об иммуноглобулин-связывающей активности двойного G домена, не уступающей ранее известному двойному Z домену.

Из литературных данных [4] известно, что В-домен белка A Staphylococcus aureus способен связываться только с Fc фрагментом иммуноглобулинов класса IgG.

Выделение магнетосом из Magnetospirillum штамм SO-1

Биомассу Magnetospirillum штамм SO-1 получали из 1.5 л культуральной жидкости путем центрифугирования при 10000 об/мин в течение 10 мин. Осажденные клетки (4 г сырой биомассы) ресуспендировали в 20 мл 20 мМ HEPES-буфера с рН=7.4 с добавлением ЭДТА (4 мМ) и фенилметилсульфонилфторида (0.1 мМ) во избежание разрушения белков мембраны магнетосом клеточными протеазами. Для более эффективного разрушения бактериальных клеток осуществляли двукратную процедуру замораживания-оттаивания полученной суспензии. Окончательное разрушение клеток проводили при помощи ультразвукового дезинтегратора Sonopuls UW2070 (Bandelin, Германия) с частотой 20 кГц в течение 10 мин. Суспензию разрушенных клеток переносили в чистые пробирки, и магнитная фракция собиралась на магнитном стенде Promega. Для избавления от остатков разрушенных бактериальных клеток магнитные наночастицы дважды промывали 20 мМ HEPES-буфером с рН=7.4 с добавлением 200 мМ NaCl, с последующей десятикратной промывкой магнетосом 20 мМ HEPES-буфером рН=7.4 на магнитном стенде Promega.

Проверка чистоты и физико-химических свойств бактериальных магнетосом

Чистоту препарата магнетосом и их физико-химические свойства характеризовали с помощью методов атомно-силовой микроскопии (АСМ) (ИНТЕГРА Прима, Нт-МДТ, Россия) (ФИГ.1). Установлено, что магнетосомы, выделенные из Magnetospirillum штамм SO-1, имели одинаковую форму, размеры магнитных кристаллов составляли от 45 до 60 нм. Данные микроскопии свидетельствуют о наличии интактной липопротеиновой мембраны. Элементный состав определяют с помощью метода энергодисперсионной рентгеновской спектроскопии. Показано, что кристаллы магнетосом состоят из магнетита (Fe3O4). Таким образом, разработанный метод позволяет выделять магнитные наночастицы из бактерий Magneto spirillum sp.SO-1 с интактной мембраной, необходимой для последующей модификации магнетосом.

Иммобилизация белка MGG на поверхности магнетосом. Полученный белок MGG иммобилизируют на мембране магнетосом с помощью обработки ультразвуком. Встраивания белка осуществляли в присутствии 10 мМ лауриилсаркозината натрия и 100 мМ NaCl. Для модификации бактериальных наночастиц 1 мл (10 мг/мл) препарата магнетосом в 20 мМ HEPES-буфере с рН=7.4 смешивали с 1 мл (5 мг/мл) белка MGG, со 100 мкл NaCl и 10 мкл лауриилсаркозината натрия. Затем проводили озвучивание смеси с помощью ультразвукового дезинтегратора Sonopuls UW2070 (Bandelin, Германия) с частотой 10 кГц (0.5 с/0,5 с) в течение 1 мин. Полифункциональные бактериальные магнетосомы собирали на магнитном стенде и трижды промывали 20 мМ HEPES-буфером с рН=7.4. Встраивание гибридного белка проверяли с помощью метода АСМ (ИНТЕГРА Прима, Нт-МДТ, Россия) (ФИГ. 2) Функциональную активность модифицированных предлагаемым способом магнетосом проверяли с помощью магнитного иммуноферментного анализа. Для этого 10 мкл (1 мт/мл) модифицированных бактериальных магнетосом добавляли к 1 мл антител мыши против Fc-фрагмента иммуноглобулина человека, конъюгированные с пероксидазой хрена, с заданными разведениями и инкубировали в течение 30 мин при комнатной температуре. После чего магнетосомы 5 раз промывали на магнитном стенде 1 мл 20 мМ HEPES-буфера, рН=7.4 для избавления от несвязанных антител. Уровень связывания определяют спектрофотометрически по цветной реакции пероксидазы с тетраметилбензидином (ФИГ.3).

Пример выполнения предлагаемого способа

10 мкл (1 мг/мл) полифункциональных бактериальных магнетосом добавляли к 1 мл антител мыши против инсулина человека с заданными разведениями и инкубировали в течение 30 мин при комнатной температуре. С целью избавления от несвязанных антител магнетосомы 5 раз промывали на магнитном стенде 1 мл 20 мМ HEPES-буфера, рН=7.4. После чего добавляли 1 мл (1 мкг/мл) антител кролика против Fc-фрагмента иммуноглобулина мыши, конъюгированные с пероксидазой хрена, и инкубировали в течение 30 мин. После аналогичной отмывки несвязанных антител добавляли 100 мкл хромогенного субстрата тетраметилбезидина, реакцию останавливали 20 мкл 1 М HCl. Оптическую плотность раствора измеряли на спектрофотометре при длине волны 405 нм (ФИГ.№4). Полученные данные свидетельствуют о том, что полифункциональные бактериальные магнетосомы могут быть использованы в качестве магнитного сорбента для проведения ИФА высокой чувствительности.

Литература

1. Д.С.Груздев, М.В.Дзюба, А.С.Герасимов, Б.Б.Кузнецов. Получение и исследование активности модифицированных белков мембраны магнетосом. // Прикладная биохимия и микробиология.// В печати.

2. Studier F.W. // Protein Expression and Purification. 2005. №41. P.207-234.

3. Loomans E.M.G., Roelen A.J.M., Van Damme H.S., Bloemers H.P.J., Gribau T.C.J., Schielen W.J.C. // J. Immunol. Methods. 1995. №184. P.207-217.

4. A.Karimi, A., Matsumura, M., Wright, P.E. & Dyson, H.J. //Characterization of monomeric and dimeric В domain of Staphyloccocal protein A.// J. Peptide Res., 1999, №54, P.344±352.

Перечень последовательностей

SEQ ID №1 аминокислотная последовательность белка MGG

MPFHLAPYLAKSVPGVGVLGALVGGAAALAKNVRLLKEKRITNTEAAIDTGKETVGAGLATALSAVAATAVGGGLVVSLGTALVAGVAAKYAWDRGVDLVEKELNRGKAANGASDEDILRDELAGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKHHHHHH

Способ получения полифункциональных магнитных наночастиц на основе магнетосом, полученных из штамма SO-1 бактерий Magnetospirillum, включающий иммобилизацию гибридного белка MGG, имеющего аминокислотную последовательность SEQ ID №1 (MPFHLAPYLAKSVPGVGVLGALVGGAAALAKNVRLLKEKRITNTEAAIDTGKETVGAGLATALSAVAATAVGGGLVVSLGTALVAGVAAKYAWDRGVDLVEKELNRGKAANGASDEDILRDELAGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKHHHHHH), в присутствии 10 мМ лауриилсаркозината натрия и 100 мМ NaCl на поверхности бактериальных магнетосом посредством ультразвукового воздействия с частотой 10 кГц (0,5 с/0,5 с) в течение 1 мин.



 

Похожие патенты:

Изобретение относится к области генетической инженерии, молекулярной биологии и медицины. Предложен носитель для направленной доставки нуклеиновых кислот в клетки, экспрессирующие рецептор CXCR4, состоящий из последовательности-лиганда к рецептору CXCR4 с последовательностью аминокислот KPVSLSYRSPSRFFESH, линкерного участка из двух молекул ε-аминогексановой кислоты, соединяющей последовательность-лиганд с последовательностью для компактизации нуклеиновых кислот, последовательности, обеспечивающей компактизацию нуклеиновых кислот и выход комплекса из эндосом CHRRRRRRHC.

Изобретение относится к области биотехнологии, конкретно к способу введения молекулы siRNA в цитозоль клетки, и может быть использовано в медицине. Способ включает контактирование указанной клетки с молекулой siRNA, носителем и фотосенсибилизирующим веществом и облучение клетки светом с длиной волны, эффективной для активации фотосенсибилизирующего вещества.

Изобретение относится к области биотехнологии. Описан иммуностимулирующий комплекс, включающий РНК в виде комплекса с одним или более олигонуклеотидами, причем олигонуклеотид обладает свойствами пептида, проникающего в клетку (ППК), содержит от 8 до 15 аминокислотных остатков и характеризуется следующей общей формулой: (Arg)1(Lys)m(His)n(Orn)o(Xaa)x.

Изобретение относится к способу получения генно-инженерного растения. .

Изобретение относится к области молекулярной биологии и биотехнологии и может быть использовано в медицине и в фармацевтической промышленности. .

Изобретение относится к биотехнологии, к способу введения молекулы пептидной нуклеиновой кислоты (ПНК) в цитозоль или в ядро клетки. .

Изобретение относится к области биотехнологии и генетической инженерии, а именно к генно-инженерной конструкции pGoatcasGCSF для экспрессии гранулоцит-колониестимулирующего фактора человека (Г-КСФ).

Изобретение относится к карбосилановым дендримерам, способу их получения и их применению. .

Изобретение относится к новому химическому соединению, а именно к rac-N-[2,3-ди(тетрадецилокси)проп-1-ил]пиридиний бромиду, обладающему способностью доставлять нуклеиновые кислоты в клетки млекопитающих: Технический результат: описанное соединение, обладает низкой токсичностью и способно в виде спиртового раствора доставлять нуклеиновые кислоты в клетки млекопитающих.
Изобретение относится к способу получения минеральной кремниевой воды (МКВ), предназначенной для применения в медицинских целях. Способ получения включает гидролиз тетраэтоксисилана в смеси ТЭОС : этанол : вода, подкисленная HCl.

Изобретение относится к медицинской технике и может быть использовано в стоматологии, травматологии и ортопедии. Описан способ получения наноструктурированнного кальций-фосфатного покрытия для медицинских имплантатов, заключающийся в распылении мишени из стехиометрического гидроксиапатита Ca10(PO4)6(OH)2 в плазме высокочастотного магнетронного разряда в атмосфере аргона при давлении 0.1-1 Па и плотностью мощности на мишени 0.1-1 Вт/см2 в течение 15-180 мин на расстоянии от мишени до подложки в интервале от 40 до 50 мм, где формирование наноструктуры производится после нанесения покрытия в ходе контролируемого термического отжига при температуре 700-750°C в течение 15-30 мин.
Изобретение относится к композициям и полимерным материалам биомедицинского назначения, содержащим наночастицы серебра (0,0005-0,02 мас.%), стабилизированные амфифильными сополимерами малеиновой кислоты (0,0008-0,05 мас.%), низкомолекулярные органические амины (0,0002-0,04 мас.%) и воду.
Изобретение относится к фармацевтической композиции для доставки фармацевтического агента к очагу заболевания. Композиция содержит не растворимый в воде фармацевтический агент, представляющий собой паклитаксел, и фармацевтически приемлемый носитель, представляющий собой альбумин, предпочтительно, альбумин сыворотки человека.

Изобретение относится к медицине. Описано устройство зонтичное (окклюдер) с модифицированным поверхностным слоем для окклюзии ушка левого предсердия.

Изобретение относится к области электротехники, а именно к технологии получения нанокристаллических катодных материалов, применяемых в литий-ионных аккумуляторных батареях.

Изобретение относится к технологии получения композитных наномодифицированных мембран и может быть использовано при изготовлении мембранно-электродных блоков, применяемых в электрохимических устройствах, в том числе в электролизерах воды низкого и высокого давления, портативных электронных устройствах.
Изобретение относится к составам асфальтобетонных смесей и может быть использовано при производстве износостойких долговечных дорожных покрытий с регулируемыми эксплуатационно-технологическими свойствами.

Изобретение относится к области медицины, в частности к материалам из нано/ультратонких волокон, используемых для изготовления медицинских изделий, в частности раневых покрытий, клеточных субстратов, медицинских масок, назальных фильтров, а также фильтров для воздушной и жидкостной фильтрации, сорбентов радионуклидов.

Изобретение относится к способу модификации оболочек полиэлектролитных капсул наночастицами магнетита. Заявленный способ включает получение матрицы-контейнера, в качестве которой используют пористые микрочастицы карбоната кальция, формирование оболочки полиэлектролитных капсул путем последовательной адсорбции полиаллиламина и полистиролсульфоната и модификацию наночастицами магнетита на поверхности матрицы-контейнера или после растворения матрицы путем синтеза наночастиц магнетита методом химической конденсации.

Изобретение относится к устройствам микро- и наноэлектроники. Мемристорные устройства являются устройствами энергонезависимой памяти и могут быть использованы для создания компьютерных систем на основе архитектуры искусственных нейронных сетей. Данное устройство состоит из активного слоя, расположенного между двумя токопроводящими слоями, находящегося с ними в электрическом контакте. Активный слой обладает свойством резистивного переключения и представляет собой двухслойную оксидную структуру HfAlxOy/HfO2. Слой HfAlxOy имеет высокую растворимость и высокую равновесную концентрацию кислородных вакансий, а HfO2 является слоем с низкой растворимостью вакансий. Токопроводящие слои выполнены их нитрида титана или нитрида вольфрама. На границе раздела HfO2/TiN наносится сверхтонкий слой оксида рутения толщиной не менее 0.5 нм. Изобретение обеспечивает повышение стабильности режимов переключения сопротивления в низко- и высокоомное состояние, снижение напряжения переключения, высокую технологическую совместимость с существующими процессами производства кремниевых микросхем. 2 з.п. ф-лы, 2 ил.

Изобретение относится к области биотехнологии, в частности к биотехнологии бактерий, и связано с получением полифункциональных магнитных наночастиц. В качестве настоящего изобретения предложен способ получения полифункциональных магнитных наночастиц на основе бактериальных магнетосом и гибридного белка MGG, позволяющий получать магнетосомы, связывающие иммуноглобулины класса IgG по фрагменту Fc. Задачей настоящего изобретения является получение полифункционального магнитного сорбента, несущего на поверхности магнитных наночастиц лиганды, позволяющие проводить присоединение к частицам иммуноглобулины класса IgG. Результат достигается тем, что в состав липидной мембраны бактериальных магнетосом посредством ультразвуковой обработки интегрируется гибридный белок MGG, аминокислотная последовательность которого содержит трансмембранный домен и область связывания иммуноглобулинов. 4 ил.

Наверх