Способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения



Способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения
Способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения
Способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения
Способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения

 


Владельцы патента RU 2523583:

Федеральное государственное бюджетное учреждение науки Центр "Биоинженерия" Российской академии наук (RU)

Изобретение относится к области биотехнологии, в частности к биотехнологии бактерий, и связано с получением полифункциональных магнитных наночастиц. В качестве настоящего изобретения предложен способ получения полифункциональных магнитных наночастиц на основе бактериальных магнетосом и гибридного белка MGG, позволяющий получать магнетосомы, связывающие иммуноглобулины класса IgG по фрагменту Fc. Задачей настоящего изобретения является получение полифункционального магнитного сорбента, несущего на поверхности магнитных наночастиц лиганды, позволяющие проводить присоединение к частицам иммуноглобулины класса IgG. Результат достигается тем, что в состав липидной мембраны бактериальных магнетосом посредством ультразвуковой обработки интегрируется гибридный белок MGG, аминокислотная последовательность которого содержит трансмембранный домен и область связывания иммуноглобулинов. 4 ил.

 

Изобретение относится к области биотехнологии, в частности к биотехнологии бактерий, и связано с получением полифункциональных магнитных наночастиц.

В качестве настоящего изобретения предложен способ встраивания иммуноглобулин-связывающих белков в естественную мембрану бактериальных магнитных наночастиц при помощи обработки суспензии частиц в растворе целевого белка ультразвуком.

Результаты реализации данного изобретения могут быть использованы при разработке методов магнитного иммуноферментного анализа с целью обнаружения целевых антигенов, а сами модифицированные магнитные частицы могут применяться в качестве сорбирующего агента для выделения иммуноглобулинов.

Известен способ проведения магнитного иммуноферментного анализа с помощью частиц оксида железа Fe2O3, при котором проводится модификация поверхности частиц путем химической сшивки антигенов с поверхностью частиц с помощью глютарового альдегида. Патент РФ RU (11) 2290641 (13) С1.

Известен способ получения модифицированных магнитных наночастиц бактериального происхождения, при котором встраивание целевых белковых молекул в мембрану наночастиц проводится путем генетической трансформации бактерий, продуцирующих магнитные наночастицы вектором, в состав которого входит ген, кодирующий встраиваемый белок. Встраивание требуемого белка в мембрану магнитных наночастиц осуществляется в результате природных биохимических процессов внутри живой клетки (Патент США US 20100292495).

Известен также способ получения модифицированных магнитных наночастиц бактериального происхождения, при котором встраивание целевых белковых молекул в мембрану наночастиц проводится путем экспрессии гибридного белка MagA/целевой белок в клетках магнитотактической бактерии АМВ-1, в чем данный способ сходен с предыдущим (Патент США US 5861285).

Известен способ получения модифицированных магнитных наночастиц бактериального происхождения, при котором проводится химическая сшивка антител против целевого белка (Bt-токсина бактерии Bacillus thuringiensis) с мембраной бактериальных магнетосом бактерии методом карбоксиаминофиксации (патент ЕС CN 1024193 70 (А)).

Недостатками перечисленных выше методов является либо недостаточная специфичность связывания целевых веществ с поверхностью магнитных частиц (как это имеет место при химической сшивке) или неконтролируемый уровень встраивания модифицирующих агентов в мембрану магнетосом (случай генетической модификации).

Проведенный анализ патентных источников показывает, что несмотря на непрерывно возрастающий поток информации о способах использования бактериальных магнитных наночастиц (магнетосом) имеется острая потребность в относительно простых и эффективных методах модификации поверхности магнетосом с целью размещения на внешней мембране искомых целевых веществ. Получаемые такими методами модифицированные магнетосомы могут использоваться в дальнейшем как для проведения исследований в области фундаментальной науки, так и для решения прикладных задач - адресной доставки лекарств, магнитно-резонансной терапии заболеваний, разработки методов магнитной иммуноферментной диагностики и проч.

Задачей предлагаемого метода является высокоэффективное встраивание иммуноглобулин-связывающих белков в природную мембрану магнетосом, что позволяет получать полифункциональные (за счет возможности дальнейшего связывания встроенным белком антител различной специфичности) магнитные наночастицы на основе магнетосом бактериального происхождения. В качестве источника магнетосом была выбрана бактерия Magnetospirillum штамм SO-1, выделенная из прибрежных осадков р.Ольховка (г.Кисловодск). Данный штамм отличает от известных культивируемых магнитотактических бактерий повышенная аэротолерантность, высокая скорость роста и устойчивая продукция магнетосом в широком диапазоне условий культивирования.

Таким образом, изобретение - способ получения полифункциональных магнитных наночастиц на основе магнетосом бактериального происхождения - должно:

а) обеспечивать встраивание гибридного белка MGG [1] (SEQ ID №1) в мембрану бактериальных магнетосом в результате ультразвуковой обработки.

N-конец этого гибридного белка (аминокислоты №№1-124) содержит последовательность аминокислот с гидрофобными свойствами, соответствующую белку Mam12 мембраны магнетосом бактерии Magnetospirillum magnetotacticum MS-1, что обеспечивает закрепление молекулы белка в липопротеиновой мембране бактериальных наночастиц. С-конец (аминокислоты №№130-284) представляет собой тандемно повторяющийся искусственный аналог фрагмента В иммуноглобулин-связывающего белка А бактерии Staphylococcus aureus. N- и С-концы белка связаны между собой глицин-сериновым шарниром (аминокислоты №№125-129), обеспечивающим независимость фолдинга двух доменов белка;

б) обеспечивать связывание антител класса IgG по Fc-фрагменту

Осуществление изобретения

Клеточные линии и питательные среды для роста клеток

Е. coli штамм BL21 (DE3) (F-ompT hsdSB (rB-mB-) gal dcm (DE3)) (Novagene, США), Magnetospirillum sp.SO-1.

Получение и исследование активности иммуноглобулин-связывающего белка MGG

Экспрессию белка MGG проводили в клетках Е. coli штамм BL21 (DE3), трансформированных экспрессионным вектором pET23a(+)/mGG методом автоиндукции [2].

Очистку гибридного белка MGG осуществляли с помощью металлохелатной аффинной хроматографии (МХАХ) из препарата мембранной фракции белков, который суспендировали в буфере А (20 мМ Tris-HCl, рН 8.0, 500 мМ NaCl, 5% глицерин, 10 мМ β-меркаптоэтанол, 10 мМ имидазол, 2 мМ PMSF, 1.5% лаурил саркозин), и инкубировали в течение часа при комнатной температуре. Солюбилизированную мембранную фракцию наносили на сорбент «Ni-NTA agarose» (Invitrogen, США), предварительно уравновешенный буфером А. Далее осуществляли промывку сначала буфером А (не менее 3 объемов сорбента), а затем буфером В: 20 мМ Tris-HCl, рН 8.0, 1 М NaCl, 5% глицерин, 5 мМ имидазол, 1% лаурил саркозин (не менее 3 объемов сорбента). Элюцию целевого белка проводили буфером С 20 мМ Tris-HCl, рН 7.5, 130 мМ NaCl, 5% глицерин, 500 мМ имидазол, 0.5% лаурил саркозин. Элюат диализовали в 20 мМ Tris-HCl, рН 7.5 буфере, содержащем 50 мМ NaCl, 10% глицерин; 14.6 мМ лаурилсаркозин в течение ночи при +4°С. Наличие гексагистидиновой последовательности на С-конце гибридных белков позволило одностадийно получить высокоочищенный препарат белков при помощи МХАХ.

Способность связывания модифицированным белком антител определяли с помощью ИФА. В лунках сорбировали 1 мг инсулина человека в течение ночи при +4°С. Остаточную сорбцию блокировали 1.5% раствором БСА в PBST буфере (137 мМ NaCl, 2.7 мМ КС1, 10 мМ Na2HPO4, 1.8 мМ KH2PO4, 0.01% NaN3, 0.05% Tween 20) в течение часа. Далее добавляли 100 мкл (1 мкг/мл) моноклональных антител мыши против инсулина человека (Имтек, Россия) и инкубировали в течение часа при комнатной температуре. Лунки отмывали 4 раза PBST буфером, после чего наносили с заданными разведениями гибридный белок и инкубировали при комнатной температуре в течение 1 ч. После аналогичной отмывки в течение 1 ч инкубировали 0.1 мкг антител мыши против гистидинового тага (Имтек, Россия); система детекции - перекись водорода/пероксидаза хрена, хромогенный субстрат ТМВ (Sigma, США). В качестве отрицательного контроля использовали полипептид, несущий гистидиновый таг на С-конце.

Специфичность взаимодействия определяли путем вычисления константы диссоциации комплекса гибридного белка с антителом согласно [3]. В каждую лунку наносили по 1 мкг гибридного белка. После блокирования поверхности лунки, добавляли антитела кролика к Fc-фрагменту иммуноглобулина G мыши, конъюгированные с пероксидазой хрена в заданных разведениях. Для сравнения уровня неспецифического связывания антител белком MGG, аналогичным образом был получен гибридный белок MZZ, состоящий из белка Мат 12 и двух доменов Z (широко используемые в биотехнологии синтетические аналоги домена В белка A S. Aureus). Показано, что белки MGG и MZZ проявляют высокий уровень специфичности взаимодействия с антителами: Kaff(MGG)=1.59±0.12 нМ Kaff(MZZ)=1.44±0.16 нМ. На основе полученных данных сделан вывод об иммуноглобулин-связывающей активности двойного G домена, не уступающей ранее известному двойному Z домену.

Из литературных данных [4] известно, что В-домен белка A Staphylococcus aureus способен связываться только с Fc фрагментом иммуноглобулинов класса IgG.

Выделение магнетосом из Magnetospirillum штамм SO-1

Биомассу Magnetospirillum штамм SO-1 получали из 1.5 л культуральной жидкости путем центрифугирования при 10000 об/мин в течение 10 мин. Осажденные клетки (4 г сырой биомассы) ресуспендировали в 20 мл 20 мМ HEPES-буфера с рН=7.4 с добавлением ЭДТА (4 мМ) и фенилметилсульфонилфторида (0.1 мМ) во избежание разрушения белков мембраны магнетосом клеточными протеазами. Для более эффективного разрушения бактериальных клеток осуществляли двукратную процедуру замораживания-оттаивания полученной суспензии. Окончательное разрушение клеток проводили при помощи ультразвукового дезинтегратора Sonopuls UW2070 (Bandelin, Германия) с частотой 20 кГц в течение 10 мин. Суспензию разрушенных клеток переносили в чистые пробирки, и магнитная фракция собиралась на магнитном стенде Promega. Для избавления от остатков разрушенных бактериальных клеток магнитные наночастицы дважды промывали 20 мМ HEPES-буфером с рН=7.4 с добавлением 200 мМ NaCl, с последующей десятикратной промывкой магнетосом 20 мМ HEPES-буфером рН=7.4 на магнитном стенде Promega.

Проверка чистоты и физико-химических свойств бактериальных магнетосом

Чистоту препарата магнетосом и их физико-химические свойства характеризовали с помощью методов атомно-силовой микроскопии (АСМ) (ИНТЕГРА Прима, Нт-МДТ, Россия) (ФИГ.1). Установлено, что магнетосомы, выделенные из Magnetospirillum штамм SO-1, имели одинаковую форму, размеры магнитных кристаллов составляли от 45 до 60 нм. Данные микроскопии свидетельствуют о наличии интактной липопротеиновой мембраны. Элементный состав определяют с помощью метода энергодисперсионной рентгеновской спектроскопии. Показано, что кристаллы магнетосом состоят из магнетита (Fe3O4). Таким образом, разработанный метод позволяет выделять магнитные наночастицы из бактерий Magneto spirillum sp.SO-1 с интактной мембраной, необходимой для последующей модификации магнетосом.

Иммобилизация белка MGG на поверхности магнетосом. Полученный белок MGG иммобилизируют на мембране магнетосом с помощью обработки ультразвуком. Встраивания белка осуществляли в присутствии 10 мМ лауриилсаркозината натрия и 100 мМ NaCl. Для модификации бактериальных наночастиц 1 мл (10 мг/мл) препарата магнетосом в 20 мМ HEPES-буфере с рН=7.4 смешивали с 1 мл (5 мг/мл) белка MGG, со 100 мкл NaCl и 10 мкл лауриилсаркозината натрия. Затем проводили озвучивание смеси с помощью ультразвукового дезинтегратора Sonopuls UW2070 (Bandelin, Германия) с частотой 10 кГц (0.5 с/0,5 с) в течение 1 мин. Полифункциональные бактериальные магнетосомы собирали на магнитном стенде и трижды промывали 20 мМ HEPES-буфером с рН=7.4. Встраивание гибридного белка проверяли с помощью метода АСМ (ИНТЕГРА Прима, Нт-МДТ, Россия) (ФИГ. 2) Функциональную активность модифицированных предлагаемым способом магнетосом проверяли с помощью магнитного иммуноферментного анализа. Для этого 10 мкл (1 мт/мл) модифицированных бактериальных магнетосом добавляли к 1 мл антител мыши против Fc-фрагмента иммуноглобулина человека, конъюгированные с пероксидазой хрена, с заданными разведениями и инкубировали в течение 30 мин при комнатной температуре. После чего магнетосомы 5 раз промывали на магнитном стенде 1 мл 20 мМ HEPES-буфера, рН=7.4 для избавления от несвязанных антител. Уровень связывания определяют спектрофотометрически по цветной реакции пероксидазы с тетраметилбензидином (ФИГ.3).

Пример выполнения предлагаемого способа

10 мкл (1 мг/мл) полифункциональных бактериальных магнетосом добавляли к 1 мл антител мыши против инсулина человека с заданными разведениями и инкубировали в течение 30 мин при комнатной температуре. С целью избавления от несвязанных антител магнетосомы 5 раз промывали на магнитном стенде 1 мл 20 мМ HEPES-буфера, рН=7.4. После чего добавляли 1 мл (1 мкг/мл) антител кролика против Fc-фрагмента иммуноглобулина мыши, конъюгированные с пероксидазой хрена, и инкубировали в течение 30 мин. После аналогичной отмывки несвязанных антител добавляли 100 мкл хромогенного субстрата тетраметилбезидина, реакцию останавливали 20 мкл 1 М HCl. Оптическую плотность раствора измеряли на спектрофотометре при длине волны 405 нм (ФИГ.№4). Полученные данные свидетельствуют о том, что полифункциональные бактериальные магнетосомы могут быть использованы в качестве магнитного сорбента для проведения ИФА высокой чувствительности.

Литература

1. Д.С.Груздев, М.В.Дзюба, А.С.Герасимов, Б.Б.Кузнецов. Получение и исследование активности модифицированных белков мембраны магнетосом. // Прикладная биохимия и микробиология.// В печати.

2. Studier F.W. // Protein Expression and Purification. 2005. №41. P.207-234.

3. Loomans E.M.G., Roelen A.J.M., Van Damme H.S., Bloemers H.P.J., Gribau T.C.J., Schielen W.J.C. // J. Immunol. Methods. 1995. №184. P.207-217.

4. A.Karimi, A., Matsumura, M., Wright, P.E. & Dyson, H.J. //Characterization of monomeric and dimeric В domain of Staphyloccocal protein A.// J. Peptide Res., 1999, №54, P.344±352.

Перечень последовательностей

SEQ ID №1 аминокислотная последовательность белка MGG

MPFHLAPYLAKSVPGVGVLGALVGGAAALAKNVRLLKEKRITNTEAAIDTGKETVGAGLATALSAVAATAVGGGLVVSLGTALVAGVAAKYAWDRGVDLVEKELNRGKAANGASDEDILRDELAGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKHHHHHH

Способ получения полифункциональных магнитных наночастиц на основе магнетосом, полученных из штамма SO-1 бактерий Magnetospirillum, включающий иммобилизацию гибридного белка MGG, имеющего аминокислотную последовательность SEQ ID №1 (MPFHLAPYLAKSVPGVGVLGALVGGAAALAKNVRLLKEKRITNTEAAIDTGKETVGAGLATALSAVAATAVGGGLVVSLGTALVAGVAAKYAWDRGVDLVEKELNRGKAANGASDEDILRDELAGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGDNKFNKGQQNAFYEILHLPNLNEEQRNGLIQSLKDDPSQSANLLAEAKKLNDAQAPKHHHHHH), в присутствии 10 мМ лауриилсаркозината натрия и 100 мМ NaCl на поверхности бактериальных магнетосом посредством ультразвукового воздействия с частотой 10 кГц (0,5 с/0,5 с) в течение 1 мин.



 

Похожие патенты:

Изобретение относится к области генетической инженерии, молекулярной биологии и медицины. Предложен носитель для направленной доставки нуклеиновых кислот в клетки, экспрессирующие рецептор CXCR4, состоящий из последовательности-лиганда к рецептору CXCR4 с последовательностью аминокислот KPVSLSYRSPSRFFESH, линкерного участка из двух молекул ε-аминогексановой кислоты, соединяющей последовательность-лиганд с последовательностью для компактизации нуклеиновых кислот, последовательности, обеспечивающей компактизацию нуклеиновых кислот и выход комплекса из эндосом CHRRRRRRHC.

Изобретение относится к области биотехнологии, конкретно к способу введения молекулы siRNA в цитозоль клетки, и может быть использовано в медицине. Способ включает контактирование указанной клетки с молекулой siRNA, носителем и фотосенсибилизирующим веществом и облучение клетки светом с длиной волны, эффективной для активации фотосенсибилизирующего вещества.

Изобретение относится к области биотехнологии. Описан иммуностимулирующий комплекс, включающий РНК в виде комплекса с одним или более олигонуклеотидами, причем олигонуклеотид обладает свойствами пептида, проникающего в клетку (ППК), содержит от 8 до 15 аминокислотных остатков и характеризуется следующей общей формулой: (Arg)1(Lys)m(His)n(Orn)o(Xaa)x.

Изобретение относится к способу получения генно-инженерного растения. .

Изобретение относится к области молекулярной биологии и биотехнологии и может быть использовано в медицине и в фармацевтической промышленности. .

Изобретение относится к биотехнологии, к способу введения молекулы пептидной нуклеиновой кислоты (ПНК) в цитозоль или в ядро клетки. .

Изобретение относится к области биотехнологии и генетической инженерии, а именно к генно-инженерной конструкции pGoatcasGCSF для экспрессии гранулоцит-колониестимулирующего фактора человека (Г-КСФ).

Изобретение относится к карбосилановым дендримерам, способу их получения и их применению. .

Изобретение относится к новому химическому соединению, а именно к rac-N-[2,3-ди(тетрадецилокси)проп-1-ил]пиридиний бромиду, обладающему способностью доставлять нуклеиновые кислоты в клетки млекопитающих: Технический результат: описанное соединение, обладает низкой токсичностью и способно в виде спиртового раствора доставлять нуклеиновые кислоты в клетки млекопитающих.
Изобретение относится к способу получения минеральной кремниевой воды (МКВ), предназначенной для применения в медицинских целях. Способ получения включает гидролиз тетраэтоксисилана в смеси ТЭОС : этанол : вода, подкисленная HCl.

Изобретение относится к медицинской технике и может быть использовано в стоматологии, травматологии и ортопедии. Описан способ получения наноструктурированнного кальций-фосфатного покрытия для медицинских имплантатов, заключающийся в распылении мишени из стехиометрического гидроксиапатита Ca10(PO4)6(OH)2 в плазме высокочастотного магнетронного разряда в атмосфере аргона при давлении 0.1-1 Па и плотностью мощности на мишени 0.1-1 Вт/см2 в течение 15-180 мин на расстоянии от мишени до подложки в интервале от 40 до 50 мм, где формирование наноструктуры производится после нанесения покрытия в ходе контролируемого термического отжига при температуре 700-750°C в течение 15-30 мин.
Изобретение относится к композициям и полимерным материалам биомедицинского назначения, содержащим наночастицы серебра (0,0005-0,02 мас.%), стабилизированные амфифильными сополимерами малеиновой кислоты (0,0008-0,05 мас.%), низкомолекулярные органические амины (0,0002-0,04 мас.%) и воду.
Изобретение относится к фармацевтической композиции для доставки фармацевтического агента к очагу заболевания. Композиция содержит не растворимый в воде фармацевтический агент, представляющий собой паклитаксел, и фармацевтически приемлемый носитель, представляющий собой альбумин, предпочтительно, альбумин сыворотки человека.

Изобретение относится к медицине. Описано устройство зонтичное (окклюдер) с модифицированным поверхностным слоем для окклюзии ушка левого предсердия.

Изобретение относится к области электротехники, а именно к технологии получения нанокристаллических катодных материалов, применяемых в литий-ионных аккумуляторных батареях.

Изобретение относится к технологии получения композитных наномодифицированных мембран и может быть использовано при изготовлении мембранно-электродных блоков, применяемых в электрохимических устройствах, в том числе в электролизерах воды низкого и высокого давления, портативных электронных устройствах.
Изобретение относится к составам асфальтобетонных смесей и может быть использовано при производстве износостойких долговечных дорожных покрытий с регулируемыми эксплуатационно-технологическими свойствами.

Изобретение относится к области медицины, в частности к материалам из нано/ультратонких волокон, используемых для изготовления медицинских изделий, в частности раневых покрытий, клеточных субстратов, медицинских масок, назальных фильтров, а также фильтров для воздушной и жидкостной фильтрации, сорбентов радионуклидов.

Изобретение относится к способу модификации оболочек полиэлектролитных капсул наночастицами магнетита. Заявленный способ включает получение матрицы-контейнера, в качестве которой используют пористые микрочастицы карбоната кальция, формирование оболочки полиэлектролитных капсул путем последовательной адсорбции полиаллиламина и полистиролсульфоната и модификацию наночастицами магнетита на поверхности матрицы-контейнера или после растворения матрицы путем синтеза наночастиц магнетита методом химической конденсации.

Изобретение относится к устройствам микро- и наноэлектроники. Мемристорные устройства являются устройствами энергонезависимой памяти и могут быть использованы для создания компьютерных систем на основе архитектуры искусственных нейронных сетей. Данное устройство состоит из активного слоя, расположенного между двумя токопроводящими слоями, находящегося с ними в электрическом контакте. Активный слой обладает свойством резистивного переключения и представляет собой двухслойную оксидную структуру HfAlxOy/HfO2. Слой HfAlxOy имеет высокую растворимость и высокую равновесную концентрацию кислородных вакансий, а HfO2 является слоем с низкой растворимостью вакансий. Токопроводящие слои выполнены их нитрида титана или нитрида вольфрама. На границе раздела HfO2/TiN наносится сверхтонкий слой оксида рутения толщиной не менее 0.5 нм. Изобретение обеспечивает повышение стабильности режимов переключения сопротивления в низко- и высокоомное состояние, снижение напряжения переключения, высокую технологическую совместимость с существующими процессами производства кремниевых микросхем. 2 з.п. ф-лы, 2 ил.
Наверх