Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом



Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом
Калибратор/регулятор для синхронного анализа белков, способных к комплексообразованию друг с другом

 


Владельцы патента RU 2523887:

ОРТО-КЛИНИКАЛ ДАЙЭГНОСТИКС, ИНК. (US)

Настоящая группа изобретений относится к медицине, а именно к медицинской диагностике, и касается калибратора для синхронного анализа белков, способных к комплексообразованию друг с другом. Для этого используют композицию, включающую два белка, в которых одна или более аминокислот или одна или более неаминокислотных групп одного и/или двух белков удалены, модифицированы или заменены другой неаминокислотной группой или группами. Это исключает взаимное связывание белков. Затем осуществляют контакт композиции с иммобилизованным рецептором, специфичным для определяемого белка, и по уровню связывания маркированного рецептора определяют присутствие и количество белка в композиции. 3 н. и 11 з.п. ф-лы, 3ил., 3 пр., 6 табл.

 

ПЕРЕКРЕСТНЫЕ ССЫЛКИ НА СМЕЖНЫЕ ИЗОБРЕТЕНИЯ

Данная заявка притязает на приоритет предварительной заявки на патент США № 61/019443 от 7 января 2008 года.

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к способам и композициям, содержащим два и более белков, измененных с целью предотвращения их взаимного распознавания и связывания. Композиции могут использоваться в качестве эталона, калибратора или регулятора в аналитических испытаниях, способных выявлять как измененные, так и неизмененные или нативные формы одного или нескольких белков.

ПРЕДПОСЫЛКИ СОЗДАНИЯ ИЗОБРЕТЕНИЯ

Преэклампсия - синдром гипертензии, отечности и протеинурии, который поражает от 5 до 10% беременных и может привести к развитию тяжелых заболеваний у матери и плода вплоть до смертельного исхода. Ежегодно по всему миру регистрируется по меньшей мере 200000 материнских смертей в результате преэклампсии. Симптомы преэклампсии обычно проявляются после 20-й недели беременности.

Развитию плода и плаценты способствуют несколько факторов роста. Фактор роста эндотелия сосудов (VEGF) является митогеном клеток эндотелия и фактором, индуцирующим ангиогенез. VEGF обеспечивает проницаемость сосудов и участвует в гломерулярном восстановлении капилляров. VEGF, являясь гомодимером, связывается с одной из двух гомологичных трансмембранных рецепторных тирозинкиназ, ФМС-подобной тирозинкиназой (Flt-1) и киназным доменом рецептора (KDR).

Плацентарный фактор роста (PlGF) относится к семейству VEGF и также участвует в развитии плаценты. PlGF состоит из цитотрофобластов и синцитиотрофобластов и обладает способностью индуцировать пролиферацию, миграцию и активацию эндотелиальных клеток. PlGF, являясь гомодимером, связывается с рецептором Flt-1, но не с рецептором KDR. Как PlGF, так и VEGF способствуют митогенной активности и ангиогенезу, которые играют важнейшую роль в развитии плаценты.

Растворимая форма рецептора Flt-1 (sFlt-1) была выделена в культивируемой среде эндотелиальных клеток пупочной вены человека, а затем экспрессирована in vivo в плацентарной ткани. sFlt-1 является сращенным вариантом рецептора Flt-1, у которого отсутствуют трансмембранный и цитоплазматический домены. sFlt-1 связывается с VEGF с высокой аффинностью, но не стимулирует митогенез эндотелиальных клеток. Считается, что sFlt-1 выступает в качестве "физиологического поглотителя" для понижающего регулирования сигнальных путей VEGF. Регулирование уровней sFlt-1, таким образом, позволяет модулировать сигнальные пути VEGF и VEGF. Точное регулирование сигнальных путей VEGF и PlGF крайне необходимо для поддержания адекватной пролиферации, миграции и ангиогенеза у трофобластных клеток в процессе развития плаценты.

Единственный ген кодирует человеческий PlGF. Однако сплайсинг зрелого PlGF mRNA дает в результате три изоформы различной длины: PlGF-1 (PlGF131), PlGF-2 (PlGF152) и PlGF-3 (PlGF203). В другом варианте упоминается PlGF-4 (Yang, et al., J. Reprod. Immunol., v.60, p.53-60, 2003). PlGF выделен в виде гликозилированного гомодимера.

Недавние исследования показали, что sFlt-1 и PlGF по отдельности или в сочетании друг с другом могут использоваться в качестве биомаркеров для прогнозирования, диагностики или мониторинга преэклампсии (Levine et al., NEJM, v.350, p.672-683, 2004).

Аминокислотная последовательность зрелого PlGF-1 человека (аминокислотные остатки 1-132) опубликована и получена из базы данных белков, обозначаемой PDB 1FZV (Iyer, et al., J. Biol. Chem., v.276, p.12153-12161, 2001). Данная последовательность обозначается здесь как SEQ ID NO:1:

MLPAVPPQQW ALSAGNGSSE VEVVPFQEVW GRSYCRALER

LVDVVSEYPS EVEHMFSPSC VSLLRCTGCC GDENLHCVPV

ETANVTMQLL KIRSGDRPSY VELTFSQHVR CECRPLREKM

KPERCGDAVP RR

Диагностика риска развития или наличия преэклампсии у индивида может быть выполнена путем выявления присутствия или определения количества фактора роста эндотелия сосудов, в частности PlGF, и/или рецепторной тирозинкиназы, в частности sFlt-1 в биологическом образце (таком как моча, цельная кровь, сыворотка крови, плазма, слюна и т.п.), взятом у индивида. По данным аналитических испытаний калибровочные и регуляторные композиции играют существенную роль в определении количества или подтверждении наличия целевого анализируемого материала и в установлении достоверности и уточнении аналитического анализа. Приготовление таких композиций в форме жидкости или сухой смеси, как правило, не представляет трудности, если анализируемый материал уже имеется в наличии, растворим в подходящем растворителе (обычно водном) для биологических аналитов, стабилен и не подвергается разрушительному взаимодействию с другими компонентами, которые могут содержаться в композиции. Как отмечалось выше, PlGF связывается с sFlt-1 и образует стабильный ассоциированный комплекс. В результате приготовление композиций, содержащих нативные белки в индивидуальной пропорции, подходящей для использования в качестве эталонного образца, калибратора или регулятора в аналитических испытаниях для выявления PlGF или sFlt-1 или PlGF и sFlt-1 вместе, не представляется возможным. Несмотря на то что можно приготовить композиции, содержащие одиночные, отдельные белки, предпочтительнее было бы приготовить композиции, содержащие оба белка. Таким образом, существует потребность в эталонных, калибровочных или регуляторных композициях, в которых бы содержались эти белки вместе в известных и индивидуальных количествах. Настоящее изобретение удовлетворяет эту потребность.

КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

В одном аспекте настоящее изобретение относится к композиции, содержащей два или несколько белков, при этом один или несколько белков были изменены, чтобы в достаточной мере сократить или существенно предотвратить или исключить взаимное распознавание и связывание. Такая композиция может использоваться в качестве эталонного образца, калибратора или регулятора в аналитических испытаниях для одного или нескольких белков в композиции.

В отношении двух неизмененных белков/нативных белков A и B, которые образуют нековалентный ассоциированный комплекс, выражение "существенно предотвратить или исключить взаимное распознавание и связывание" означает, что в испытании на определение их взаимного связывания связывание измененного A с неизмененным/нативным B, или связывание неизмененного/нативного A с измененным B, или связывание измененного A с измененным B не поддается обнаружению, или едва обнаружимо, или взаимная аффинность, количественно измеряемая путем определения аффинных констант, составляет менее 10% исследованных неизмененных/нативных A и неизмененных/нативных B. Выражение "существенно сократить" означает, что взаимное связывание имеет место, но его удалось снизить до степени, приемлемой в конкретном случае применения.

Рассмотрим случай, когда необходимо определить присутствие или количество неизмененного или нативного белка A путем аналитического исследования, причем в исследовании используется один или несколько рецепторов, специфичных для эпитопов белка A. Следует учитывать, что белок A был изменен для того, чтобы существенно сократить или исключить связывание с белком B. Несмотря на то что белок A был изменен, эпитопы остались интактными или приемлемо интактными, сохранив способность распознавать и связывать рецепторы. Благодаря этому измененный белок A подходит для калибрования образцов для анализа, подтверждения присутствия неизмененного/нативного белка A в образце или для подтверждения надежности и точности анализа в отношении неизмененного/нативного белка A. Таким образом, в целом рецепторы способны распознавать и связывать как измененные, так и неизмененные/нативные формы белка. Аналитические исследования с применением рецепторов, как правило, представляют собой иммуноанализы, где в качестве рецепторов используются поликлональные или моноклональные антитела, полные, полимерные и/или химерные формы антител или фрагментов антител. Также возможно применение других видов рецепторов, таких как аптамеры (US 5840867; US 6207388). В аналитическом исследовании на определение неизмененного или нативного белка B с использованием рецепторов, специфичных для эпитопов белка B, эпитопы измененного белка A не обязательно должны оставаться интактными. При этом важно в достаточной мере сократить или существенно исключить взаимное распознавание и связывание измененного белка A и белка B.

Если и белок А, и белок B были изменены с целью сокращения или существенного исключения их взаимного распознавания и связывания, то в аналитическом исследовании на определение неизмененного/нативного белка A или в аналитическом исследовании на определение неизмененного/нативного белка B или в аналитическом исследовании на определение обоих неизмененных/нативных белков A и B используются рецепторы, специфичные для эпитопов белка A, и рецепторы, специфичные для эпитопов белка B; эти эпитопы в измененных белках сохраняют способность распознавать и связывать рецепторы, используемые в исследовании. Композиции, содержащие одновременно измененный белок A и измененный белок B, могут впоследствии применяться для калибрования образцов для анализа, подтверждения присутствия неизмененного/нативного белка A или неизмененного/нативного белка B или обоих белков - неизмененного/нативного белка A и неизмененного/нативного белка B, а также для подтверждения достоверности и точности исследований.

В другом аспекте настоящее изобретение относится к эталонным, калибровочным и регуляторным композициям для использования в анализе на первый белок или на второй белок или и на первый, и на второй белок, где одна или несколько аминокислот или одна или несколько неаминокислотных групп первого белка или второго белка или и первого, и второго белка удалены, модифицированы или заменены другой аминокислотой или неаминокислотной группой или группами, тем самым сокращая или существенно исключая взаимное связывание первого белка со вторым белком.

В еще одном аспекте настоящее изобретение относится к композиции, содержащей рецепторную тирозинкиназу, предпочтительно ФМС-подобную тирозинкиназу, в еще более предпочтительном варианте - sFlt-1 и фактор роста эндотелия сосудов, когда один из них или оба вместе изменены путем удаления, модификации или замены аминокислоты или гликозила. Фактором роста эндотелия сосудов может быть плацентарный фактор роста и, предпочтительно, PlGF-1. Предпочтительная композиция включает sFlt-1 и измененный PlGF-1, имеющий аланин вместо

a) пролина в позиции 25 в последовательности SEQ ID NO:1, или

b) глутамина в позиции 27 в последовательности SEQ ID NO:1, или

c) цистеина в позиции 60 в последовательности SEQ ID NO:1, или

d) аспартата в позиции 72 в последовательности SEQ ID NO:1, или

e) глутамата в позиции 73 в последовательности SEQ ID NO:1, или

f) аспарагина в позиции 84 в последовательности SEQ ID NO:1, или

g) пролина в позиции 98 в последовательности SEQ ID NO:1, или

h) тирозина в позиции 100 в последовательности SEQ ID NO:1, или

измененный PlGF-1, имеющий глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO:1, или любую комбинацию аланиновых замен согласно пунктам "a-h" и глициновую замену.

Предпочтительная композиция включает sFlt-1 и измененный PlGF-1, имеющий аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO:1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO:1.

Другая предпочтительная композиция включает sFlt-1 и измененный PlGF-1, имеющий глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO:1, аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO:1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO:1.

В еще одном аспекте настоящее изобретение относится к способу калибрования образца для анализа на белок в пробе, включающему этапы:

1) контакт, как описано выше, с композицией, содержащей известное количество белка с рецептором, специфичным для первого эпитопа белка, и, как следствие, образование комплекса, содержащего рецептор и белок композиции;

2) контакт комплекса, образованного на этапе 1), с маркированным рецептором, специфичным для второго эпитопа белка, и, как следствие, образование комплекса, включающего рецептор, белок композиции и маркированный рецептор;

3) выявление сигнала от связанного маркированного рецептора или сигнала от свободного маркированного рецептора; и

4) ассоциирование сигнала от свободного или связанного рецептора с известным количеством белка в композиции.

В еще одном аспекте настоящее изобретение относится к способу калибрования образца для анализа на белок в пробе, включающему этапы:

1) контакт, как описано выше, с композицией, содержащей известное количество белка с иммобилизованным рецептором, специфичным для первого эпитопа белка, и, как следствие, образование комплекса, включающего иммобилизованный рецептор и белок композиции;

2) контакт комплекса, образованного на этапе 1), с маркированным рецептором, специфичным для второго эпитопа белка, и, как следствие, образование комплекса, включающего иммобилизованный рецептор, белок композиции и маркированный рецептор;

3) отделение связанного маркированного рецептора от свободного маркированного рецептора;

4) выявление сигнала от связанного маркированного рецептора или сигнала от свободного маркированного рецептора; и

5) ассоциирование сигнала от свободного или связанного рецептора с известным количеством белка в композиции.

В еще одном аспекте настоящее изобретение относится к способу калибрования образца для анализа на рецепторную тирозинкиназу и/или фактор роста эндотелия сосудов в пробе, включающему этапы:

1) приготовление композиции, содержащей известное или предварительно установленное количество рецепторной тирозинкиназы и известное или предварительно установленное количество фактора роста эндотелия сосудов, причем любой из двух компонентов или оба вместе могут быть изменены, как описано выше, для сокращения или существенного исключения взаимного распознавания и связывания;

2) контакт с композицией, содержащей рецептор, специфичный для первого эпитопа рецепторной тирозинкиназы, и/или рецептор, специфичный для первого эпитопа фактора роста эндотелия сосудов, и, как следствие, образование первых комплексов, включающих рецептор, специфичный для первого эпитопа рецепторной тирозинкиназы, и рецепторную тирозинкиназу, и/или рецептор, специфичный для первого эпитопа фактора роста эндотелия сосудов, и фактор роста эндотелия сосудов;

3) контакт комплексов, образованных на этапе 2), с маркированным рецептором, специфичным для второго эпитопа рецепторной тирозинкиназы и/или маркированным рецептором, специфичным для второго эпитопа фактора роста эндотелия сосудов; и, как следствие, образование вторых комплексов, включающих рецептор, специфичный для первого эпитопа рецепторной тирозинкиназы, рецепторную тирозинкиназу и маркированный рецептор, специфичный для второго эпитопа рецепторной тирозинкиназы, и/или рецептор, специфичный для первого эпитопа фактора роста эндотелия сосудов, фактор роста эндотелия сосудов и маркированный рецептор, специфичный для второго эпитопа фактора роста эндотелия сосудов;

4) отделение связанного маркированного рецептора, специфичного для рецепторной тирозинкиназы, от свободного маркированного рецептора, специфичного для рецепторной тирозинкиназы и/или связанного маркированного рецептора, специфичного для фактора роста эндотелия сосудов, от свободного маркированного рецептора, специфичного для фактора роста эндотелия сосудов;

5) выявление сигнала от связанного маркированного рецептора, специфичного для рецепторной тирозинкиназы, или сигнала от свободного маркированного рецептора, специфичного для рецепторной тирозинкиназы; и/или

6) выявление сигнала от связанного маркированного рецептора, специфичного для фактора роста эндотелия сосудов, или сигнала от свободного маркированного рецептора, специфичного для фактора роста эндотелия сосудов; и

7) ассоциирование сигнала от свободного или связанного рецептора, специфичного для рецепторной тирозинкиназы, и сигнала от свободного или связанного рецептора, специфичного для фактора роста эндотелия сосудов, с известным количеством рецепторной тирозинкиназы и/или фактора роста эндотелия сосудов в композиции.

В предпочтительном варианте осуществления изобретения в качестве рецепторной тирозинкиназы используется sFlt-1, а в качестве фактора роста эндотелия сосудов используется PlGF-1, причем PlGF-1 изменен и имеет аланин вместо

a) пролина в позиции 25 в последовательности SEQ ID NO:1, или

b) глутамина в позиции 27 в последовательности SEQ ID NO:1, или

c) цистеина в позиции 60 в последовательности SEQ ID NO:1, или

d) аспартата в позиции 72 в последовательности SEQ ID NO:1 или

e) глутамата в позиции 73 в последовательности SEQ ID NO:1, или

f) аспарагина в позиции 84 в последовательности SEQ ID NO:1, или

g) пролина в позиции 98 в последовательности SEQ ID NO:1, или

h) тирозина в позиции 100 в последовательности SEQ ID NO:1, или

измененный PlGF-1, имеющий глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO:1, или любую комбинацию аланиновых замен в соответствии с пунктами a)-h) и глициновую замену.

В более предпочтительном варианте осуществления изобретения в качестве рецепторной тирозинкиназы используется sFlt-1, а в качестве фактора роста эндотелия сосудов используется PlGF-1, причем PlGF-1 изменен и имеет аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO:1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO:1.

В другом более предпочтительном варианте осуществления изобретения в качестве рецепторной тирозинкиназы используется sFlt-1, а в качестве фактора роста эндотелия сосудов используется PlGF-1, причем PlGF-1 изменен и имеет глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO:1, аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO:1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO:1.

В еще одном аспекте настоящее изобретение относится к способу определения количества или подтверждения присутствия белка в образце, включающему следующие этапы:

a) контакт образца с иммобилизованным рецептором, специфичным для первого эпитопа белка, и, как следствие, образование первого комплекса, включающего иммобилизованный рецептор, специфичный для первого эпитопа белка, и белок;

b) контакт первого комплекса с маркированным рецептором, специфичным для второго эпитопа белка, и, как следствие, образование второго комплекса, состоящего из рецептора, специфичного для первого эпитопа белка, белка и маркированного рецептора, специфичного для второго эпитопа белка;

c) отделение маркированного рецептора, который связан во втором комплексе, от свободного маркированного рецептора;

d) выявление сигнала от маркированного рецептора, который связан во втором комплексе, или сигнала от свободного маркированного рецептора;

e) контакт иммобилизованного рецептора, специфичного для первого эпитопа белка, с композицией, описанной выше, содержащей известное или предварительно заданное количество белка, и, как следствие, образование третьего комплекса, содержащего иммобилизованный рецептор, специфичный для первого эпитопа белка и белок композиции;

f) контакт третьего комплекса с маркированным рецептором, специфичным для второго эпитопа белка, и, как следствие, образование четвертого комплекса из рецептора, специфичного для первого эпитопа белка, белка композиции и маркированного рецептора, специфичного для второго эпитопа белка;

g) отделение маркированного рецептора, который связан в четвертом комплексе, от свободного маркированного рецептора;

h) выявление сигнала от маркированного рецептора, который связан в четвертом комплексе, или сигнала от свободного маркированного рецептора; и

i) сравнение сигналов, выявленных в соответствии с пунктами d) и h), для подтверждения присутствия белка или для измерения количества белка в образце.

В предпочтительном варианте осуществления изобретения определяемым белком является фактор роста эндотелия сосудов. В более предпочтительном варианте осуществления изобретения определяемым белком является PlGF, в частности PlGF-1, а вторым белком в композиции является рецепторная тирозинкиназа. В еще более предпочтительном варианте осуществления изобретения определяемым белком является PlGF-1, а вторым белком в композиции является sFlt-1. В еще более предпочтительном варианте осуществления изобретения определяемым белком является PlGF-1, вторым белком в композиции является sFLt-1, а PlGF-1 композиции изменен и включает аланин вместо

a) пролина в позиции 25 в последовательности SEQ ID NO:1, или

b) глутамина в позиции 27 в последовательности SEQ ID NO:1, или

c) цистеина в позиции 60 в последовательности SEQ ID NO:1, или

d) аспартата в позиции 72 в последовательности SEQ ID NO:1, или

e) глутамата в позиции 73 в последовательности SEQ ID NO:1, или

f) аспарагина в позиции 84 в последовательности SEQ ID NO:1, или

g) пролина в позиции 98 в последовательности SEQ ID NO:1, или

h) тирозина в позиции 100 в последовательности SEQ ID NO:1, или

измененный PlGF-1, имеющий глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO:1, или любую комбинацию аланиновых замен в соответствии с пунктами a)-h) и глициновую замену.

В более предпочтительном варианте осуществления изобретения определяемым белком является PlGF-1, вторым белком композиции является sFlt-1, а PlGF-1 композиции содержит аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO:1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO:1.

В другом более предпочтительном варианте осуществления изобретения определяемым белком является PlGF-1, вторым белком композиции является sFlt-1, а PlGF-1 композиции содержит глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO:1, аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO:1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO:1.

КРАТКОЕ ОПИСАНИЕ ФИГУР

На фиг.1A на основе иммуноферментного анализа представлено связывание вариантов PlGF-1 с растворимой частью Flt-1. Связывание вариантов PlGF-1 с Flt-1 человека, нанесенного слоем 0,5 мкг/мл на 96-луночный планшет, было выполнено путем повышения концентраций растворимых белков в диапазоне 1-16 нг/мл. В качестве положительного контроля использован дикий тип PlGF-1.

На фиг.1B на основе иммуноферментного анализа представлено связывание вариантов PlGF-1 с растворимой частью Flt-1. Процентная доля связывания вариантов PlGF-1 концентрацией 8 нг/мл рассчитана с учетом связывания дикого типа PlGF-1. Представленные результаты являются средним показателем трех независимых экспериментов.

На фиг.2 отображена чистота трех рекомбинантных белков PlGF. Окрашивание серебром (A: дорожки 1, 2 и 3) и вестерн-блоттинг моноклональных Rat-4 (B: дорожки 4, 5 и 6). Оценка дорожек: M: лэддер SeeBlue (Invitrogen), дорожки 1, 4 - P126(DE), дорожки 2, 5 - P126(AA) и дорожки 3,6 - P126(GAA).

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Несмотря на то что настоящее изобретение будет описано с точки зрения определенных предпочтительных вариантов осуществления изобретения применительно к преэклампсии и белкам-биомаркерам sFlt-1 и PlGF-1, подразумевается, что изобретение относится к любой композиции белков и ее использованию, где один или несколько компонентных белков композиции изменены с целью сокращения их взаимного распознавания и связывания.

Независимо от того, каким образом выявляют белки-биомаркеры преэклампсии - при помощи единой аналитической платформы или набора реактивов, либо отдельно друг от друга в независимых аналитических исследованиях или при помощи отдельных наборов реактивов, полезно было бы иметь регулятор или калибратор, содержащий одновременно оба белка-биомаркера в одной композиции с известным или предварительно установленным и необходимым соотношением концентраций. Существуют по меньшей мере две проблемы, связанные с совместным применением sFlt-1 и PlGF в нативной или неизмененной форме для приготовления эталонных, калибровочных или регуляторных композиций: во-первых, sFlt-1 и PlGF связываются друг с другом посредством специфичного связывающего домена, присутствующего в каждом белке, как уже отмечалось, а во-вторых, в сыворотке крови женщин во второй половине беременности уровень sFlt-1 обычно значительно превышает уровень PlGF независимо от того, страдают они преэклампсией или нет. Немодифицированный или нативный PlGF, объединенный и хранящийся вместе с немодифицированным или нативным sFlt-1, не способен удовлетворительно выполнять требуемые функции в композиции, используемой для калибрования образцов для анализа на определение PlGF или sFlt-1 вследствие практически количественного связывания PlGF с sFlt-1.

Для сокращения или существенного исключения взаимного распознавания и связывания sFlt-1 и PlGF были реализованы аминокислотные изменения PlGF (Errico et al. J. Biol. Chem. 279, 43929-43939, 2004). Эти аминокислотные изменения не имеют значительного воздействия на общую структуру белка PlGF. Изменения не затрагивают связывающие эпитопы, что позволяет сочетать и хранить эти измененные белки вместе с sFlt-1 в составе композиции, используемой в качестве эталона, калибратора или регулятора в аналитических исследованиях, направленных на выявление неизмененного или нативного PlGF, неизмененного или нативного sFlt-1, или того и другого вместе.

Направленность аминокислотных изменений, удалений или замен на PlGF с целью сокращения или существенного исключения связывания с sFlt-1 упростилась благодаря наличию аминокислотной последовательности PlGF и трехмерной кристаллической структуры.

В целом полезно было бы знать вторичную, третичную и четвертичную структуры, посттрансляционные модификации (например, фосфорилирование, гликозилирование, сульфатирование и убиквитинилирование), трехмерную кристаллическую структуру связывающих белков и белков, участвующих в ассоциированном комплексе. Однако для осуществления настоящего изобретения эта информация не требуется. Хотя можно выполнить модификацию, удаление или замену групп, связанных с посттрансляционными модификациями, более предпочтительной является модификация, удаление или замена одной или нескольких аминокислот одного или нескольких белков, участвующих во взаимном распознавании и связывании. Сайт-специфичная химическая модификация белков хорошо известна в этой области знаний (Techniques in Protein Modification, Lundblad R.L., CRC Press, 1995; Chemical Reagents for Protein Modification, Lundblad, R.L., CRC Press, 3rd ed., 2005). Химическая/синтетическая модификация аминокислот может использоваться для осуществления настоящего изобретения. Предпочтительный подход включает методы генной инженерии. Прямое получение аминокислотной последовательности белка является общепринятой практикой в данной области знаний. Аналогично этому к общепринятой практике в этой области знаний относится опосредованное получение аминокислотной последовательности белка из нуклеотидной последовательности гена, кодирующего белок. Получение нуклеотидной последовательности гена не представляет трудности. Тогда при наличии гена можно выполнить сайт-направленный мутагенез для удаления, замены или модификации одной или нескольких аминокислот. Это можно осуществить произвольным или предетерминированным способом. Белок, измененный или мутированный путем сайт-направленного мутагенеза, можно клонировать и сделать более доступным. Белок и подробные данные и описания методов генной инженерии имеются в целом ряде публикаций и приведенных в них ссылок (Molecular Cloning, Sambrook J. and Russell D.W., Cold Spring Harbor Laboratory Press, 2002; Recombinant Gene Expression Protocols, Tuan R.S. ed., Humana Press, 1997; Methods in Molecular Biology and Protein Chemistry, Spangler B.D., John Wiley & Sons Ltd. 2002; Genetic Engineering Fundamentals, Kammermeyer K. and Clark V.L., Marcel Dekker Inc., 1989; Mayo et al., Nature, v.306, p.86-88, 1983; Suggs et al., Proc. Nat. Acad. Sci. USA, v.78, p.6613−6617 1981; Scott et al. Nature, v.302, p.538−540, 1983; Helfman et al., Proc. Nat. Acad. Sci. USA, v.80, p.31−35, 1983; Young et al., Proc. Nat. Acad. Sci. USA, v.80, p.1194−1198, 1983; US 4237224; US 4273875; US 4293652; US 4870009).

Измененный белок можно протестировать, чтобы определить, насколько удалось сократить или существенно исключить взаимное распознавание и связывание этого белка с белком-партнером (белками-партнерами). Тестирование можно провести в соответствии с описаниями опытов, широко известных в данной области знаний. Измененный белок также можно протестировать с целью определения степени интактности эпитопов в сравнении с неизмененным или нативным белком при помощи рецепторов/антител, специфичных для эпитопов. Аффинность можно охарактеризовать количественно или качественно (Errico et al., J. Biol. Chem., v.279, p.43929-43939, 2004; Piehler et al., J. Immunol. Methods, v.201(2), p.189-206, 1997; Casasnovas et al., v.270, p.13216-13224, 1995; Boone et al., J. Virol., v.11, p.515-519, 1973; US 7081346; US 5324633; US 4340668; US 2005/0175999).

Вне зависимости от природы измененной группы или групп (аминокислотная и/или неаминокислотная), или природы изменения/модификации белка (прямая химическая модификация - окисление, восстановление и т.п.), удаления или замены группы (групп), или независимо от того, был изменен один из белков или все белки, участвующие во взаимном распознавании и связывании, можно выделить два важных функциональных признака: 1) взаимное распознавание и связывание измененного белка с неизмененным белком-партнером или связывание белков-партнеров, каждый из которых был изменен, таковы, что взаимное распознавание и связывание значительно сокращаются или существенно исключаются; и 2) один или несколько эпитопов любого измененного белка сохраняют связывающую способность, достаточно адекватную или существенно идентичную связывающей способности эпитопа (эпитопов) неизмененного или нативного белка, если эта способность необходима для конкретного применения, как отмечалось ранее.

ПРИМЕР I

Человеческий PlGF-1 и его варианты, sFlt-1, античеловеческие антитела PlGF-1 к человеческому PlGF, характеристики связывания PlGF и его вариантов с sFlt-1, иммуноферментный анализ (ELISA) на определение PlGF и другие материалы и описания опытов представлены у Errico et al., J. Biol. Chem., v.279, p.43929-43939, 2004, и частично воспроизведены здесь. Более подробное описание клеточных культур, плазмид, селекции клеточных линий и другие материалы и описания опытов, не предусмотренные здесь, можно найти у Errico et al.

Материалы

Как описано у Errico et al., моноклональные антитела к античеловеческому PlGF и человеческий Flt-1 (Flt-1/Fc химера) закуплены у R&D Systems (Миннеаполис, Миннесота, США). Козлиные антимышиные IgG, конъюгированные с пироксидазой хрена (HRP) закуплены у Santa Cruz Biotechnology (Санта-Крус, Калифорния, США; www.scbt.com).

Построение вариантов PlGF

Errico et al. получил варианты PlGF, применив метод ПЦР, выполненной с использованием в качестве кальки плазмиды pchPlGF-1; ПЦР была выполнена с использованием дополнительных праймеров, картирующих участок, кодирующий мутацию аминокислоты в аланин и несущий специфичную нуклеотидную модификацию. Для получения варианта PlGF с двойной мутацией использовались праймеры, несущие обе мутации. Амплифицированная ДНК была очищена и использовалась для трансформации компетентных бактерий. Секвенирование плазмид в обоих направлениях выполнено дидезоксинуклеотидным методом. Следующие единичные остатки PlGF-1 были мутированы в Ala: Asn-16, Pro-25, Gln-27, Cys-60, Asp-72, Glu-73, Asn-74, Asn-84, Pro-98 и Tyr-100. Также была генерирована двойная мутация Asp 72 в Ala и Glu 73 в Ala PlGF-1.

Калибровочные/регуляторные композиции, содержащие измененный PlGF-1

Калибровочные/регуляторные композиции, содержащие измененный PlGF-1 и sFlt-1, получают путем объединения неизмененного sFlt-1 с измененным PlGF-1, в частности с двойным мутантом, где аланины заменяют аспартат в позиции 72 в последовательности SEQ ID NO:1 и глутамат в позиции 73 в последовательности SEQ ID NO:1, или с тройным мутантом, где присутствует дополнительная мутация глицина, заменяющего цистеин в позиции 70. Они могут быть составлены индивидуально из сухих препаратов или из рабочих водных базовых растворов, приготовленных из любого подходящего буфера с требуемым pH (например, фосфатно-солевой буферный раствор (ФСБ), pH 7,5), содержащего любые другие полезные или необходимые дополнения - например, антиоксиданты, консерванты и т.д. Для наглядности концентрация измененного PlGF-1 лежит в пределах от 0 до 1000 пг/мл, фиксированная концентрация sFlt-1 - 100 пг/мл, но могут использоваться и другие интервалы концентраций для обоих веществ. Неизмененный sFlt-1 соединяют с измененным PlGF двойного мутанта или тройного мутанта в ФСБ (10 г NaCl, 0,25 г KCl, 1,8 г Na2HPO4, 0,3 г KH2PO4, pH 7,5) для получения следующего набора эталонных, калибровочных и регуляторных материалов:

Измененный PlGF1 (пг/мл) SFlt-1 (пг/мл)
0 100
50 100
100 100
500 100
1000 100

Иммуноферментный анализ (ELISA) на PlGF

Количество PlGF в образце сыворотки крови, взятом у беременной женщины, определяется путем иммуноферментного анализа (ELISA) на PlGF. ELISA (подробное описание см. ниже), калиброван при помощи набора растворов, содержащих описанные выше измененный PlGF-1 и sFlt-1. Сигнал, получаемый с каждого уровня набора для PIGF-1, ассоциируют с концентрацией измененного PlGF-1. Эту ассоциацию можно представить в виде графика или установить при помощи соответствующих статистических и математических методов калибрования. Сигнал, полученный в ELISA с использованием образца сыворотки крови, сравнивают с калибровочной кривой, чтобы определить концентрацию PlGF в образце, или преобразуют в единицы концентрации, используя принятую математическую ассоциацию.

ELISA выполняется следующим образом: для выявления PlGF в образце одно моноклональное антитело к античеловеческому PlGF-1 в количестве 1 мкг/мл в ФСБ наносят на 96-луночный планшет в количестве 100 мкл на лунку и инкубируют в течение ночи при температуре 4°C. Лунки промывают однократно раствором ФСБ, содержащим 0,05% ТВИН 20 (ПБТ), и блокируют неспецифичные сайты связывания путем введения 1% альбумина бычьей сыворотки в ФСБ в количестве 280 мкл на лунку и инкубирования в течение 3 часов при комнатной температуре (КТ). Лунки аспирируют и хранят в прохладном месте до использования. В ходе анализа 100 мкл каждого калибровочного уровня или образца сыворотки крови соответствующим образом разводят в растворе PBET (ФСБ, содержащий 0,1% бычьего сывороточного альбумина, 5 ммоль (мМ) ЭДТА и 0,05% Твин 20) и инкубируют в течение 1 часа при температуре 37°C. Лунки промывают пять раз раствором ФСБ; другое моноклональное антитело к античеловеческому PlGF-1 (конъюгированное пироксидазой хрена) разводят в 37 нг/мл раствора PBET, помещают полученный раствор в лунки и инкубируют в течение 1 часа при температуре 37°C. Лунки промывают пять раз раствором ПБТ и добавляют 100 мкл субстрата пероксидазы хрена, состоящего из 1 мг/мл ортофенилендиамина в 50 ммоль цитратно-фосфатного буфера, pH 5 и 0,006% H2O2, и инкубируют в течение 30 минут в темноте при КТ. Для остановки реакции добавляют 25 мкл на лунку 4 N H2SO4 и измеряют сигнальную абсорбцию при помощи микропланшетного ридера, настроенного на длину волны 490 нм.

Сравнение связывания измененного PIGF-1 и неизмененного PlGF с sFlt-1

Errico et al. описал эксперимент по определению связывания измененного PlGF-1 и неизмененного/нативного PlGF-1 с Flt-1. Как правило, на 96-луночный планшет наносят растворенный человеческий Flt-1 (Flt-1/Fc химера) слоем 0,5 мкг/мл в растворе ФСБ, pH 7,5, по 100 мкл на лунку, и инкубируют в течение ночи при КТ. Планшет промывают пять раз раствором ФСБ, затем, после блокирования неспецифичных сайтов лунок при помощи раствора альбумина бычьей сыворотки, как описано выше, стимулируют продолжение реакции связывания, добавляя измененный PlGF-1 или неизмененный/нативный PlGF в лунку и инкубируя в течение 1 часа при температуре 37°C и в течение 1 часа при КТ. Лунки промывают раствором ФСБ, как описано выше, и инкубируют с биотинилированным поликлональным антителом к античеловеческому PlGF-1, 300 нг/мл в растворе PBET, в течение 1 часа при температуре 37°C и в течение 1 часа при КТ. Выявление выполняют, как описано выше в ELISA, а затем сравнивают сигналы измененного PlGF-1 и неизмененного/нативного PlGF-1. Результаты, полученные Errico et al., воспроизведены на фиг.1A и 1B.

ПРИМЕР II. Сопоставление рекомбинантного PlGF (DE) и PlGF (AA)

Цель эксперимента:

Два рекомбинантных белка PlGF оценивали с точки зрения (1) их способности вступать в реакцию связывания с моноклональным антителом, специфичным для человеческого PlGF, и (2) их способности вступать в реакцию связывания с sFlt и образовывать комплекс лиганд:рецептор.

Материалы и реагенты:

(1) Рекомбинантный PlGF:

Использовались два вида очищенного рекомбинантного PlGF.

Белок состоит из 21-аминокислотной лидерной последовательности, не принадлежащей PlGF. Лидерная последовательность содержит конец "6xHis" и 4-аминокислотный Xa сайт узнавания и расщепления.

Лидерная последовательность:последовательность SEQ ID NO:2: MRGS HHHHHH GSGSGSG IEGR

Последовательность участка PlGF в PlGF (DE): Аминокислотная последовательность соответствует аминокислотам 4-132 последовательности SEQ ID NO:1 PlGF дикого типа, в результате получается следующая аминокислотная последовательность DE:

последовательность SEQ ID NO:3:

AVPPQQWALS AGNGSSEVEV VPFQEVWGRS YCRALERLVD VVSEYPSEVE HMFSPSCVSL LRCTGCCG DE NLHCVPVETA NVTMQLLKIR SGDRPSYVEL TFSQHVRCEC RPLREKMKPE RCGDAVPRR

Последовательность участка PlGF в PlGF (AA): Аминокислотная последовательность соответствует аминокислотам 4-132 последовательности SEQ ID NO:1 PlGF дикого типа с двумя мутациями аминокислот в позициях 72 и 73 в последовательности SEQ ID NO:1 с образованием следующей аминокислотной последовательности AA:

последовательность SEQ ID NO:4:

AVPPQQWALS AGNGSSEVEV VPFQEVWGRS YCRALERLVD VVSEYPSEVE HMFSPSCVSL LRCTGCCG AA NLHCVPVETA NVTMQLLKIR SGDRPSYVEL TFSQHVRCEC RPLREKMKPE RCGDAVPRR

(2) Рекомбинантный sFlt:

Полноразмерный sFlt приобретен у компании Scios Inc. (Маунтин-Вью, Калифорния, США; www.sciosinc.com) (партия № 9225-89); состоит из 687 аминокислот растворимой ФМС-подобной тирозинкиназы 1 (sFlt-1).

последовательность sFlt-1:

последовательность SEQ ID NO:5:

MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGEHCNKKAVFSRISKFKSTRNDCTTQSNVKH

(3) Моноклональное антитело к человеческому sFlt-1 и к человеческому PlGF:

Идентификационный номер моноклонального Ат Источник Номер в каталоге Партия Клон
RD-1 мышиный анти-sFlt RD Sys CGG07605B 49560
RD-2 мышиный анти-sFlt RD Sys BYC01605A 49543
Rat-1 анти-PlGF крысы RD Sys Не дост. 1103925 358903
Rat-2 крысиный анти-PlGF RD Sys Не дост. 1103933 358939
Rat-3 анти-PlGF крысы RD Sys Не дост. 1103931 358932
Rat-4 анти-PlGF крысы RD Sys Не дост. 1103926 358905
Rat-5 анти-PlGF крысы RD Sys Не дост. 1103927 358907
MS-1 мышиный анти-PlGF RD Sys MAB264 Не дост. 37203

Примеры экспериментов:

(1) Иммуноферментный анализ-1:

· На титрационный микропланшет с высокой степенью связывания наносят рекомбинантный PlGF(DE) или PlGF(AA) слоем 0,5 мкг/мл и блокируют при помощи бычьего сывороточного альбумина (БСА)/ФСБ.

· Стандартная процедура ELISA состоит из разведения моноклонального антитела в казеине/ФСБ; разведение ослиных антимышиных IgG, конъюгированных с пероксидазой хрена, или ослиного антикрысиного IgG в соотношении 1:3K в казеине/ФСБ; 100 мкл на лунку образца или конъюгированного объема; после каждого шага проводилось инкубирование при температуре 37°C/30 мин/встряхивание; 6-разовое промывание планшета, 100 мкл о-фенилендиамина для развития субстрата при 25°C/30 мин; 25 мкл стоп-реагента; регистрация результатов при 492 нм.

· Результаты иммуноферментного анализа 1 представлены в таблице 1.

Таблица 1
Распознавание моноклонального анти-PlGF к рекомбинантному PlGF (неизмененному и измененному)
Рекомбинантный PlGF в виде покрытия
(0,5 мкг/мл)
Антителосвязывающая активность нанесенного в виде покрытия PlGF (полученные данные)
Идентификационный номер моноклонального анти-PlGF, № клона и концентрация (нг/мл)
Ат (10 нг/мл) Ms-1 Rat1 Rat2 Rat4 Ат (100 нг/мл) Rat3 Rat5
37203 358903 358939 358905 358932 358907
PlGF-1 (DE) 1,823 2,098 2,237 2,114 1,233 1,256
PlGF-1 (AA) 2,650 1,789 2,233 1,935 1,305 1,297

· Вывод: Все тестируемые моноклональные антитела вступали в реакцию как с PlGF(DE), так и с PlGF(AA), показав, что мутация D72/E73A не повлияла на связывание моноклонального антитела и эпитопы этих антител локализованы не на этих двух сайтах мутации.

(2) ELISA-2:

· На титрационный микропланшет с высокой степенью связывания наносят рекомбинантный PlGF(DE) или PlGF(AA) слоем 0,5 мкг/мл и блокируют при помощи бычьего сывороточного альбумина (БСА)/ФСБ.

· Стандартная процедура ELISA включает инкубирование первого планшета с sFlt, растворенным в казеине/ФСБ в различных концентрациях; инкубирование второго планшета со смешанным анти-sFlt раствором, содержащим два моноклональных антитела RD-1 и RD-2 по 0,1 мкг/мл; инкубирование третьего планшета с ослиным антимышиным IgG, конъюгированным с пероксидазой хрена, в соотношении 1:4K, разведенным в казеине/ФСБ; и инкубирование четвертого планшета со 100 мкл о-фенилендиамина для развития субстрата в течение 30 минут при температуре 25°C. Шаги инкубирования первого, второго и третьего планшетов в течение 15-20 мин/встряхивание при температуре 37°C; 6-разовое промывание планшетов после каждого шага. 25 мкл стоп-реагента после четвертой инкубации и регистрация результатов при 492 нм.

· Результаты иммуноферментного анализа-2 представлены в таблице 2.

Таблица 2
Связывание sFlt с рекомбинантным PlGF (неизмененным и измененным)
Нанесенный рекомбинантный PlGF
(0,5 мкг/мл)
Образование комплекса sFlt с нанесенным PlGF
Концентрация sFlt (нг/мл) при инкубации
1800 600 200 66,67
БСА (контроль) 0,004 0,006 0,010 0,020
PlGF-1 (DE) 1,728 1,204 0,524 0,316
PlGF-1 (AA) 0,150 0,080 0,060 0,040
* Связанный комплекс sFlt:PlGF был выявлен при помощи мышиного анти-sFlt и конъюгата антимышиных антител с пероксидазой хрена.

Вывод: sFlt образует комплекс рецептор:лиганд с нанесенным PlGF(DE). Однако образование комплекса было значительно сокращено мутантом PlGF(AA); это означает, что аминокислотные позиции 72 и 73 в последовательности SEQ ID NO:1 играли важную роль для связывания sFlt-1 и образования комплекса.

(3) Анализ с использованием оборудования Biacore:

· sFlt были иммобилизованы на чипе Biacore FC-2 в присутствии пары N-гидроксисукцинимид (NHS)/этиламинопропилкарбодиимид при кр. ед. = 6738. FC-1 - пустой в качестве негативного контроля.

· PlGF(DE) или PlGF(AA) впрыснуты в FC-1 и FC-2 для оценки комплексообразования.

· Результаты анализа с использованием оборудования Biacore приведены в таблице 3.

Таблица 3
Измерения комплекса sFlt:PlGF при помощи оборудования Biacore
Чип CM5: Рекомб. чел. PlGF 20 мкг/мл
PlGF (DE) PlGF (AA)
Bicore (крысиные единицы) FC1: пусто 11 12
FC2: sFlt 156 30
FC2 - FC1 145 18

· Вывод: Введенный PlGF(DE) связывался с иммобилизованным sFlt с образованием комплекса рецептор:лиганд, тогда как введенный PlGF(AA) слабо связывался с иммобилизованным sFlt.

ПРИМЕР III

Сравнение рекомбинантного PlGF дикого типа и двух дополнительных мутантов PlGF

Цель эксперимента:

Три дополнительных рекомбинантных белка PlGF были получены и оценены с точки зрения (1) их способности вступать в реакцию связывания с моноклональными антителами, специфичными к человеческому PlGF, и (2) их способности вступать в реакцию связывания с sFlt с образованием комплекса лиганд:рецептор.

Материалы и реагенты:

(1) Три дополнительных рекомбинантных белка PlGF были получены следующим образом:

- P126(DE): рекомбинантный PlGF дикого типа: последовательность SEQ ID NO:6:

MRGSAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSP

SCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLR

EKMKPERCGDAVGP GQIVGGVYLL

Первые четыре аминокислотных остатка являются неизмененными аминокислотами (MRGS); последние десять аминокислот являются 10G-эпитопами (C-терминальный конец); две аминокислоты, предшествующие 10G-эпитопу, также являются неизмененными аминокислотами (Gly-Pro); аминокислотная последовательность 126 между неизмененными аминокислотами (т.е. начинающаяся после MRGS и предшествующая GP) является последовательностью PlGF, идентичной аминокислотным позициям 4-129 в последовательности SEQ ID NO:1.

- P126(AA): PlGF мутант № 1: последовательность SEQ ID NO:7:

MRGSAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSP

SCVSLLRCTGCCG AA NLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLR

EKMKPERCGDAVGP GQIVGGVYLL

аналогично P126(DE), за исключением подчеркнутых аминокислот (AA), являются двумя мутированными аминокислотами

- P126(GAA): PlGF мутант № 2: последовательность SEQ ID NO:8:

MRGSAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSP

SCVSLLRCTGC G G AA NLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLR

EKMKPERCGDAVGP GQIVGGVYLL

аналогично PlGF мутанту № 1 P126(AA), за исключением дополнительной мутации на аминокислоте два перед AA, мутирован из C в G

Все три рекомбинантных белка были экспрессированы в бактериях, и все три образуют нерастворимые тельца-включения. После разрушения ультразвуком промывание в 4 моль/л мочевины в растворе ФСБ и 2 моль/л мочевины в ФСБ; в итоге тельца-включения были растворены в 8 моль мочевины/15 ммоль восстановленного глутатиона (GSH)/50 ммоль трис-HCL (pH 7,8). Рефолдинг белков PlGF выполнен методом трехступенчатого диализа: (1) 24 часа на диализном буфере: 3 моль мочевины/50 ммоль TRIS (pH 7,5)/2 ммоль ЭДТА/0,2 моль аргинина/2 ммоль глутатиона (GSH), (2) 24 часа на диализном буфере: 2 моль мочевины/50 ммоль TRIS (pH 7,5)/2 ммоль ЭДТА/0,2 моль аргинина/1,2 ммоль глутатиона (GSH)/0,4 ммоль окисленного глутатиона (GSSG) и (3) 24 часа на диализном буфере: 0,8 моль мочевины/20 ммоль TRIS (pH 7,5)/2 ммоль ЭДТА/0,2 моль аргинина/0,48 ммоль глутатиона (GSH)/0,16 ммоль окисленного глутатиона (GSSG). Рефолдированные PlGF далее очищались путем помещения в колонку для аффинной хроматографии диализированного белкового раствора, полученного путем перекрестного связывания моноклонального антитела, специфичного к 10G-концу, и CNBr-активированной сефарозы 4 жидкого композита Fast Flow resin (номер 17-0981-01 в каталоге GE). Затем связанный PlGF был извлечен при помощи 40%-го ацетонитрила. В итоге, после замены буфера на ФСБ получают очищенные белки PlGF.

(2) Моноклональные античеловеческие PlGF, моноклональные античеловеческие sFlt, поставщик - компания R&D Systems (Миннеаполис, Миннесота, США); ослиные антикрысиные IgG, конъюгированные с пероксидазой хрена (номер в каталоге 712-035-150), поставщик - компания Jackson ImmunoResearch Laboratories, Inc. (Уэст-Гров, Пенсильвания, США); планшеты для ELISA, поставщик - компания Corning Life Sciences (номер в каталоге 2592); гели для электрофореза NuPAGE 4-12%, блоттинг-мембрана из ПВДФ и лэддер SeeBlue, компания-поставщик - Invitrogen (Карлсбад, Калифорния, США); блокаторы: казеин/ФСБ и субстрат для вестерн-блоттинга SuperSignal West Dura были приобретены у компании Pierce (Рокфорд, Иллинойс, США). CNBr-активированная сефароза 4 жидкого композита Fast Flow resin (номер в каталоге 17-0981-01) и набор для окрашивания серебром (номер в каталоге 17-1150-01), поставщик - компания GE Healthcare (Пискатавэй, Нью-Джерси, США)

Экспериментальные примеры:

(1) Рекомбинантный PlGF: На фиг.2 отображена чистота трех рекомбинантных белков PlGF при помощи окрашивания серебром и вестерн-блоттинга.

(2) ELISA-1

• На титрационный микропланшет с высокой степенью связывания наносят рекомбинантный P126(DE), или P126(AA), или P126(GAA) слоем 0,5 мкг/мл и блокируют при помощи БСА/ФСБ.

• Стандартная процедура ELISA включает разведение моноклонального антитела в казеине/ФСБ; разведение конъюгированных с пероксидазой хрена ослиных антимышиных IgG или ослиных антикрысиных IgG в соотношении 1:3K в казеине/ФСБ; 100 мкл на лунку образца или конъюгированного объема; после каждого шага проводилось инкубирование при температуре 37°C/30 мин/встряхивание; 6-разовое промывание планшета, 100 мкл о-фенилендиамина для развития субстрата при 25°C/30 мин; 25 мкл стоп-реагента; регистрация результатов при 492 нм.

• Результаты ELISA представлены в таблице 4.

Таблица 4
Распознавание моноклонального анти-PlGF к рекомбинантному PlGF (неизмененному и измененному)
Рекомбинантный PlGF в виде покрытия
(0,5 мкг/мл)
Антителосвязывающая активность нанесенного в виде покрытия PlGF (полученные данные)
Идентификационный номер моноклонального анти-PlGF, № клона и концентрация (нг/мл)
Ат (1 нг/мл) Ms-1 Rat1 Rat2 Rat4 Ат (10 нг/мл) Rat3 Rat5
37203 358903 358939 358905 358932 358907
P126 (DE) 1,023 1,368 1,497 1,634 0,779 0,834
P126 (AA) 0,967 1,301 1,633 1,681 0,681 0,697
P126 (GAA) 1,134 1,226 1,530 1,591 0,806 0,799

• Вывод: Все тестируемые моноклональные антитела вступали в реакцию с P126(DE), P126(AA) и P126(GAA); это означает, что двойная мутация D72A/E73A и тройная мутация C70G/ D72A/E73A не повлияли на связывание моноклонального антитела и эпитопы этих антител локализованы на других сайтах мутации.

(3) ELISA-2:

• На титрационный микропланшет с высокой степенью связывания наносят рекомбинантный P126(DE), P126(AA) и P126(GAA) слоем 0,5 мкг/мл и блокируют при помощи БСА/ФСБ.

• Стандартная процедура ELISA включает инкубирование 1го планшета с sFlt, разведенным в казеине/ФСБ в различных концентрациях, инкубирование 2го планшета со смешанным раствором анти-sFlt, содержащим два моноклональных антитела RD-1 и RD-2 по 0,1 мкг/мл, инкубирование 3го планшета с раствором конъюгированных с пероксидазой хрена ослиных антимышиных IgG в казеине/ФСБ в соотношении 1:4K, и инкубирование 4го планшета с 100 мкл о-фенилендиамина для развития субстрата в течение 30 минут при температуре 25°C. Шаги инкубирования 1го, 2го и 3го планшетов при 37°C/15-20 мин/встряхивание; после каждого шага 6-разовое промывание планшетов. После инкубирования 4го планшета добавление 25 мкл стоп-реагента и регистрация результатов при 492 нм.

• Результаты ELISA представлены в таблице 5.

Таблица 5
Связывание sFlt с рекомбинантным PlGF (неизмененным и измененным)
Нанесенный рекомбинантный PlGF (5 мкг/мл) Образование комплекса sFlt с нанесенным PlGF
Концентрация sFlt (нг/мл) при инкубации
1800 600 200 66,67
БСА (контроль) 0,009 0,008 0,005 0,003
P126 (DE) >3 1,833 0,833 0,347
P126 (AA) 0,210 0,182 0,115 0,143
P126 (GAA) 0,150 0,101 0,095 0,088
* Связанный комплекс sFlt:PlGF был выявлен при помощи мышиного анти-sFlt и конъюгата антимышиных антител с пероксидазой хрена.

• Вывод: sFlt образует комплекс рецептор:лиганд с нанесенным P126(DE). Однако образование такого комплекса было значительно сокращено мутантом P126(AA) и мутантом P126(GAA; это означает, что аминокислотные позиции 70, 72 и 73 в последовательности SEQ ID NO:1 играли важную роль для связывания sFlt-1 и образования комплекса.

(4) ELISA-3:

• На титрационный микропланшет с высокой степенью связывания наносят рекомбинантный sFlt слоем 0,5 мкг/мл и блокируют при помощи БСА/ФСБ.

• Стандартная процедура ELISA включает инкубирование 1го планшета с P126(DE), или P126(AA), или P126(GAA), разведенным в казеине/ФСБ в различных концентрациях, инкубирование 2го планшета с раствором моноклонального анти-PlGF Rat-4 в количестве 0,1 мкг/мл, инкубирование 3го планшета с раствором конъюгированных с пероксидазой хрена ослиных антикрысиных IgG в казеине/ФСБ в соотношении 1:4K, и инкубирование 4го планшета со 100 мкл о-фенилендиамина для развития субстрата в течение 30 минут при температуре 25°C. Шаги инкубирования 1го, 2го и 3го планшетов при 37°C/15-20 мин/встряхивание; после каждого шага 6-разовое промывание планшетов. После инкубирования 4го планшета добавление 25 мкл стоп-реагента и регистрация результатов при 492 нм.

• Результаты ELISA представлены в таблице 6.

Таблица 6
Связывание с рекомбинантным PlGF (неизмененным и измененным)
Нанесенный sFlt
(0,5 мкг/мл)
Образование комплекса sFlt с нанесенным PlGF
Концентрация PlGF (нг/мл) при инкубации
1000 500 250 100 0
P126 (DE) >3 1,388 0,557 0,259 0,021
P126 (AA) 0,299 0,118 0,101 0,077 0,009
P126 (GAA) 0,119 0,117 0,069 0,088 0,051
* Связанный комплекс sFlt:PlGF был выявлен при помощи мышиного анти-PlGF (Rat-4) и конъюгата

• Вывод: неизмененный PlGF, P126(DE), образует комплекс лиганд:рецептор с нанесенным sFlt. Однако измененный PlGF (P126(AA) и P126(GAA) не смогли образовать такой комплекс; это означает, что аминокислотные позиции 70, 72 и 73 в последовательности SEQ ID NO:1 играют решающую роль в связывании sFlt и образовании комплекса.

Описание специфичных вариантов осуществления настоящего изобретения носит иллюстративный характер. Оно не претендует на то, чтобы считаться исчерпывающим или ограничивать объем изобретения приведенными здесь специфичными формами. Среднему специалисту в данной области будет ясно, что существует возможность различных изменений, не выходящих за рамки формулы изобретения и не нарушающих его сущности.

Все патенты, заявки на получение патентов, а также публикации, цитированные здесь, включены в настоящий документ путем ссылки.

1. Эталонная, калибровочная или контрольная композиция для использования в анализе на sFlt-1 и/или PlGF, при этом композиция содержит sFlt-1 и PlGF, где одна или более аминокислот или одна или более неаминокислотных групп sFlt-1 и/или PlGF удалены, модифицированы или заменены другой аминокислотой или неаминокислотной группой или группами, тем самым сокращая или существенно исключая взаимное связывание sFlt-1 и PlGF.

2. Композиция по п.1, в которой PlGF представляет собой PlGF-1.

3. Композиция по п.2, в которой PlGF-1 содержит аланин вместо
a) пролина в позиции 25 в последовательности SEQ ID NO: 1, или
b) глутамина в позиции 27 в последовательности SEQ ID NO: 1, или
c) цистеина в позиции 60 в последовательности SEQ ID NO: 1, или
d) аспартата в позиции 72 в последовательности SEQ ID NO: 1, или
e) глутамата в позиции 73 в последовательности SEQ ID NO: 1, или
f) аспарагина в позиции 84 в последовательности SEQ ID NO: 1, или
g) пролина в позиции 98 в последовательности SEQ ID NO: 1, или
h) тирозина в позиции 100 в последовательности SEQ ID NO: 1, или
измененный PlGF-1, имеющий глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO: 1, и любую комбинацию аланиновых замен согласно пп.(a)-(h) и глициновую замену.

4. Композиция по п.2, в которой PlGF-1 содержит аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO: 1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO: 1.

5. Композиция по п.2, в которой PlGF-1 содержит глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO: 1, аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO: 1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO: 1.

6. Способ калибрования образца для анализа на выявление sFlt-1 и/или PlGF, включающий стадии
1) контакта с композицией по п.1, содержащей известное количество sFlt-1 и PlGF с рецептором, специфичным для sFlt-1, или рецептором, специфичным для PlGF; и
2) контакта комплекса, образованного на стадии 1), с маркированным рецептором, специфичным для sFlt-1, и маркированным рецептором, специфичным для PlGF; и
3) отделения связанного маркированного рецептора, специфичного для sFlt-1, от свободного маркированного рецептора, специфичного для sFlt-1 или связанного маркированного рецептора, специфичного для PlGF, от свободного маркированного рецептора, специфичного для PlGF; и
4) выявления сигнала от связанного маркированного рецептора, специфичного для sFlt-1, образовавшего комплекс с sFlt-1 в композиции, или сигнала от свободного маркированного рецептора, специфичного для sFlt-1; или
5) выявления сигнала от связанного маркированного рецептора, специфичного для PlGF, образовавшего комплекс с PlGF в композиции, или сигнала от свободного маркированного рецептора, специфичного для PlGF; и
6) ассоциирования сигнала от свободного или связанного рецептора, специфичного для sFlt-1, и сигнала от свободного или связанного рецептора, специфичного для PlGF, с известным количеством sFlt-1 или PlGF в композиции.

7. Способ по п.6, где Pl GF представляет собой PlGF-1.

8. Способ по п.7, где PlGF-1 содержит аланин вместо
a) пролина в позиции 25 в последовательности SEQ ID NO: 1, или
b) глутамина в позиции 27 в последовательности SEQ ID NO: 1, или
c) цистеина в позиции 60 в последовательности SEQ ID NO: 1, или
d) аспартата в позиции 72 в последовательности SEQ ID NO: 1, или
e) глутамата в позиции 73 в последовательности SEQ ID NO: 1, или
f) аспарагина в позиции 84 в последовательности SEQ ID NO: 1, или
g) пролина в позиции 98 в последовательности SEQ ID NO: 1, или
h) тирозина в позиции 100 в последовательности SEQ ID NO: 1, или
измененный PlGF-1, имеющий глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO: 1, или любую комбинацию аланиновых замен в соответствии с пп.(а)-(h) и глициновую замену.

9. Способ по п.7, где PlGF-1 содержит аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO: 1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO: 1.

10. Способ по п.7, где PlGF-1 содержит глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO: 1, аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO: 1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO: 1.

11. Способ подтверждения присутствия или определения количества белка в образце, где белок выбран из группы, состоящей из PlGF-1 и sFlt-1, включающий следующие стадии:
a) контакт образца с иммобилизованным рецептором, специфичным для белка, и, как следствие, образование первого комплекса, включающего иммобилизованный рецептор и белок образца;
b) контакт первого комплекса с маркированным рецептором, специфичным для белка, и, как следствие, образование второго комплекса, состоящего из рецептора, белка образца и маркированного рецептора;
c) отделение маркированного рецептора, который связан во втором комплексе, от свободного маркированного рецептора;
d) определение сигнала от маркированного рецептора, который связан во втором комплексе, или сигнала от свободного маркированного рецептора;
e) контакт иммобилизованного рецептора, специфичного для белка, с композицией белка по п.1, при известном количестве белка в композиции, и, как следствие, образование третьего комплекса, содержащего иммобилизованный рецептор и белок композиции;
f) контакт третьего комплекса с маркированным рецептором, специфичным для белка, и, как следствие, образование четвертого комплекса рецептора, белка композиции и маркированного рецептора;
g) отделение маркированного рецептора, который связан в четвертом комплексе, от свободного маркированного рецептора;
h) определение сигнала от маркированного рецептора, который связан в четвертом комплексе, или сигнала от свободного маркированного рецептора; и
i) сравнение сигналов, определенных в соответствии с пп. d) и h), для подтверждения присутствия белка или для измерения количества белка в образце.

12. Способ по п.11, где PlGF-1 композиции содержит аланин вместо
a) пролина в позиции 25 в последовательности SEQ ID NO: 1, или
b) глутамина в позиции 27 в последовательности SEQ ID NO: 1, или
c) цистеина в позиции 60 в последовательности SEQ ID NO: 1, или
d) аспартата в позиции 72 в последовательности SEQ ID NO: 1, или
e) глутамата в позиции 73 в последовательности SEQ ID NO: 1, или
f) аспарагина в позиции 84 в последовательности SEQ ID NO: 1, или
g) пролина в позиции 98 в последовательности SEQ ID NO: 1, или
h) тирозина в позиции 100 в последовательности SEQ ID NO: 1, или
измененный PlGF-1, имеющий глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO: 1, или любую комбинацию аланиновых замен в соответствии с пп.(а)-(h) и глициновую замену.

13. Способ по п.12, где PlGF-1 содержит аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO: 1 и аланин вместо глутамата в позиции 72 в последовательности SEQ ID NO: 1.

14. Способ по п.12, где PlGF-1 содержит глицин вместо цистеина в позиции 70 в последовательности SEQ ID NO: 1, аланин вместо аспартата в позиции 72 в последовательности SEQ ID NO: 1 и аланин вместо глутамата в позиции 73 в последовательности SEQ ID NO: 1.



 

Похожие патенты:
Изобретение относится к медицине, педиатрии, перинатологии, детской неврологии и может быть использован для ранней диагностики нарушения движений у детей с перинатальным поражением нервной системы.

Изобретение относится к медицине, а именно к травматологии и ортопедии, и может быть использовано для прогнозирования риска развития стрессовых переломов костей нижних конечностей.

Изобретение относится к медицине и может быть использовано для электрохимического определения антиоксидантной активности биологических жидкостей, например плазмы или сыворотки крови.
Изобретение относится к медицине, а именно к акушерству и гинекологии, и может быть использовано для прогнозирования восстановления фертильности в послеоперационном периоде у женщин с наружным генитальным эндометриозом.
Изобретение относится к области медицины, а именно к акушерству. Изобретение раскрывает способ оценки риска развития внутриутробной инфекции у новорожденного при наличии у матери антител класса G к Chlamydia trachomatis в крови.

Изобретение относится к области физиологии, нейрофизиологии, биохимии, в частности к характеристике про- и антиоксидантного статуса головного мозга, и может быть использовано для исследования влияния различных факторов на локализацию и степень нейродегенеративных изменений в головном мозге животного.
Изобретение относится к медицине и может быть использовано в нефрологии при заместительной почечной терапии у пациентов с терминальной стадией хронической болезни почек.
Изобретение относится к медицине, а именно к онкологии и хирургии, и может быть использовано при хирургическом лечении дифференцированного рака щитовидной железы в сочетании с аутоиммунным тиреоидитом с узлообразованием.
Изобретение относится к медицине, а именно к неврологии, ортопедии, нейрохирургии, и может быть использовано для диагностики степени тяжести течения дегенеративно-дистрофического заболевания позвоночника.

Изобретение относится к картриджу для биоаналитического реакционного устройства. Картридж содержит по меньшей мере одну камеру для пробы, имеющую стенку, через которую эта проба может быть обработана или проанализирована биоаналитическим реакционным устройством.
Изобретение относится к медицине, в частности к педиатрии, и описывает способ прогнозирования динамики течения муковисцидоза, выявленного путем неонатального скрининга, основанный на учете пола, возраста, уровня гемоглобина, лейкоцитов, АлАТ, АсАТ, С-реактивного белка, вида бактериальной флоры в мазках из носа и в мазках из зева, уровня хлоридов пота, в котором определяют коэффициент прогноза динамики течения муковисцидоза (Кдм) с использованием регрессионного управления: Кдм=3,21946+0,526873*пол - 0,0488185*возраст - 0,0125638*гемоглобин+0,0302588*лейкоциты - 0,0418016*АлАТ+0,00832224*АсАТ+0,0736644*СРБ+; 0,238719* флора из носа+0,442044* флора из зева - 0,00669528*хлориды пота, где: пол - для мальчиков обозначают цифрой 1, для девочек цифрой 0; возраст - количество полных месяцев на момент обследования; гемоглобин - уровень гемоглобина в периферической крови в граммах на литр, лейкоциты - количество лейкоцитов в кубическом миллиметре периферической крови; АлАТ - уровень аланин-аминотрансферазы в венозной крови в единицах на литр; АсАТ - уровень аспартат-аминотрансферазы в венозной крови в единицах на литр; СРБ - уровень с-реактивного белка в миллиграммах на литр; флора из носа и флора из зева - вид бактериальной флоры в мазках из носа или из зева: 1 стрептококк, 2 синегнойная палочка; 3 стафилококк; 4 грибы; 5 рост флоры отсутствует (мазок стерилен); 6 энтерококк; 7 коринобактерии; 8 нейсерия; 9 ацинетобактер; 10 кишечная палочка; 11 цитробактер; 12 клебсиелла; 13 стернотофомонас; 14 гемофилийная палочка; 15 моракселла; 16 прочие виды флоры; хлориды пота - уровень хлоридов пота в ммоль/л; если величина коэффициента менее 2,3, прогнозируют течение заболевания без отрицательной динамики; если коэффициент 2,3 и более, прогнозируют течение муковисцидоза с ухудшением состояния. Способ позволяет сократить затраты времени, не требует участия высококвалифицированных врачей, обладает высокой точностью и специфичностью. 1 табл., 2 пр.
Изобретение относится к медицине, а именно к онкоурологии, и может быть использовано для выбора тактики лечения местно-распространённого рака предстательной железы. Для этого определяют уровень ПСА крови. Осуществляют лучевую терапию и вводят золадекс в дозе 3,6 мг с интервалом в 28 дней до начала, в процессе и после окончания облучения. При значении уровня ПСА крови ниже 1 нг/мл через три месяца после начала лечения золадексом продолжают его вводить в течение последующих 6 месяцев. При этом лучевую терапию проводят расщепленным курсом в режиме классического фракционирования дозы облучения до СОД 64 Гр. В случае выявления уровня ПСА ниже 1 нг/мл только через шесть месяцев после начала введения золадекса его продолжают вводить в течение последующих 9 месяцев. Лучевую терапию при этом проводят расщепленным курсом в режиме классического фракционирования дозы облучения до СОД 70 Гр. При выявлении уровня ПСА через шесть месяцев выше 1 нг/мл вводят золадекс и ежедневно касодекс в дозе 50 мг в течение последующих 12 месяцев. Лучевую терапию при этом проводят расщепленным курсом в режиме гипофракционирования дозы облучения до СОД 70 Гр. Способ обеспечивает повышение эффективности и оптимизацию лечения, существенное жжение количества осложнений со стороны целого ряда систем организма больного, увеличение периода ремиссии за счёт индивидуализации режима лечения. 3 пр.
(57) Способ относится к области медицины и предназначено для ранней диагностики некротизирующего энтероколита у новорожденных. Способ включает определение трансферрина и свободного гемоглобина в кале. При значении гемоглобина более 50 нг/мл и при значении трансферрина более 25 нг/мл делают вывод о наличии некротизирующего энтероколита. Заявленный способ позволяет быстро и точно выявлять некротизирующий энтероколит у новорожденных на ранних стадиях. 2 пр.

Изобретение относится к медицине, в частности к хирургии, травматологии, трансплантологии, кумбостиологии, и представляет собой способ изготовления дермального матрикса (ДМ). Способ включает забор кожи у донора-трупа в операционной дерматомом по стандартной методике с соблюдением правил асептики и антисептики. Сразу после заготовки биологический материал помещают в стерильную емкость, содержащую водный раствор антибиотика широко спектра действия. С сохранением стерильности емкость герметично закрывают. Биоматериал хранят при -40°C до получения результатов патологоанатомического исследования донора, исследования биологической безопасности тканей донора. Биоматериал с подтвержденной биологической безопасностью используют для изготовления ДМ. Изготовление ДМ включает следующие этапы: разделение эпидермиса и дермы, децеллюляризация дермы, обеспечение биосовместимости трансплантата. Способ позволяет сократить производство до 36 ч и обеспечивает получение бесклеточного, биосовместимого дермального матрикса толщиной до 1 мм, с сохранением структур и ориентации волокон. 1 з.п. ф-лы, 2 табл., 1 ил.
Изобретение относится к области медицины, а именно к лабораторной диагностике. Способ диагностики AL-амилоидоза заключается в том, что каплю биологической жидкости с кристаллоиндуктором подвергают клиновидной дегидратации и затем полученную фацию анализируют под микроскопом с использованием количественных критериев. Способ доступен, прост в исполнении, позволяет выявить системный амилоидоз в короткие сроки.

Группа изобретений относится к измерению объема или концентрации биологических веществ. Представлено измерительное устройство с кожухом и по меньшей мере одним дисплеем, интегрированным в кожух, при этом кожух содержит отсек, предназначенный для вставки картриджа в кожух с целью доставки в устройство предназначенного для измерения образца, и при этом отсек имеет отверстие на передней части кожуха, и первая часть кожуха для вставки картриджа выступает под углом ко второй части кожуха. Также описан способ измерения с указанным устройством при анализе биологических жидкостей. Достигается повышение надежности и широты применения при проведении анализа 2 н. и 6 з.п. ф-лы, 5 ил.

Предложенная группа изобретений относится к области медицины. Предложены способ и набор для определения наличия у пациента повышенного риска обладания сердечно-сосудистым заболеванием или нарушением по полиморфным вариантам генов. Предложен способ идентификации пациента, который нуждается в ранней и/или агрессивной или профилактической терапии сердечно-сосудистого заболевания и способ лечения такого пациента. Предложенная группа изобретений обеспечивает эффективные способы и наборы для определения риска обладания сердечно-сосудистым заболеванием, что позволяет идентифицировать пациента, который нуждается в терапии сердечно-сосудистого заболевания. 4 н. и 6 з.п. ф-лы, 4 ил., 18 табл., 1 пр.

Изобретение касается способа образования 3-фенилимино-3H-фенотиазинового медиатора или 3-фенилимино-3H-феноксазинового медиатора, включающего предоставление первого реагента, содержащего фенотиазин или феноксазин; предоставление первого растворителя; предоставление второго реагента и предоставление второго растворителя. Первый реагент, первый растворитель, второй реагент и второй растворитель объединяют для образования раствора реагентов. К раствору реагентов добавляют персульфат натрия для соединения первого и второго реагентов, приводящего к образованию реакционного раствора, содержащего 3-фенилимино-3H-фенотиазиновый медиатор или 3-фенилимино-3H-феноксазиновый медиатор. Дополнительно проводят обработку реакционного раствора для удаления первого растворителя и второго растворителя для выделения медиаторов. Изобретение также касается продуктов, полученных указанным способом, и их применения в электрохимическом тест-сенсоре. Медиаторы по изобретению имеют низкий фоновый ток и обладают необходимыми характеристиками, включая стабильность. 6 н. и 6 з.п. ф-лы, 1 табл., 25 пр., 5 ил.

Заявленное изобретение относится к области диагностики и может быть использовано для раннего обнаружения беременности. Тестер на беременность содержит впитывающий наконечник (1), частично напрессованный на тестовую полоску (3) в корпусе оболочки, имеющем верхнюю оболочку (2.1) и нижнюю оболочку (2.2), и тестовую полоску (3) на стабилизирующей подложке (12), доходящую до окна проверки результата (4) с отметками контрольной и тестовой линий. Тестер дополнительно имеет защитную внешнюю оболочку, состоящую из верхней оболочки (5.1) и нижней оболочки (5.2). В передней части тестера на внутренней поверхности оболочек (5.1) и (5.2) расположены противоположные полуоси (6.1) и (6.2), которые входят в отверстия (7.1) и (7.2) в оболочках (2.1) и (2.2). В задней части тестера на внутренней стороне верхней оболочки (5.1) есть штифт (8), входящий в отверстие (9) на внутренней стороне нижней оболочки (5.2), в передней части которой, на ее внутренней стороне, есть фиксирующий выступ (10). Над выступом (10), на нижней поверхности корпуса оболочки (2), есть паз (11), в котором фиксирующий выступ (10) перемещается. На нижней поверхности нижней оболочки (2.2), которая видима в закрытом положении, есть выемка (13), в которую фиксирующий выступ (10) заходит в открытом положении. Заявленное изобретение обеспечивает повышение гигиеничности при использовании тестера на беременность. 12 ил.

Изобретение относится к медицине и описывает способ прогнозирования эффективности защиты лимфоцитов от переокисления путем определения концентрации гидроксирадикалов, в котором при комплексном внесении в среду инкубации лимфоцитов 1,4-дитиоэритритола и аскорбиновой кислоты в конечной концентрации 2,5 мМ и 0,07 мМ соответственно защиту лимфоцитов от гидроксирадикалов оценивают как эффективную при росте в среде гидроксирадикалов до 7% и менее, а неэффективную при росте в среде гидроксирадикалов до 8% и более. Изобретение обеспечивает повышение точности прогнозирования, при этом способ прост в осуществлении и интерпретации полученных результатов. 1 табл., 1 пр.
Наверх