Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных

Авторы патента:


Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных
Использование кислой лизосомной липазы для лечения дефицита кислой лизосомной липазы у больных

 


Владельцы патента RU 2550961:

СИНАДЖЕВА БИОФАРМА КОРП. (US)

Изобретение относится к медицине и может быть использовано для лечения пациента-человека с дефицитом кислой лизосомной липазы (КЛЛ). Для этого указанному пациенту-человеку вводят рекомбинантную КЛЛ человека в количестве, эффективном для снижения уровня трансаминазы печени в сыворотке или крови до нормального уровня. При этом указанную рекомбинантную КЛЛ человека вводят от одного раза примерно каждые 7 дней до одного раза примерно каждые 30 дней и указанное введение является достаточным для уменьшения поражения печени у указанного пациента-человека. Изобретение обеспечивает лечение дефицита КЛЛ, таких как болезнь Вольмана, болезнь накопления эфиров холестерина (БНЭХ), как на ранних, так и на поздних этапах развития заболевания. 31 з.п. ф-лы, 19 ил., 12 табл., 18 пр.

 

УРОВЕНЬ ТЕХНИКИ

Дефицит кислой лизосомной липазы (КЛЛ) представляет собой редкую лизосомную болезнь накопления (ЛБН), характеризующуюся отсутствием расщепления холестеринового эфира (ХЭ) и триглицеридов (ТГ) в лизосомах вследствие дефицита фермента. Дефицит КЛЛ имеет сходство с другими лизосомными болезнями накопления с аккумуляцией субстрата в ряде типов тканей и клеток. При дефиците КЛЛ аккумуляция субстрата наиболее заметна в клетках ретикулоэндотелиальной системы, включая клетки Купфера в печени, гистиоциты в селезенке и в собственной пластинке слизистой оболочки тонкой кишки. Ретикулоэндотелиальные клетки выражают рецептор глюкозамина маннозы/N-ацетила макрофага (также известный как рецептор маннозы макрофага, РММ или CD206), который стимулирует связывание, включение клеткой вещества и лизосомную интернализацию протеинов с N-ацетилглюкозамином или завершенными N-гликанами маннозы и обеспечивает путь для возможной коррекции дефицита фермента в этих типах ключевых клеток.

Дефицит КЛЛ представляет собой мультисистемное заболевание, которое наиболее часто проявляется при желудочно-кишечных, печеночных и сердечнососудистых осложнениях и ассоциируется со значительной болезненностью и смертностью. Клинические последствия дефицита КЛЛ возникают вследствие обширной аккумуляции липидного материала в лизосомах в ряде тканей и кардинальных нарушений в механизмах регулирования холестерина и липидного гистиоцитоза, включая существенное увеличение синтеза печеночного холестерина. Дефицит КЛЛ представляет, по меньшей мере, два фенотипа: болезнь Вольмана (БВ) и болезнь накопления эфиров холестерина (БНЭХ).

Болезнь Вольмана, названная так в честь врача, первым описавшего ее, является наиболее агрессивным проявлением дефицита КЛЛ. Этот фенотип характеризуется желудочно-кишечными и печеночными проявлениями, включая нарушение роста, малабсорбцию, стеаторею, значительную потерю веса, лимфаденопатию, спленомегалию и гепатомегалию. Болезнь Вольмана быстро прогрессирует и неизменно приводит к смертельному исходу обычно в первый год жизни. Анализ историй болезни показывает, что выживание после 12-месячного возраста наблюдается чрезвычайно редко для больных, поступающих с нарушением роста вследствие тяжелой формы дефицита КЛЛ в первый год жизни. При такой наиболее агрессивной форме нарушение роста является доминирующим клиническим признаком и вносит основной вклад в смертность в раннем возрасте. Поражение печени, проявляющееся в форме ее увеличения и повышения уровня трансаминазы, также является общим проявлением у младенцев.

Диагноз болезни Вольмана ставится на основании как физических показателей, так и результатов лабораторных анализов. Младенцы обычно госпитализируются в первые два месяца жизни вследствие диареи, упорной рвоты, затруднениях при кормлении, отсталого роста, отсутствия развития. Физические показатели включают вздутие живота вследствие гепатомегалии и спленомегалии, и рентгенографическое исследование часто выявляет кальцификацию надпочечных желез. Лабораторные исследования обычно выявляют повышенные уровни сывороточной трансаминазы и отсутствие или значительное снижение активности эндогенного фермента КЛЛ. У некоторых больных наблюдаются повышенные уровни холестерина и триглицеридов в крови.

Больные с дефицитом КЛЛ также могут выявляться при большем возрасте в основном по поражению печени и сердечнососудистой системы, и это состояние часто называется болезнью накопления эфиров холестерина (БНЭХ). При БНЭХ, печень сильно поражена вследствие гепатомегалии, некроза клеток печени, повышения уровня трансаминазы, цирроза и фиброза печени. Вследствие повышенных уровней ХЭ и ТГ поражение сердечнососудистой системы может характеризоваться гиперлипидемией. Аккумуляция жировых отложений на стенках артерий (атеросклероз) была обнаружена у некоторых больных, страдающих БНЭХ. Отложения сужают артериальный просвет и могут привести к закупорке сосудов, повышая риск сердечнососудистых осложнений, включая инфаркт миокарда и внезапные приступы. Однако не у всех больных, страдающих дефицитом КЛЛ, развивается атеросклероз. Например, у пациентов с болезнью Вольмана наблюдаются другие симптомы, связанные с болезнью, включая увеличение печени и селезенки, лимфаденопатию и нарушение всасывания тонкой кишкой, но БВ в общем не характеризуется возникновением атеросклероза (The Metabolic and Molecular Bases of Inherited Disease (Метаболические и молекулярные основы наследственных болезней) (Scriver, С.R., Beaudet, A.L., Sly, W.S., Valle D., и др.) 7-е издание. Том 2, с.2570, McGraw-Hill, 1995). Также не у всех пациентов с БНЭХ наблюдается атеросклероз, см. Di Bisceglie и др., Hepatology (Гепатология 11: 764-772 (1990), Ameis и др., J, Lipid Res. (Исследование липидов) 36: 241-250 (1995). Проявление БНЭХ очень переменчиво, и у некоторых пациентов эта болезнь не диагностируется до наступления осложнений в позднем взрослом возрасте, в то время как у других пациентов наблюдается нарушение функции печени в раннем детском возрасте. БНЭХ ассоциируется с сокращенной продолжительностью жизни и значительным ухудшением состояния здоровья. Ожидаемая продолжительность жизни людей с БНЭХ зависит от серьезности связанных с болезнью осложнений.

В настоящее время способы лечения болезни Вольмана очень ограничены. Младенцам с гипертермией и/или признаками инфекции назначаются антибиотики. Может быть назначена стероидозамещающая терапия при недостаточности надпочечников и специальное парентеральное питание, и пока нет доказательств, что эти меры предотвращают наступление смертельного исхода, неясно, оказывают ли они какое-либо влияние на короткий срок выживания. В серии, состоящей из четырех пациентов с дефицитом КЛЛ, при лечении посредством пересадки костного мозга все четверо умерли вследствие осложнений в течение нескольких месяцев после пересадки. Хотя некоторый успех был описан в последующих историях болезни, коэффициент смертности остается высоким, и многим больным трансплантация не выполняется по причине их очень плохого состояния и низкой вероятности выживания при подготовке к трансплантации. Очень небольшое количество долгожителей, о которых сообщается, указывает на то, что коррекция дефицита фермента в гемопоэтических клетках является достаточным условием существенного улучшения клинического состояния при этой болезни. Обычно клиническая поддержка предоставляется через диетические ограничения при попытке ограничить накопление нетранспортабельных и неразлагающихся липидов, связанных с острыми проявлениями болезни, приводящими к смертельному исходу.

В настоящее время способы лечения фенотипа БНЭХ сосредоточены на симптоматической терапии через контроль аккумуляции липидов посредством диеты, исключающей продукты с высоким содержанием холестерина и триглицеридов, и подавления синтеза холестерина и образования аполипопротеина В через назначение лекарственных препаратов, понижающих уровень холестерина (например, статины и холестирамин). Хотя можно наблюдать некоторое клиническое улучшение, лежащая в основе проявления болезнь остается и развитие болезни продолжается.

Было предположено, что ферментозамещающая терапия с использованием рекомбинантной КЛЛ может быть жизнеспособным способом лечения дефицита кислой лизосомной липазы и соответствующих состояний (см. Meyers и др. (1985) Nutrition Res. (Исследование питания) 5(4):423-442; WO 9811206; и Besley (1984) Clinical Genetics (Клиническая генетика) 26:195-203). Некоторые исследования дефицита КЛЛ с использованием мышей продемонстрировали коррекцию некоторых отклонений от нормы у мышей с дефицитом КЛЛ (КЛЛ-/-) при введении высоких доз (более 1 миллиграмма на 1 килограмм массы тела) рекомбинантной человеческой КЛЛ один раз в каждые 3 дня (см., например, Grabowski US 2007/0264249). При проведении предыдущих исследований для коррекции отклонений у мышей с дефицитом КЛЛ предполагалось, что относительно большие количества и частое введение протеина рекомбинантной КЛЛ требуются для коррекции основных фенотипов. Также важно отметить, что в отличие от модели, использующей крыс с КЛЛ-/- и первоначально описанной Yoshida и Kuriyama (1990) Laboratory Animal Science (Исследование лабораторных животных), том 40, с.486-489, модель, использующая мышей с КЛЛ -/-, используемая в исследованиях выше, не имеет близкого сходства с БВ у людей в том смысле, что дефицит КЛЛ у мышей не приводит к нарушениям роста, наблюдающимся у людей.

На сегодняшний день экзогенная КЛЛ не назначалась людям и эффективная терапия, доступная для лечения дефицита КЛЛ, включая БВ, БНЭХ и другие болезни, отсутствует. Поэтому существует острая необходимость в способах лечения с минимизированной частотой введения лекарственных средств для повышения качества жизни пациентов. Дополнительно, желательно определение терапевтически эффективных доз для восстановления роста, нормализации функции печени, повышения концентрации КЛЛ в тканях и повышения активности КЛЛ у больных людей.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение основано на первых клинических случаях, когда пациентам-людям были успешно введены дозы экзогенной КЛЛ. Младенец, страдающий смертельной формой дефицита КЛЛ (болезнь Вольмана или ранняя стадия дефицита КЛЛ), был эффективно вылечен посредством введения экзогенной КЛЛ, и оценка безопасности замещающей терапии с использованием фермента КЛЛ была выполнена на группе пациентов-людей, страдающих поздней формой дефицита КЛЛ. Младенцу с ранним началом дефицита КЛЛ вводились еженедельно низкие дозы без проявления каких-либо неблагоприятных явлений или реакций. Резкие улучшения основных показателей состояния организма и клинических/лабораторных проверок эффективности наблюдались через одну-две недели после начального введения. Через 4 месяца еженедельного введения доз наблюдалось восстановление нормального роста младенца и значительное улучшение всех показателей, относящихся к дефициту КЛЛ, включая малабсорбцию, гепатомегалию и функцию печени. Взрослым больным с поздней формой болезни также вводились еженедельно дозы с небольшим количеством экзогенной КЛЛ без признаков неблагоприятных проявлений. Таким образом, клинические данные, собранные на сегодняшний день, показывают, что ферментозамещающая терапия с использованием экзогенной КЛЛ настоящего изобретения обеспечивает безопасное и эффективное лечение дефицита КЛЛ.

Соответственно, настоящее изобретение предоставляет способы лечения болезней или состояний, связанных с дефицитом КЛЛ у пациентов-людей, посредством введения эффективного количества экзогенной кислой лизосомной липазы (КЛЛ). Экзогенная КЛЛ может представлять собой рекомбинантную КЛЛ человека, имеющую структуру N-линейного гликана, содержащую, по меньшей мере, одну маннозу и/или маннозу-6-фосфат. Экзогенная КЛЛ эффективно интернализируется в лизосому, например, лимфоцитов, макрофагов и/или фибробластов.

В некоторых вариантах воплощения у пациента, страдающего дефицитом КЛЛ, диагностируется болезнь Вольмана (БВ). В одном варианте воплощения введение является достаточным для улучшения роста пациента с БВ. В одном варианте воплощения введение является достаточным для восстановления нормального роста пациента с БВ. В других вариантах воплощения у человека, страдающего дефицитом КЛЛ, диагностируется болезнь накопления эфиров холестерина (БНЭХ). Способы лечения в соответствии с настоящим изобретением могут применяться к пациентам-людям любого возраста.

В этой заявке также предоставляются способы лечения больного, страдающего дефицитом КЛЛ, введением ему рекомбинантной КЛЛ человека в эффективном количестве для улучшения функции печени. В некоторых вариантах воплощения введение является достаточным для нормализации результатов проверки печени. В одном варианте воплощения введение является достаточным для снижения уровней трансаминаз печени. Например, трансаминазы печени могут содержать сывороточную аспартатаминотрансферазу (ACT) и/или сывороточную аланинаминотрансферазу (АЛТ). В одном варианте воплощения введение является достаточным для минимизации гепатомегалии. В одном варианте воплощения введение является достаточным для уменьшения размера печени больного. В одном варианте воплощения введение является достаточным для снижения уровней ферритина сыворотки крови.

В одном варианте воплощения введение является достаточным для снижения уровней ферритина сыворотки крови, включая, например, уровни холестеринового эфира (ХЭ) и/или триглицеридов (ТГ).

Также предоставляется способ повышения активности КЛЛ у больного с дефицитом КЛЛ. Такой способ включает введение рекомбинантной КЛЛ человека больному для повышения активности КЛЛ, которая может быть определена, например, в лимфоцитах и/или фибробластах.

В одном варианте воплощения описывается способ лечения состояния, связанного с дефицитом КЛЛ, у больного посредством введения эффективного количества протеина экзогенной КЛЛ больному от одного раза каждые 5 дней до одного раза каждые 30 дней.

В некоторых вариантах воплощения больному, страдающему дефицитом КЛЛ, вводится доза от примерно 0,1 мг до примерно 50 мг экзогенной КЛЛ на килограмм массы тела. В одном варианте воплощения больному вводится доза от примерно 0,1 мг до примерно 10 мг экзогенной КЛЛ на килограмм массы тела. В одном варианте воплощения больному вводится доза от примерно 0,1 мг до примерно 5 мг экзогенной КЛЛ на килограмм массы тела.

В одном варианте воплощения доза введения составляет от примерно 0,1 мг/кг/ч до примерно 4 мг/кг/ч.

В некоторых вариантах воплощения больной лечится с использованием второго лекарственного средства. Второе лекарственное средство может включать, например, средство для снижения уровня холестерина (например, статин или эзетимиб), антигистамин (например, дифенгидрамин) или иммунодепрессант.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На Фигуре 1А показаны уровни сывороточной аспартатаминотрансферазы (ACT) у младенца-мальчика с болезнью Вольмана (т.е. с ранней формой дефицита КЛЛ), который получал еженедельно дозу экзогенной КЛЛ (SBC-102) (доза: 0,2 мг/кг (первоначальное введение; неделя 0); 0,3 мг/кг (неделя 1); 0,5 мг/кг (неделя 2); и 1,0 мг/кг (недели 3-8)). На Фигуре 1Б показаны уровни сывороточной аланинаминотрансферазы (АЛТ) у этого же больного. Возраст больного при первоначальном введении составлял 4 месяца и 1 неделю.

На Фигуре 2 показаны уровни ферритина сыворотки крови пациента с болезнью Вольмана, который получал еженедельно дозу экзогенной КЛЛ (SBC-102) (доза: 0,2 мг/кг (первоначальное введение; неделя 0); 0,3 мг/кг (неделя 1); 0,5 мг/кг (неделя 2); и 1,0 мг/кг (недели 3-8)). Возраст больного при первоначальном введении составлял 4 месяца и 1 неделю. Уровни ферритина сыворотки крови показаны с недели 1 после первоначального введения дозы в неделю 0.

На Фигуре 3 показана скорость роста пациента с болезнью Вольмана, который получал еженедельно дозу экзогенной КЛЛ (SBC-102) (доза: 0,2 мг/кг (первоначальное введение; неделя 0); 0,3 мг/кг (неделя 1); 0,5 мг/кг (неделя 2); и 1,0 мг/кг (недели 3-8)).

На Фигуре 4 показан график роста пациента с болезнью Вольмана (кг, проценты возрастной массы для мальчиков).

На Фигуре 5 показаны уровни сывороточной аспартатаминотрансферазы (ACT) у 41-летнего белого мужчины с БНЭХ, который получал еженедельные дозы 0,35 мг/кг экзогенной КЛЛ.

На Фигуре 6 показаны уровни сывороточной (АЛТ) у 41-летнего белого мужчины с БНЭХ, который получал еженедельные дозы 0,35 мг/кг экзогенного КЛЛ.

На Фигуре 7 показаны уровни сывороточного альбумина у 41-летнего белого мужчины с БНЭХ, который получал еженедельные дозы 0,35 мг/кг экзогенной КЛЛ.

На Фигуре 8 показаны уровни ферритина сыворотки крови у 41-летнего белого мужчины с БНЭХ, который получал еженедельные дозы 0,35 мг/кг экзогенной КЛЛ.

На Фигуре 9 показана скорость увеличения веса у четырех крыс-самцов одинакового возраста, каждой из которых вводилась экзогенная КЛЛ в соответствии с одним из следующих режимов введения: 1 мг на килограмм один раз в неделю, 5 мг на килограмм один раз в неделю, 5 мг на килограмм один раз в 2 недели или плацебо. Числа в колонках показываю возраст в днях.

На Фигуре 10 показаны результаты патологического и гистопатологического исследования крысы с дефицитом КЛЛ после лечения экзогенной КЛЛ и крысы с дефицитом КЛЛ после лечения плацебо. Макропатологическое исследование показало нормализацию цвета и размера печени у крыс после лечения экзогенной КЛЛ. Гистопатологическое исследование ткани печени крыс после лечения экзогенной КЛЛ показало существенно нормальную гистологию печени, резко отличающуюся от значительной аккумуляции пенистых макрофагов у животных, которым вводилось плацебо.

На Фигуре 11 показаны колокализация рекомбинантной КЛЛ человека (SBC-102) и лизосомный маркер в лизосомах ячеек, исследованных способом флуоресцентной микроскопии с использованием режима последовательного сканирования

На Фигуре 12 показана специфичность связи рекомбинантной КЛЛ человека (SBC-102) с рецептором N-ацетилглюкозамина/маннозы, оцениваемая посредством конкурентно-связывающего анализа с использованием клеточной линии макрофага, NR8383.

На Фигуре 13 показана активность рекомбинантной КЛЛ человека в нормальных клетках и клетках с дефицитом КЛЛ, in vitro.

На Фигуре 14 показано влияние лечения введением рекомбинантной КЛЛ человека на массу внутренних органов крыс с дефицитом КЛЛ. Размер органов представлен в процентах от массы тела, определенной в возрасте 8 недель, у крыс КЛЛ-/- и КЛЛ+/+ после еженедельного введения среды или SBC-102 в количестве 5 мг/кг в течение 4 недель.

На Фигуре 15 показана масса тела у дикого типа и крыс с дефицитом КЛЛ после введения среды или SBC-102 в количестве 5 мг/кг-1 в течение 4 недель. Введение доз показано на оси Х ромбиками, начиная с 4 недели.

На Фигуре 16 показаны уровни холестерина, холестеринового эфира и триглицерида в печени, определенные в возрасте 8 недель у крыс с БВ и дефицитом КЛЛ после еженедельного введения среды или SBC-102 в количестве 5 мг/кг-1 в течение 4 недель.

На Фигуре 17 показано увеличение массы тела в процентах у крыс с дефицитом КЛЛ.

На Фигуре 18 показана масса печени в процентах от массы тела у крыс с дефицитом КЛЛ после введения SBC-102 в течение 4 недель.

На Фигуре 19 показаны уровни холестеринового эфира в тканях крыс с дефицитом КЛЛ после введения SBC-102 в течение 4 недель.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Настоящее изобретение предоставляет способы лечения человека, страдающего болезнью или состоянием, чувствительными к введению экзогенной кислой лизосомной липазы.

Определения

Для удобства определенные термины, используемые в описании, примерах и прилагаемой формуле изобретения, формулируются в этой заявке для иллюстрирования и определения значений и границ применения различных терминов, используемых для описания настоящего изобретения.

«КЛЛ» в соответствии с использованием в данной заявке относится к «кислой лизосомной липазе», и два термина используются взаимозаменяемо в описании. КЛЛ может представлять собой протеин человека, т.е. кислую лизосомную липазу человека. Термин «SBC-102» в соответствии с использованием в данной заявке относится к рекомбинантной кислой лизосомной липазе человека. Термин КЛЛ также относится к таким веществам, представленным в литературе, как гидролаза кислого холестерилового эфира, эстераза холестерила, Липаза А, ЛИП А, и эстераза стерола.

КЛЛ катализирует гидролиз холестериновых эфиров и триглицеридов до свободного холестерина, глицерина и свободных жирных кислот. Таким образом, «активность КЛЛ» может быть измерена, например, как расщепление флуорогенного субстрата, 4-метилумбеллиферилового олеата (4МУО). Расщепление 4МУО может быть обнаружено, например, посредством возбуждения при длине волны 360 нм и эмиссии при 460 нм свободного флюорофора, 4-метилумбеллиферила (4МУ). Результаты могут быть представлены в относительных единицах флуоресценции (ОЕФ). Например, количество субстрата, расщепленного при 30-минутном исследовании по конечной точке, может быть определено количественно относительно эталонной кривой 4МУ, и одна единица (Е) активности может быть определена как количество фермента, необходимого для расщепления 1 микромоля 4МУО в минуту при 37°С. Соответственно, функциональные фрагменты вариантов КЛЛ включают фрагменты, содержащие активность КЛЛ, например, способность гидролизовать эфиры холестерина и/или триглицериды.

В соответствии с использованием в данной заявке «экзогенная КЛЛ» относится к КЛЛ, которая не вырабатывается больным естественным образом. Например, экзогенная КЛЛ включает протеин рекомбинантной КЛЛ, который вводится больному, протеин КЛЛ, который выделяется у человека или животного и вводится больному, и протеин КЛЛ, который вырабатывается (т.е. выражается) у больного в результате введения КЛЛ-кодирующей РНК и/или ДНК или другого лечения, повышающего экспрессию протеина экзогенной КЛЛ.

«Внутривенная инъекция» часто рассматривается как внутривенное струйное введение или быстрое введение дозы вещества и относится к способу введения, когда шприц подсоединяется к устройству доступа к вене, и препарат вводится непосредственно, обычно быстро, но иногда до 15 минут, если введение может привести к раздражению вены или эффекту слишком быстрого введения. После введения препарата в это устройство необходимы некоторые средства для обеспечения его введения в организм пациента. Обычно это достигается обеспечением условия свободного протекания жидкой среды, переносящей препарат в кровяное русло. Однако в некоторых случаях после первого введения используется вторая инъекция жидкой среды, часто называемая «промыванием», для облегчения попадания препарата в кровяное русло.

«Внутривенное вливание» относится к способу введения, при котором препарат вводится в течение продолжительного периода времени. Например, препарат может вводиться больному в течение от 1 до 8 часов. Препарат также может вводиться больному в течение примерно 1, примерно 2, примерно 3, примерно 4, примерно 5, примерно 6, примерно 7 или примерно 8 часов. Для осуществления внутривенного вливания может использоваться капельница для введения препарата самотеком или насос для внутривенного вливания. Внутривенное вливание обычно используется в тех случая, когда больному требуется введение препарата только в определенные периоды времени и не требуется введение дополнительных веществ (например, водных растворов, которые могут содержать натрий, хлорид, глюкозу или их какую-либо комбинацию), которые восстанавливают уровень электролиты, содержание сахара в крови, компенсируют потери воды.

Термин «птичий» в соответствии с использованием в данной заявке относится к каким-либо видам, подвидам или расам организма птиц таксономического класса, таких как, но ограничиваясь ими, курицы, индюки, утки, гуси, перепелки, фазаны, попугаи, вьюрки, ястребы, вороны и бескилевые птицы, включая страусов, эму и казуаров. Термин включает различные известные расы Gallus gallus, или куриц (например, белый леггорн, бурый леггорн, полосатый рок, Суссекс, нью-гемпшир, род-айленд, австралорп, минорка, амрокс, калифорнийская серая), так же как и расы индюков, фазанов, перепелок, уток, страусов и другой домашней птицы, обычно разводимой в товарных количествах. Термин также включает индивидуальный организм птицы на всех этапах развития, в том числе зародышевое и плодное состояние.

Термин «полученный из домашней птицы» или «полученный из птицы» относится к композиции или веществу, произведенному или полученному из домашней птицы. Термин «домашняя птица» относится к птицам, которые можно содержать в качестве домашних животных, включая, но ограничиваясь ими, куриц, уток, индюков, перепелок и бескилевых птиц. Например, термин «полученный из домашней птицы» может относиться к веществу, полученному из курицы, полученному из индюка и/или полученному из перепелки.

Термин «пациент» в соответствии с использованием в данной заявке относится к любому человеку, который получает, или получил, или будет получать медицинскую помощь или лечение, например, в соответствии с предписанием провайдера медицинской помощи.

Термин «терапевтически эффективная доза» в соответствии с использованием в данной заявке относится к дозе (например, количеству и/или интервалу) лекарственного средства, которая должна обеспечить намеченную терапевтическую реакцию. Терапевтически эффективная доза относится к дозе, результатом введения которой при сравнении с соответствующим субъектом, который не получил такую дозу, является улучшение процесса лечения, излечение, предотвращение или снижение интенсивности болезни, расстройства или побочного эффекта, или снижение частоты проявления, или предупреждение болезни или расстройства. Термин также включает в своих границах применения дозы, являющиеся эффективными для улучшения физиологических функций.

Термины «лечить», «врачевание» и «лечение» относятся к способам облегчения, смягчения или улучшения течения болезни или ее проявления, предотвращения дополнительного симптома, смягчение или предотвращение лежащей в основе причины проявления, подавления болезни или состояния, купирования развития болезни или состояния, облегчения болезни или состояния, стимулирование обратного развития болезни или состояния, облегчение состояния, вызванного болезнью или состоянием или прекращения симптома болезни или состояния профилактически и/или после проявления симптома.

В соответствии с использованием в данной заявке с указанием конкретной дозы «кг-1», «на кг», «/кг» и «на килограмм» означает «на килограмм массы тела» млекопитающего, и эти термины могут использоваться взаимозаменяемо.

В соответствии с использованием в данной заявке термин «полипептид» предназначен для охвата «полипептида» в единственном числе, а также «полипептидов» во множественном числе и относится к молекуле, состоящей из мономеров (аминокислот), линейно связанных амидными связями (также известными как пептидные связи). Термин «полипептид» относится к любой цепи или цепям из двух или более аминокислот и не относится к конкретной длине продукта. Таким образом, пептиды, дипептиды, трипептиды, олигопептиды, «протеины», «цепи аминокислот» или какие-либо другие термины, используемые для цепи или цепей из двух или более аминокислот, включены в рамки понятия «полипептид» и термин «полипептид» может использоваться вместо любого из этих терминов или взаимозаменяемо. Термин «полипептид» также предназначен для продуктов модификации полипетида после экспрессии, включая без ограничения гликозилирование, ацетилирование, фосфорилирование, амидирование, дериватизацию известными защищающими/блокирующими группами, протеолитическим расщеплением или модификацией аминокислот неестественного происхождения. Полипептид может быть получен из естественного биологического источника или произведен с использованием рекомбинантной технологии, но не обязательно путем трансляции с назначенной последовательности нуклеиновой кислоты. Он может генерироваться любым способом, включая химический синтез.

В соответствии с использованием в данной заявке относительная гомология между двумя аминокислотными последовательностями или двумя нуклеотидными последовательностями эквивалентна относительной идентичности двух последовательностей. Относительная идентичность двух последовательностей является функцией количества идентичных позиций, общих для последовательностей (т.е. % гомология = количество идентичных позиций / общее количество позиций × 100), учитывая количество разрывов и длину каждого разрыва, которые необходимо ввести для оптимального совмещения двух последовательностей. Сравнение последовательностей и определение относительной идентичности двух последовательностей может быть осуществлено с использованием математического алгоритма, как описано в примерах ниже, не имеющих ограничительного характера.

Относительная идентичность двух аминокислотных последовательностей может быть определена с использованием алгоритма Мейера и Миллера (Е. Meyers и W. Miller (Comput. Appl. Biosci, 4:11-17 (1988)), который был введен в программу ALIGN (версия 2.0), используя весовую таблицу остатка РАМ 120, коэффициент длины разрыва 12 и коэффициент разрыва 4. В дополнение, относительная идентичность двух аминокислотных последовательностей может быть определена, используя алгоритм Нидльмана и Ванша (Needleman и Wunsch (J. Mol, Biol. 48:444-453 (1970)), который был введен в программу GAP пакета программного обеспечения GCG (http://www.gcg.com), используя или матрицу Блоссома 62 или матрицу РАМ250 и весовой коэффициент разрыва 16, 14, 12, 10, 8, 6, или 4 весовой коэффициент длины 1, 2, 3, 4, 5 или 6.

«Изолированный» полипептид или фрагмент, вариант или производный продукт является назначенным полипептидом, который не находится в естественной среде. Конкретный уровень очистки не требуется. Например, изолированный полипептид может быть извлечен из собственной или естественной среды. Произведенные рекомбинантно полипептиды и протеины, выраженные в клетках-хозяевах, рассматриваются как изолированные, как раскрывается в данной заявке, как собственные или рекомбинантные полипептиды, которые были сепарированы, фракционированы или частично или в основном очищены любым пригодным способом.

Другие полипептиды, раскрываемые в данной заявке, представляют собой фрагменты, производные, аналоги или варианты вышеупомянутых полипептидов и их любых комбинаций. Термины «фрагмент», «вариант», «производная» и «аналог» при обращении к любому из полипептидов, раскрываемых в данной заявке, включают любые полипептиды, которые сохраняют, по меньшей мере, некоторую активность соответствующего собственного полипептида (например, фрагменты, варианты, производные и аналоги полипептидов КЛЛ, которые сохраняют способность гидролизовать эфиры холестерина и/или триглицериды). Фрагменты полипептидов включают, например, протеолитические фрагменты, а также фрагменты делеций. Варианты полипептида включают фрагменты, как описано выше, а также полипептиды с измененными аминокислотными последовательностями вследствие аминокислотных замещений, удалений или вставок. Варианты могут иметь естественное или неестественное происхождение. Варианты неестественного происхождения могут быть произведены, используя известные способы мутагенеза. Вариантные полипептиды могут включать консервативные или неконсервативные аминокислотные замещения, удаления или вставки. Производные представляют собой полипептиды, которые были изменены до появления дополнительных свойств, отсутствующих и собственных полипептидов. Примеры включают гибридные белки. Вариантные полипептиды могут также именоваться как «полипептидные аналоги». В соответствии с использованием в данной заявке, «производная» исходного полипептида может содержать один или более остатков, полученных химическим способом посредством реакции функциональной боковой группы. К «производным» также относятся пептиды, содержащие одну или более аминокислотных производных естественного происхождения двадцати стандартных аминокислот. Например, 4-гидроксипролин может быть замещен пролином; 5-гидроксилизин может быть замещен лизином; 3-метилгистидин может быть замещен гистидином; гомосерин может быть замещен серином; и/или орнитин может быть замещен лизином.

Термин «полинуклеотид» предназначен для охвата нуклеиновой кислоты в единственном числе, а также нуклеиновых частот во множественном числе и относится к изолированной молекуле или конструкции нуклеиновой кислоты, например информационной РНК (иРНК) или плазмидной ДНК (пДНК). Полинуклеотид может включать традиционную фосфодиэфирную связь или нетрадиционную связь (например, амидную связь, такую как обнаруженную в пептидной нуклеиновой кислоте (ПНК). Термин «нуклеиновая кислота» относится к какому-либо одному или более сегментам нуклеиновой кислоты, например фрагментам ДНК или РНК, присутствующим в полинуклеотиде. «Изолированная» нуклеиновая кислота или «изолированный» нуклеотид представляет собой молекулу нуклеиновой кислоты, ДНК или РНК, которая была извлечена из собственной среды. Например, рекомбинантный полинуклеотид, кодирующий КЛЛ, содержащуюся в векторе, рассматривается как изолированный для целей настоящего изобретения. Дополнительные примеры изолированного полинуклеотида включают рекомбинантные полинуклеотиды, содержащиеся в гетерологичных клетках-хозяевах, или очищенные (частично или в основном) полинуклеотиды в растворе. Изолированные молекулы РНК включают in vivo или in vitro транскрипты РНК полинуклеотидов в соответствии с настоящим изобретением. Изолированные полинуклеотиды или нуклеиновые кислоты в соответствии с настоящим изобретением дополнительно включают такие молекулы, полученные искусственно. В дополнение, полинуклеотид или нуклеиновая кислота может быть регуляторным элементом или включать такой элемент, например промотор, участок связывания рибосом или терминатор транскрипции.

В соответствии с использованием в данной заявке «кодирующая область» представляет собой часть нуклеиновой кислоты, состоящую из кодонов, транслируемых в аминокислоты. Хотя «стоп-кодон» (ТАГ, ТГА или ТАА) не транслируется в аминокислоту, он может рассматриваться как часть кодирующей области, но какие-либо фланкирующие последовательности, например промоторы, участки связывания рибосом, терминаторы транскрипции, интроны и подобные им, не являются частью кодирующей области. Две или более кодирующие области в соответствии с настоящим изобретением могут быть представлены в одной полинуклеотидной конструкции, например на одиночном векторе, или в отдельных полинуклеотидных конструкциях, например на отдельных (разных) векторах. Кроме того, любой вектор может содержать одну кодирующую область или может включать две или более кодирующие области. В дополнение, вектор, полинуклеотид или нуклеиновая кислота в соответствии с настоящим изобретением может кодировать гетерологичные кодирующие области, слившиеся или неслившиеся с нуклеиновой кислотой, кодирующей полипептид КЛЛ или фрагмент, вариант или производную от них. Гетерологичные кодирующие области включают без ограничения специальные элементы или мотивы, такие как секреторный сигнальный пептид или гетерологичный функциональный домен.

Различные области управления транскрипцией известны специалистам в этой области. Эти области включают, без ограничения, области управления транскрипцией, функционирующие в клетках позвоночных, такие как, но не ограничивающиеся ими, сегменты промотора и усилителя с цитомегаловируса (непосредственный ранний промотор, совместно с итроном-А), вакуолизирующего обезьяньего вируса 40 (ранний промотор) и ретровирусов (таких, как вирус саркомы Рауса). Другие области управления транскрипцией включают области, полученные с генов позвоночных, такие как актин, белок теплового шока, гормон роста крупного рогатого скота, В-глобин кролика, а также другие последовательности, способные управлять экспрессией гена эукариотических клеток. Дополнительные подходящие области управления транскрипцией включают тканеспецифичные промоторы и усилители, а также лимфокин-индуцируемые промоторы (например, промоторы, индуцируемые интерферонами или интерлейкинами).

Подобно этому различные элементы управления транскрипцией известны специалистам в этой области. Эти элементы включают, но не ограничиваются ими, участки связывания рибосом, кодоны инициирования и прекращения трансляции и элементы, полученные с пикорнавирусов (в частности, с внутреннего участка связывания рибосом (ВУСР), также называемого последовательностью CITE).

В других вариантах воплощения изобретения полинуклеотид в соответствии с настоящим изобретением представляет собой РНК, например, в виде информационной РНК (иРНК).

Кодирующие области полинуклеотида и нуклеиновой кислоты в соответствии с настоящим изобретением могут быть связаны с дополнительными кодирующими областями, которые кодируют секреторные или сигнальные пептиды, направляющие секрецию полипептида, кодированного полинуклеотидом в соответствии с настоящим изобретением. В соответствии с гипотезой сигнальной последовательности, протеины, секретируемые клетками млекопитающих, имеют сигнальный пептид или секреторную лидерную последовательность, которая отщепляется от зрелого протеина после инициирования экспорта растущей белковой цепи через гранулярный эндоплазматический ретикулум. Специалисты в этой области знают, что полипептиды, секретируемые клетками позвоночных, обычно имеют сигнальный пептид, слитый с N-концом полипептида, который отщепляется от полного или первичного полипептида для производства секреторного или зрелого вида полипептида. В определенных вариантах воплощения собственный сигнальный пептид, например, используется сигнальный пептид MKMRFLGLVVCLVLWTLHSEG (SEQ ID NO:2) КЛЛ человека или функциональная производная этой последовательности, которая сохраняет способность направлять секрецию операбельно ассоциируемого полипептида. Альтернативно, может использоваться гетерологичный сигнальный пептид (например, гетерологичный сигнальный пептид млекопитающих или птиц) или его функциональная производная. Например, лидерная последовательность дикого типа может быть замещена активатором плазминогена ткани человека (ПТЧ) или β-глюкуронидазой мыши.

Термин «вектор» означает полинуклеотид, состоящий из одноцепочечной, двуцепочечной, кольцевой или сверхспиральной ДНК или РНК. Типичный вектор может состоять из следующих элементов, функционально связанных и находящихся на определенных расстояниях для обеспечения функциональных экспрессии гена: точка начальной репликации, промотор, усилитель, лидерная последовательность 5' иРНК, участок связывания рибосом, кассета нуклеиновой кислоты, сайты терминации и полиаденилирования и выбираемые маркерные последовательности. Один или более из этих элементов могут быть опущены в конкретных применениях. Кассета нуклеиновой кислоты может включать сайт рестрикции для вставки последовательности нуклеиновой кислоты, которая должна быть выражена. В функциональном векторе кассета нуклеиновой кислоты содержит последовательность нуклеиновой кислоты, которая должна быть выражена, включая сайты инициирования трансляции и терминации. В конструкцию может быть дополнительно включен интрон, например, 5" в кодирующую последовательность. Вектор строится таким образом, что конкретная кодирующая последовательность расположена в векторе с соответствующими регуляторными последовательностями, при таких позиционировании и ориентации кодирующей последовательности относительно управляющих последовательностей, что кодирующая последовательность считывается под «управлением» управляющей или регуляторной последовательности. Желательно, чтобы модификация последовательностей, кодирующих конкретный белок, достигла этого конца. Например, в некоторых случаях может потребоваться модифицировать последовательность таким образом, чтобы она могла быть присоединена к управляющим последовательностям с соответствующей ориентацией, или сохранять рамку считывания. Управляющие последовательности и другие регуляторные последовательности могут быть присоединены к кодирующей последовательности перед вставкой в вектор. Альтернативно, кодирующая последовательность может быть клонирована непосредственно в вектор экспрессии, который уже содержит управляющие последовательности и соответствующий сайт рестрикции в рамке считывания с и под регуляторным управлением управляющих последовательностей.

Термин «экспрессия» в соответствии с использованием в данной заявке относится к процессу, посредством которого ген производит биохимический продукт, например, полипептид. Процесс включает все проявления функционального присутствия гена в клетке, включая, без ограничения, нокдаун гена, также как и переходную и устойчивую экспрессию. Процесс включает, без ограничения, транскрипцию гена в информационную РНК (иРНК) и трансляцию такой иРНК в полипептид (ы). Экспрессия гена производит «генный продукт». В соответствии с использованием в данной заявке генный продукт может представлять собой нуклеиновую кислоту, например, информационную РНК, произведенную посредством транскрипции гена, или полипептид, транслируемый из транскрипта. Генный продукт, описываемый в данной заявке, дополнительно включает нуклеиновые кислоты с посттранскрипционными модификациями, например полиаденилированием или полипептиды с посттрансляционными модификациями, например метилированием, гликозилированием, добавлением липидов, ассоциированием с другими белковыми субъединицами, протеолитическим расщеплением и т.п.

В соответствии с использованием в данной заявке термин «клетки-хозяева» относится к клеткам, образующим основной вектор с использованием рекомбинантных ДНК и кодированием, по меньшей мере, одного гетерологичного гена.

В соответствии с использованием в данной заявке термины «N-гликан», «олигосахарид», « олигосахаридная структура», «шаблон гликозилирования», «профиль гликозилирования» и «структура гликозилирования» имеют в основном одно значение, и каждый из них относится к одной или более структурам, образованным из сахарных остатков и присоединяемых к гликированным белкам.

В соответствии с использованием в данной заявке термин «лекарственная композиция» относится к смеси состава, описываемого в данной заявке, с другими химическими компонентами, такими как носители, стабилизаторы, разбавители, диспергаторы, суспендирующие агенты, загустители и/или наполнители.

Пациенты с недостаточной активностью КЛЛ

Без желания ограничивать изобретение лечением какого-либо состояния или группы состояний изобретение включает лечение дефицита кислой лизосомной липазы (КЛЛ) у пациентов. В соответствии с использованием в данной заявке пациентом с дефицитом КЛЛ является любой пациент с недостаточной активностью КЛЛ. Недостаточная активность КЛЛ у пациентов может, например, быть причиной низкого уровня РНК, низкого уровня белков или низкой активности белков. Недостаточная активность КЛЛ может быть результатом мутации последовательности, кодирующей КЛЛ, регуляторной последовательности КЛЛ или другого гена (например, гена, регулирующего КЛЛ). Недостаточная активность КЛЛ может быть также результатом воздействия экологических факторов.

Настоящее изобретение может использоваться для лечения широкого диапазона состояний у субъекта или пациента. Поэтому любое состояние, которое может успешно лечиться посредством применения экзогенной КЛЛ в соответствии с изобретением включается в объем изобретения.

Один вариант воплощения изобретения относится к лечению лизосомной болезни накопления (ЛБН), являющейся результатом дефицита кислой лизосомной липазы, конкретно - болезни Вольмана (БВ) и болезни накопления эфиров холестерина (БНЭХ). Без желания ограничивать изобретение какой либо конкретной теорией или каким-либо частным механизмом действия, и БВ и БНЭХ могут являться результатом мутаций в локусе КЛЛ и приводят к массивной аккумуляции липидного материала в лизосомах в ряде тканей, и значительным нарушениям в холестериновом и липидном гомеостатических механизмах, которые могут быть вылечены введением экзогенной КЛЛ в соответствии со способами настоящего изобретения. Таким образом, в одном варианте воплощения дефицит КЛЛ, который лечится в соответствии с изобретением, представляет собой БВ. В другом варианте воплощения дефицит КЛЛ, который лечится в соответствии с изобретением, представляет собой БНЭХ. В некоторых вариантах воплощения диагноз БВ и БНЭХ основывается на генетическом анализе (например, идентификация функциональной мутации в последовательности, кодирующей КЛЛ). В других вариантах воплощения диагноз БВ и БНЭХ основывается на клинических данных (например, физическое обследование и/или лабораторные тесты).

В некоторых вариантах воплощения экзогенная КЛЛ может использоваться для лечения осложнений при различных состояниях, таких как неалкогольная жировая болезнь печени (НАЖБП) и неалкогольный стеатогепатит (НАСГ). НАЖБП относится к болезни печени, имеющей гистопатологию, подобную гистопатологии болезни печени, возникающей вследствие чрезмерного потребления алкоголя. Она характеризуется макрососудистым ожирением, приводящим к увеличению печени. НАЖБП может прогрессировать в НАСГ, которая относится к болезни печени, подобной НАЖБП с добавлением воспаления и повреждения печени, что может привести к фиброзу и циррозу.

В некоторых вариантах воплощения экзогенная КЛЛ может использоваться для лечения состояний, включающих панкреатит, например хронический панкреатит и/или острый панкреатит, а также повреждение поджелудочной железы, вызванное алкоголем, такое как индуцированный алкоголем панкреатит.

Экзогенная КЛЛ, произведенная любым подходящим способом, может использоваться для лечения болезней вследствие повреждения клеток, вызванного алкоголем, включая, но не ограничиваясь этим, такие индуцированные алкоголем повреждения клеток, которые приводят к аккумуляции липидных эфиров в тканях тела, таких как, но не ограничиваясь ими, печень, селезенка, пищеварительный тракт и сердечнососудистая ткань. В соответствии с изобретением малабсорбция также может лечиться посредством введения экзогенной КЛЛ. Экзогенная КЛЛ также является полезной при лечении пациентов с танжерской болезнью и наследственной гипоальфалипопротеинемии. Танжерская болезнь/наследственная гипоальфалипопротеинемия связана с аккумуляцией эфиров холестерина в макрофагах и сопровождается гепатоспленомегалией и/или лимфаденопатией вместе с низким уровнем липопротеинов высокой плотности (ЛВП), которые могут лечиться посредством введения экзогенной КЛЛ. Например, без желания ограничивать изобретение какой-либо частной теорией или механизмом действия, пониженная активность КЛЛ может привести к снижению экспрессии АВСА1, и, наоборот, повышенная активность КЛЛ, полученная при введении экзогенной КЛЛ пациенту с танжерской болезнью наследственной гипоальфалипопротеинемией повысит экспрессию АВСА1 для преодоления воздействий гена АВСА1 со сниженной функциональной активностью в результате полиморфизма.

В некоторых вариантах воплощения уровень активности КЛЛ у пациента перед лечением составляет примерно 1%, примерно 2%, примерно 3%, примерно 5%, примерно 10%, примерно 15%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70% или примерно 80% от нормального уровня активности КЛЛ. В одном варианте воплощения уровень активности КЛЛ у пациента перед лечением составляет примерно 50% или меньше от нормального уровня активности КЛЛ. В одном варианте воплощения уровень активности КЛЛ у пациента перед лечением составляет примерно 40% или меньше от нормального уровня активности КЛЛ. В некоторых вариантах воплощения уровень активности КЛЛ у пациента перед лечением составляет примерно 30% или меньше от нормального уровня активности КЛЛ. В некоторых вариантах воплощения уровень активности КЛЛ у пациента перед лечением составляет примерно 20% или меньше от нормального уровня активности КЛЛ. В некоторых вариантах воплощения уровень активности КЛЛ у пациента перед лечением составляет примерно 10% или меньше от нормального уровня активности КЛЛ. В некоторых вариантах воплощения уровень активности КЛЛ у пациента перед лечением составляет примерно 5% или меньше от нормального уровня активности КЛЛ. В некоторых вариантах воплощения у пациента перед лечением не обнаруживается измеряемый уровень активности КЛЛ.

В некоторых вариантах воплощения уровень активности КЛЛ измеряется в культивируемом фибробласте, полученном от пациента-человека, страдающего дефицитом КЛЛ. В некоторых вариантах воплощения уровень активности КЛЛ измеряется в лимфоцитах (например, лейкоцитах) пациента-человека, страдающего дефицитом КЛЛ. Лимфоциты включают, но не ограничиваются ими, мононуклеары периферической крови (МНПК). Способы измерения описываются, например, в Burton и др., (1980) Clinica Chimica Acta 101: 25-32, и в Anderson и др., (1999) Mol. Genet. & Metab., 66: 333- 345; оба источника включены в данную заявку во всей полноте. Пациенты с дефицитом КЛЛ, получающие лечение посредством введения экзогенной КЛЛ, могут демонстрировать ферментную активность фибробластной КЛЛ, которая ниже примерно 30, примерно 20, примерно 10, примерно 5, примерно 4, примерно 3, примерно 2 или примерно 1 пмоль/мг/мин при измерении с использованием триолеина в качестве подложки. Пациенты с дефицитом КЛЛ, получающие лечение посредством введения экзогенной КЛЛ, могут демонстрировать ферментную активность лейкоцитной КЛЛ, которая ниже примерно 30, примерно 20, примерно 10, примерно 5, примерно 4, примерно 3, примерно 2 или примерно 1 пмоль/мг/мин при измерении с использованием триолеина в качестве подложки. Пациенты с дефицитом КЛЛ, получающие лечение посредством введения экзогенной КЛЛ, могут демонстрировать ферментную активность фибробластной КЛЛ, которая ниже примерно 30, примерно 20, примерно 10, примерно 5, примерно 4, примерно 3, примерно 2 или примерно 1 пмоль/мг/мин при измерении с использованием олеата холестерина в качестве подложки. Пациенты с дефицитом КЛЛ, получающие лечение посредством введения экзогенной КЛЛ, могут демонстрировать ферментную активность лейкоцитной КЛЛ, которая ниже примерно 30, примерно 20, примерно 10, примерно 5, примерно 4, примерно 3, примерно 2 или примерно 1 пмоль/мг/мин при измерении с использованием олеата холестерина в качестве подложки.

Введение экзогенной КЛЛ

Изобретение предоставляет способы лечения пациентов-людей посредством экзогенной КЛЛ, включающие введение экзогенной КЛЛ пациенту, где введение является достаточным для восстановления роста, улучшения функции печени, уменьшения поражения печени, повышения уровня КЛЛ в тканях и/или повышения активности КЛЛ у пациента. Изобретение предоставляет эффективные и ранее не характеризуемые частоты введения (т.е. графики введения доз) экзогенной КЛЛ для лечения состояний, являющихся следствием дефицита КЛЛ, включая БВ и БНЭХ, а также ранее не характеризуемые количества дозирования для лечения этих состояний.

Изобретение предоставляет терапевтически эффективную дозу экзогенной КЛЛ, которая должна вводиться пациенту от одного раза каждые 5 дней до одного раза каждые 30 дней в течение периода времени, определяемого специалистом-практиком в области медицинских наук. В одном варианте воплощения период времени будет оставшимся периодом жизни пациента. В одном варианте воплощения частота введения дозы находится в диапазоне от одного раза каждые 5 дней до одного раза каждые 25 дней. В одном варианте воплощения частота введения дозы находится в диапазоне от одного раза каждые 5 дней до одного раза каждый 21 день. В другом варианте воплощения частота введения дозы находится в диапазоне от одного раза каждые 7 дней до одного раза каждые 14 дней. Экзогенная КЛЛ может вводиться один раз каждые 5 дней, один раз каждые 6 дней, один раз каждые 7 дней, один раз каждые 8 дней, один раз каждые 9 дней, один раз каждые 10 дней, один раз каждые 11 дней, один раз каждые 12 дней, один раз каждые 13 дней или один раз каждые 14 дней. В некоторых вариантах воплощения экзогенная КЛЛ вводится примерно еженедельно. В других вариантах воплощения экзогенная КЛЛ вводится один раз примерно в две недели. В одном варианте воплощения экзогенная КЛЛ вводится один раз примерно каждые 30 дней.

Для лечения состояния, как правило, количество вводимой экзогенной КЛЛ может меняться в зависимости от известных факторов, таких как возраст, здоровье и масса реципиента, вид одновременного лечения, частота лечения и т.п. Обычно доза активного ингредиента может быть равна от примерно 0,01 до примерно 50 мг на килограмм массы тела. В одном варианте воплощения доза экзогенной КЛЛ в соответствии с изобретением составляет от примерно 0,1 мг до примерно 0,5 мг на килограмм массы тела. В одном варианте воплощения доза составляет от примерно 0,1 мг до примерно 5,0 мг на килограмм. В одном варианте воплощения доза составляет от примерно 0,1 мг до примерно 5,0 мг на килограмм. В одном варианте воплощения доза составляет примерно 0,1, примерно 0,2, примерно 0,25, примерно 0,30, примерно 0,35, примерно 0,40, примерно 0,45, примерно 0,50 мг на килограмм. В одном варианте воплощения доза составляет от примерно 1 мг до примерно 5 мг на килограмм. В одном варианте воплощения доза составляет примерно 1 мг на килограмм. В одном варианте воплощения доза составляет примерно 3 мг на килограмм. Например, может быть введен 0,1 мг на килограмм массы тела, 0,2 мг на килограмм массы тела, 0,3 мг на килограмм массы тела, 0,4 мг на килограмм массы тела, 0,5 мг на килограмм массы тела, 1 мг на килограмм массы тела, 2 мг на килограмм массы тела, 3 мг на килограмм массы тела, 4 мг на килограмм массы тела или 5 мг на килограмм массы тела. В одном варианте воплощения доза составляет от примерно 1 мг до примерно 20 мг на килограмм массы тела.

Изобретение также включает другие дозы при использовании графика введении доз в соответствии с изобретением. Например, в соответствии с графиком введения доз в соответствии с изобретением, пациенту вводится от примерно 0,1 мг до примерно 50 мг на килограмм массы тела.

В некоторых вариантах воплощения вводится от примерно 0,5 до примерно 50 мг экзогенной КЛЛ, например, пациенту с болезнью Вольмана в возрасте от 1 месяца до 24 месяцев. В одном варианте воплощения возраст пациента составляет менее 1 года. В другом варианте воплощения возраст пациента составляет менее 2 лет. В некоторых вариантах воплощения примерно 0,1 мг, примерно 0,2 мг, примерно 0,3 мг, примерно 0,4 мг, примерно 0,5 мг, примерно 1 мг, примерно 2 мг, примерно 3 мг, примерно 5 мг, примерно 10 мг, примерно 15 мг, примерно 20 мг, примерно 25 мг, примерно 30 мг, примерно 35 мг, примерно 40 мг или примерно 45 мг экзогенной КЛЛ вводится пациенту с болезнью Вольмана. В некоторых вариантах воплощения от примерно 0,5 мг до примерно 30 мг, от примерно 0,5 мг до примерно 20 мг, от примерно 0,5 мг до примерно 10 мг, или от примерно 0,5 мг до примерно 5 мг вводятся пациенту с болезнью Вольмана. В некоторых вариантах воплощения вводится от примерно 1 мг до примерно 30 мг, от примерно 1 мг до примерно 20 мг, от примерно 1 мг до примерно 10 мг, или от примерно 1 мг до примерно 5 мг.

В некоторых вариантах воплощения от примерно 1 мг до примерно 350 мг экзогенной КЛЛ вводится пациенту с БЭНХ. Таким образом, в некоторых вариантах воплощения примерно 1, 5, 10, 25, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325 или 350 мг экзогенной КЛЛ вводится пациенту с БЭНХ. В некоторых вариантах воплощения от примерно 5 мг до примерно 350 мг, от примерно 5 мг до примерно 300 мг, от примерно 5 мг до примерно 250 мг, от примерно 5 мг до примерно 200 мг вводится пациенту с БЭНХ. В некоторых вариантах воплощения от примерно 10 мг до примерно 350 мг, от примерно 10 мг до примерно 300 мг, от примерно 10 мг до примерно 250 мг, от примерно 10 мг до примерно 200 мг вводится пациенту с БЭНХ.

Комплексные лечения

Лечебные белки, раскрываемые в данной заявке, могут быть использованы в комбинации с другими терапевтическими средствами. Изобретение предоставляет процедуру, выполняемую перед лечением, для минимизации или предотвращения каких-либо возможных анафилактических реакций, которые могут иметь место при введении экзогенной КЛЛ в соответствии с изобретением. В одном варианте воплощения для предотвращения возможной анафилактической реакции антагонист рецептора Н-1, также известный как антигистамин (например, дифенгидрамин), вводится пациенту. В одном варианте воплощения антагонист рецептора Н-1 вводится в виде дозы от примерно 1 мг до примерно 10 мг на килограмм массы тела. Например, антигистамин может вводиться в количестве примерно 5 мг на килограмм. Введение антигистамина может выполняться перед введением экзогенной КЛЛ в соответствии с изобретением. В одном варианте воплощения антагонист рецептора Н-1 вводится от примерно 10 до примерно 90 минут, например от примерно 30 до примерно 60 минут перед введением экзогенной КЛЛ. Антагонист рецептора Н-1 может вводиться с использованием амбулаторной системы, подсоединенной к порту сосудистого доступа. В одном варианте воплощения антигистамин вводится за примерно 90 минут до введения экзогенной КЛЛ. В одном варианте воплощения антигистамин вводится от примерно 10 до примерно 60 минут перед введением экзогенной КЛЛ. В другом варианте воплощения антигистамин вводится от примерно 20 до примерно 40 минут перед введением экзогенной КЛЛ. Например, антигистамин может вводиться за 20, 25, 30, 35, или 40 минут до введения экзогенной КЛЛ. В одном варианте воплощения вводимый антигистамин представляет собой дифенгидрамин. Может использоваться любой пригодный антигистамин. Такие антигистамины включают, без ограничения, клемастин, доксиламин, лоратидин, деслоратидин, фексофенадин, фенирамин, цетиризин, эбастин, прометазин, хлорфенамин, левоцетиризин, олопатадин, кветиапин, меклизин, дименгидринат, эмбрамин, диметиден и дексхлорфенирамин.

В одном варианте воплощения антигистамин вводится в виде дозы от примерно 0,1 мг до примерно 10 мг на килограмм массы тела. В одном варианте воплощения антигистамин вводится в виде дозы от примерно,1 мг до примерно 5 мг на килограмм массы тела. Например, доза может составлять 1 мг, 2 мг, 3 мг, 4 мг или 5 мг на килограмм массы тела. Антигистамин может вводиться любым пригодным способом. В одном варианте воплощения антигистамин вводится внутривенно. В другом варианте воплощения антигистамин вводится в фармацевтически приемлемых капсулах.

В другом варианте воплощения при внутривенном вливании вероятность анафилактической реакции может быть снижена посредством введения препаратов с использованием протокола линейного нарастания. В этом контексте, протокол линейного нарастания относится к медленному повышению скорости вливания препарата во время вливания для снижения чувствительности пациента к вливанию препарата.

Иммунодепрессанты, такие как, но не ограничиваясь ими, антигистамины, кортикостероиды, сиролимус, воклоспорин, циклоспорин, метотрексат, направленные антитела рецептора IL-2, направленные антитела рецептора Т-ячейки, направленные антитела ФНО-альфа или составные белки (например, инфликсимаб, этанерцепт или адалимумаб), антиген 4 цитотоксических Т лимфоцитов (CTLA-4-Ig) (например, абатацепт), антитела анти-ОХ-40 могут быть также введены до, во время или после введения экзогенной КЛЛ, например, если у пациента ожидается или была анафилактическая реакция или неблагоприятная иммунная реакция.

Изобретение также охватывает лечение, включающее введение композиций, содержащих экзогенную КЛЛ в комбинации с одним или более веществ, понижающих уровень холестерина (например, ингибиторы редуктазы 3-гидрокси-3-метилглутарил-кофермента А). Примеры таких веществ, не носящие ограничительный характер, включают: аторвастатин (Lipitor® и Torvast®), флувастатин (Lescol®), ловастатин (Mevacor®, Altocor®, Altoprev®), правастатин (Livalo®, Pitava®), правастатин (Pravachol®, Selektine®, Lipostat®), розувастатин (Crestor®) и симвастатин (Zocor®, Lipex®).

Эффекты введения экзогенной КЛЛ

Настоящее изобретение предусматривает коррекцию или нормализацию относящихся к болезни проявлений после лечения посредством введения экзогенной КЛЛ. Клиническое течение (т.е. улучшение состояния) после введения КЛЛ может контролироваться, используя подходящий способ или подходящую процедуру.

В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения значения Cmax от примерно 200 нг/мл до примерно 1500 нг/мл. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения значения Cmax от примерно 200 нг/мл до примерно 1000 нг/мл. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения значения Cmax от примерно 200 нг/мл до примерно 800 нг/мл. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения значения Cmax примерно 200 нг/мл, примерно 300 нг/мл, примерно 400 нг/мл, примерно 500 нг/мл, примерно 600 нг/мл, примерно 700 нг/мл, примерно 800 нг/мл, примерно 900 нг/мл, примерно 1000 нг/мл, примерно 1250 нг/мл, или примерно 1500 нг/мл. В некоторых вариантах воплощения Cmax достигается во время вливания.

В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения периода полураспада (t1/2) КЛЛ меньше 40 минут. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения периода полураспада (t1/2) КЛЛ меньше 30 минут. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения периода полураспада (t1/2) КЛЛ меньше 20 минут. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения периода полураспада (t1/2) КЛЛ меньше 15 минут. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения периода полураспада (t1/2) КЛЛ меньше 10 минут. В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для достижения периода полураспада (t1/2) КЛЛ примерно 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35 или 40 минут.

В некоторых вариантах воплощения экзогенная КЛЛ повышает активность КЛЛ у пациента. Активность КЛЛ может быть повышена, например, в печени, селезенке, лимфатических узлах, аорте, лейкоцитах периферической крови, и/или фибробластах кожи. В некоторых вариантах воплощения активность КЛЛ измеряется в экстрактах лимфоцитов, изолированных от образцов крови.

Экзогенная КЛЛ может повысить активность КЛЛ в, по меньшей мере, примерно 1,5, примерно 2, примерно 2,5, примерно 3, примерно 4, примерно 5, примерно 6, примерно 7, примерно 8, примерно 9, примерно 10, примерно 15 или примерно 20 раз по сравнению с активностью перед введением КЛЛ. Экзогенная КЛЛ может повысить активность КЛЛ в, по меньшей мере, примерно 10, примерно 11, примерно 12, примерно 13, примерно 14, примерно 15, примерно 16, примерно 17, примерно 18, примерно 19, примерно 20 раз по сравнению с активностью перед введением КЛЛ. Активность КЛЛ может быть оценена, используя способы, известные в этой области, включая, например, анализы, используя холестерин [l-14C]олеат, триолеин (глицерин три [l-14C]олеат), p-нитрофенил миристат или субстраты 4-МУО (4 метилумбеллиферил олеат).

В одном варианте воплощения объем органа и тканей и категоризация используются для определения улучшения состояния после введения экзогенной КЛЛ в соответствии с изобретением.

В одном варианте воплощения клиническое течение для функции / поражения печени после введения экзогенной КЛЛ контролируется во времени посредством количественного определения трансаминаз крови, таких как аспартатаминотрансфераза (ACT), и/или аланинаминотрансфераза (АЛТ), и/или другие биомаркеры, такие как альбумин, щелочная фосфатаза и билирубин (прямой и общий).

В одном варианте воплощения клиническое течение контролируется с использованием технологии получения изображения. Например, и без ограничения, технология получения изображения может включать ультразвук, КТ-сканирование, магниторезонансное изображение и ядерную магниторезонансную спектроскопию.

В некоторых вариантах воплощения введение экзогенной КЛЛ в виде доз, описываемых в данной заявке, является достаточным для восстановления роста и/или увеличения массы тела пациентов-людей. Введение экзогенной КЛЛ также может повышать скорость роста (т.е. увеличения массы тела) младенцев или детей, страдающих от дефицита КЛЛ с ранним началом. Например, введение экзогенной КЛЛ может повысить скорость увеличения массы тела, по меньшей мере, на примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80%, примерно 90%, примерно 100%, примерно 200%, примерно 300%, примерно 400% или примерно 500% от скорости роста, наблюдаемой перед введением. В некоторых вариантах воплощения введение экзогенной КЛЛ восстанавливает нормальную скорость роста у детей, страдающих от дефицита КЛЛ с ранним началом (например, болезнью Вольмана), в возрасте от примерно 1 месяца до примерно 24 месяцев. Термин «нормальная» в этом контексте относится к нормальной скорости роста для пациентов, получивших лечение, определяемое специалистом-практиком в области медицинских наук.

В одном варианте воплощения, например, при лечении БВ и БНЭХ или других проявлений дефицита КЛЛ, гепатомегалия значительно ослабевает при возвращении размера печени к размеру, превышающему нормальный размер на величину от примерно 1% до примерно 60%. Термин «нормальный» в этом контексте относится к печени нормального размера пациента, получившего лечение, определяемое специалистом-практиком в области медицинских наук. В одном варианте воплощения размер печени уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 50%. В другом варианте воплощения размер печени уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 40%. В одном варианте воплощения размер печени уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 30%. В другом варианте воплощения размер печени уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 20%. В другом варианте воплощения размер печени уменьшается до величины, превышающей нормальный размер на величину от примерно 10% до примерно 20%. Например, размер печени может быть на 10%, 11%, 12% 13% 14%, 15%, 16%, 17%, 18%, 19%, или 20% больше нормального размера. В еще одном варианте воплощения размер печени уменьшается до величины, превышающей нормальный размер на величину от примерно 0% до примерно 10%. Например, размер печени может быть на 0%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% или 10% больше нормального размера печени.

Лечение посредством экзогенной КЛЛ может также улучшить функцию печени. Так, в некоторых вариантах воплощения лечение посредством экзогенной КЛЛ является достаточным для восстановления нормальной функции печени и/или нормализации тестов печени. В некоторых вариантах воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня сыворотки трансаминазы печени, например, по меньшей мере, на примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80%, и/или, по меньшей мере, примерно 90%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня сыворотки трансаминазы печени, по меньшей мере, примерно на 40%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня сыворотки трансаминаз печени, по меньшей мере, примерно на 50%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня сыворотки трансаминазы печени, по меньшей мере, примерно на 60%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня сыворотки трансаминазы печени, по меньшей мере, примерно на 70%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня сыворотки трансаминазы печени, по меньшей мере, на примерно 80%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня сыворотки трансаминазы печени, по меньшей мере, на примерно 90%.

В некоторых вариантах воплощения трансаминаза печени представляет собой аланинаминотрансферазу (АЛТ). В одном варианте воплощения введение экзогенной КЛЛ является достаточным для снижения уровня сывороточной АЛТ. Например, введение экзогенной КЛЛ может снизить уровень сывороточной АЛТ, например, по меньшей мере, на примерно 50%, 60%, 70%, 80% или 90%. Уровень сывороточной АЛТ может служить для индикации степени поражения печени. Таким образом, настоящее изобретение также рассматривает способы уменьшения степени поражения печени у пациента-человека, страдающего дефицитом КЛЛ, посредством введения эффективного количества экзогенной КЛЛ для снижения уровня сывороточной АЛТ.

В некоторых вариантах воплощения трансаминаза печени представляет собой аспартатаминотрансферазу (ACT). В одном варианте воплощения введение экзогенной КЛЛ является достаточным для снижения уровня сывороточной ACT. Например, введение экзогенной КЛЛ может снизить уровень сывороточной ACT, например, по меньшей мере, на примерно 50%, 60%, 70%, 80% или 90%. Уровень сывороточной ACT может служить для индикации степени поражения печени. Соответственно, настоящее изобретение также рассматривает способ уменьшения степени поражения печени у пациента, страдающего дефицитом КЛЛ, посредством введения эффективного количества экзогенной КЛЛ для снижения уровня сывороточной ACT.

В некоторых вариантах воплощения лечение посредством экзогенной КЛЛ может снизить уровень ферритина сыворотки. Так, в некоторых вариантах воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня ферритина сыворотки, например, по меньшей мере, на примерно 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 95% по сравнению с уровнем до лечения. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня ферритина сыворотки, по меньшей мере, примерно на 50%. В другом варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня ферритина сыворотки, по меньшей мере, примерно на 60%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня ферритина сыворотки, по меньшей мере, примерно на 70%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня ферритина сыворотки, по меньшей мере, примерно на 80%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня ферритина сыворотки, по меньшей мере, примерно на 90%. В одном варианте воплощения лечение посредством экзогенной КЛЛ является достаточным для снижения уровня ферритина сыворотки, по меньшей мере, примерно на 95%.

В одном варианте воплощения, например при лечении БВ и БНЭХ или других проявлений дефицита КЛЛ, спленомегалия значительно ослабевает при возвращении размера селезенки к размеру, превышающему нормальный размер на величину от примерно 1% до примерно 60%. Термин «нормальный» в этом контексте относится к селезенке нормального размера у пациента, получившего лечение, определяемое специалистом-практиком в области медицинских наук. В одном варианте воплощения размер селезенки уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 50%. В другом варианте воплощения размер селезенки уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 40%. В одном варианте воплощения размер селезенки уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 30%. В другом варианте воплощения размер селезенки уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 20%. %. В другом варианте воплощения размер селезенки уменьшается до величины, превышающей нормальный размер на величину от примерно 10% до примерно 20%. Например, размер печени может быть на 10%, 11%, 12% 13% 14%, 15%, 16%, 17%, 18%, 19% или 20% больше нормального размера. В еще одном варианте воплощения размер селезенки уменьшается до величины, превышающей нормальный размер на величину от примерно 0% до примерно 10%. Например, размер селезенки может быть на 0%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% или 10% больше нормального размера селезенки.

В одном варианте воплощения введение экзогенной КЛЛ является достаточным для снижения лимфаденопатии (т.е. увеличенных лимфатических узлов). Так, в некоторых вариантах воплощения размер лимфоузлов уменьшается до размера, превышающего нормальный размер на величину от примерно 1% до примерно 60%. Термин «нормальный» в этом контексте относится к лимфатическим узлам нормального размера у пациента, получившего лечение, определяемое специалистом-практиком в области медицинских наук. В одном варианте воплощения размер лимфоузлов уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 50%. В другом варианте воплощения размер лимфоузлов уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 40%. В одном варианте воплощения размер лимфоузлов уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 30%. В другом варианте воплощения размер лимфоузлов уменьшается до величины, превышающей нормальный размер на величину от примерно 1% до примерно 20%. В другом варианте воплощения размер лимфоузлов уменьшается до величины, превышающей нормальный размер на величину от примерно 10% до примерно 20%. Например, размер лимфатических узлов может быть на 10%, 11%, 12% 13% 14%, 15%, 16%, 17%, 18%, 19% или 20% больше нормального размера. В еще одном варианте воплощения размер лимфатических узлов уменьшается до величины, превышающей нормальный размер на величину от примерно 0% до примерно 10%. Например, размер лимфатических узлов может быть на 0%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% или 10% больше нормального размера лимфатических узлов. В другом варианте воплощения выполняется липидный анализ для контроля улучшения состояния. Например, липидный анализ может быть выполнен для оценки терапевтического эффекта экзогенной КЛЛ. Липидный анализ может проводиться для образца ткани пациента (например, образца крови, образец биопсии печени) любым пригодным способом, таким как, но не ограничиваясь этим, жидкостная хроматография высокого разрешения, газовая хроматография, масс-спектроскопия или тонкослойная хроматография или любая комбинация этих способов, которую специалисты в данной области считают приемлемой. В одном варианте воплощения липидный анализ, выполняемый в соответствии с изобретением, показывает уровень общего холестерина, триглицеридов, липопротеинов низкой плотности, липопротеинов высокой плотности и/или эфира холестерина.

В одном варианте воплощения, например, при лечении БВ и БНЭХ или других проявлений дефицита КЛЛ, липидный анализ пациента, получающего лечение в соответствии с изобретением, показывает нормализацию концентрации липидов в печени, селезенке, кишечном тракте, лимфатических узлах и/или аорте, как может быть определено специалистом-практиком в области медицинских наук.

Уровень липида может быть оценен с использованием липидного анализа плазмы или липидного анализа ткани. При липидном анализе плазмы, может быть собрана плазма крови, и уровень общего холестерина в плазме может быть измерен, используя, например, колорометрический анализ с помощью набора COD-PAP (Wako Chemicals), общие триглицериды в плазме могут быть измерены, используя, например, набор Triglycerides/GB (Boehringer Mannheim), и/или общий холестерин в плазме может быть определен, используя набор Cholesterol/HP (Boehringer Mannheim). При липидном анализе ткани липиды могут быть экстрагированы, например, из печени, селезенки, и/или небольших образцов кишечного тракта (например, используя способ Фольша, представленный в Folch и др. J. Biol. Chem 226:497-505 (1957)). Концентрация общего холестерина в ткани может измерена, например, используя О-фталевый альдегид.

В некоторых вариантах воплощения введение экзогенной КЛЛ является достаточным для улучшения поглощения питательных веществ. В одном варианте воплощения введение экзогенной КЛЛ улучшает поглощение питательных веществ, как показывают измеренные уровни сывороточного альфа-токоферола, 25 ОН витамина D, сывороточного ретинола, дидегидроретинола или транстиретина.

В некоторых вариантах воплощения, например при лечении БВ и БНЭХ или других проявлений дефицита КЛЛ, введение экзогенной КЛЛ является достаточным для повышения уровня сывороточного гемоглобина (Нb). В одном варианте воплощения уровень гемоглобина повышается, по меньшей мере на примерно от 10% до примерно 20% по сравнению с уровнем, наблюдаемым до введения экзогенной КЛЛ.

В некоторых вариантах воплощения экзогенная КЛЛ может вводиться, используя способы для минимизации побочных эффектов. Например, введение экзогенной КЛЛ может минимизировать иммунную реакцию на экзогенную КЛЛ.

КЛЛ и лекарственные композиции, включающие экзогенную КЛЛ

Настоящее изобретение рассматривает лечение любого из связанных с дефицитом КЛЛ состояний, описанных в данной заявке, и других состояний, ранее не упоминавшихся, но которые могут быть улучшены при лечении. Экзогенная КЛЛ, используемая в соответствии с изобретением, включает рекомбинантную КЛЛ, которая может быть произведена в любой системе полезной экспрессии белка, включая, без ограничения, клеточную культуру (например, клетки СНО, клетки COS), бактерии, такие как кишечная палочка, трансгенных животных, таких как млекопитающие и птицы (например, курица, утка и индюк), и растительные системы (например, ряска и табак). Один аспект изобретения относится к рекомбинантной КЛЛ, произведенной в соответствии с патентом США №7524626, выданным 3 октября 2006 г.; заявками на патент США №11/973853, поданной 10 октября 2007 г.; №11/978360, поданной 29 октября 2007 г.; и 12/319396, поданной 7 января 2009 г., раскрытия которых включены в данную заявку во всей полноте путем ссылки. Один аспект изобретения относится к рекомбинантной КЛЛ, произведенной в соответствии с описанием в Du и др., (2005) Am. J. Hum. Genet. 77: 1061-1074, и Du и др. (2008) J. LipidRes., 49: 1646-1657, раскрытия которых включены в данную заявку во всей полноте путем ссылки. В одном полезном варианте воплощения экзогенная КЛЛ производится в яйцеводе трансгенной птицы (например, трансгенной курицы), например, в соответствии со способом, описанным в заявке PCT/US2011/033699, поданной 23 апреля 2011 г., которая включена в данную заявку во всей полноте путем ссылки. В некоторых вариантах воплощения рекомбинантная КЛЛ производится в клеточной линии птиц. В некоторых вариантах воплощения рекомбинантная КЛЛ производится в клеточной линии млекопитающих (например, человека).

В одном варианте воплощения экзогенная кислая лизосомная липаза, используемая в соответствии с изобретением, содержит гликаны, имеющие основные N-ацетилглюкозамин (GlcNAc) и завершенные структуры маннозы с N-связями. GlcNAc и завершенные гликаны маннозы на экзогенной КЛЛ могут быть конкретно распознаны и интернализированы макрофагами и фибробластом. Манноза-6-фосфат (М6Р), которая может доставить белки к рецепторам GlcNAc/маннозы, которые выражаются на клетках при состояниях, вылечиваемых посредством введения экзогенной КЛЛ, также обычно присутствует на экзогенной КЛЛ, используемой в соответствии с изобретением.

Обычно экзогенная КЛЛ в соответствии с изобретением, описываемая и раскрываемая в данной заявке, представляет собой КЛЛ человека. В одном варианте воплощения экзогенная КЛЛ имеет аминокислотную последовательность, представленную в генетическом банке Genbank RefSeq NM_000235.2). В одном варианте воплощения зрелая экзогенная КЛЛ имеет следующую аминокислотную последовательность:

SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFH ESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ (SEQ ID NO:1)

В некоторых вариантах воплощения экзогенная КЛЛ содержит аминокислоты 1-378 SEQ ID NO:1, аминокислоты 3-378 SEQ ID NO:1, аминокислоты 6-378 SEQ ID NO:1, или аминокислоты 7-378 SEQ ID NO:1. В некоторых вариантах воплощения экзогенная КЛЛ содержит смесь, по меньшей мере, два полипептида, выбранных из группы, состоящей из аминокислот 1-378 SEQ ID NO:1, аминокислот 3-378 SEQ ID NO:1, аминокислот 6-378 SEQ ID NO:1 и аминокислот 7-378 SEQ ID NO:1. В некоторых вариантах воплощения экзогенная КЛЛ содержит смесь полипептидов, включающих аминокислоты 1-378 SEQ ID NO:1, полипептидов, включающих аминокислоты 3-378 SEQ ID NO:1, и полипептидов, включающих аминокислоты 6-378 SEQ ID NO:1. В других вариантах воплощения экзогенная КЛЛ содержит полипептид, идентичный аминокислотам 1-378 SEQ ID NO:1, аминокислотам 3-378 SEQ ID NO:1, аминокислотам 6-378 SEQ ID NO:1 или аминокислотам 7-378 SEQ ID NO:1. В других вариантах воплощения экзогенная КЛЛ содержит полипептид, который, по меньшей мере, на примерно 70%, примерно 75%, примерно 80%, примерно 85%, примерно 90%, примерно 95%, примерно 96%, примерно 97%, примерно 98% или примерно 99% идентичны аминокислотам 1- 378 SEQ ID NO:1, аминокислотам 3-378 SEQ ID NO:1, аминокислотам 6-378 SEQ ID NO:1 или аминокислотам 7-378 SEQ ID NO:1. В некоторых вариантах воплощения экзогенная КЛЛ содержит полипептид, являющийся функциональным фрагментом SEQ ID NO:1 или, по меньшей мере, на примерно 70%, примерно 75%, примерно 80%, примерно 85%, примерно 90%, примерно 95%, примерно 96%, примерно 97%, примерно 98% или примерно 99% идентичен функциональному фрагменту SEQ ID NO:1.

В некоторых вариантах воплощения экзогенная КЛЛ представляет собой белок рекомбинантной КЛЛ, описанный в заявке PCT/US2011/033699, поданной 23 апреля 2011 г., которая включена в данную заявку во всей полноте путем ссылки.

Выявлено, что позиции неидентичных аминокислот часто отличаются по консервативному замещению аминокислоты, где аминокислотные остатки замещаются другими аминокислотными остатками с подобными химическими свойствами (например, заряд или гидрофобность) и поэтому не меняют функциональные свойства молекулы. Там где последовательности отличаются по консервативным замещениям, относительная идентичность последовательности может регулироваться вверх для коррекции консервативной природы замещения. Средства выполнения такого регулирования хорошо известны специалистам в этой области. Количественная оценка консервативного замещения может быть выполнена вычислением в соответствии с, например, алгоритмом Мейера и Миллера, Meyers и Millers, Computer Applic. Biol. Sci. 4:11-17 (1988).

Термин «окно сравнения» относится к сегменту смежных позиций, таких как от примерно 25 до примерно 400 позиций, или от примерно 50 до примерно 200 позиций, или от примерно 100 до примерно 150 позиций, по которым последовательность можно сравнить с эталонной последовательностью с таким же числом смежных позиций после оптимального совмещения двух последовательностей. Способы совмещения последовательностей для сравнения хорошо известны в этой области. Оптимальное совмещение последовательностей для сравнения может быть выполнено, например, в соответствии с алгоритмом локальной гомологии (Smith и Waterman, Adv. Appl. Math. 2:482 (1981), алгоритмом глобального совмещения (Needleman и Wunsch, J. Mol. Biol. 48:443 (1970), поиском способов подобия (Pearson и Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444 (1988); Altschul и др., Nucl. Acids Res. 25:3389-402 (1997), посредством компьютерного осуществления этих алгоритмов (например, GAP, BESTFIT, FASTA и BLAST в пакете программного обеспечения Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., 30 Madison, Wis.), обычно используя настройки по умолчанию, или путем ручного совмещения и визуального контроля (см., например Current Protocols in Molecular Biology, Ausubel и др., 1994). Например, поиски белка BLAST могут быть выполнены, используя программу XBLAST, метка=50, длина слова=3, для получения аминокислотных последовательностей, которые более чем на 80% идентичны аминокислотной последовательности SEQ ID NO:1 или ее фрагменту.

Одним примером полезного осуществления алгоритма является PILEUP. PILEUP создает множественное совмещение последовательности из группы родственных последовательностей, используя прогрессивные парные совмещения. Программа также может строить дендограмму, показывающую кластерные соотношения, используемые для создания совмещения. PILEUP использует упрощение способа прогрессивного совмещения Feng и Doolittle, J. Mol. Evol. 35:351-360 (1987). Используемый способ подобен способу, описанному Higgins и Sharp, CABIOS 5:151-3 (1989). Процедура множественного совмещения начинается с парного совмещения двух наиболее подобных последовательностей, образующих кластер двух совмещенных последовательностей. Этот кластер затем может быть совмещен со следующей наиболее родственной последовательностью или с кластером двух совмещенных последовательностей. Два кластера последовательностей могут быть совмещены простым добавлением парного совмещения двух индивидуальных последовательностей. Серия таких парных совмещений, которая включает последовательности с возрастающей несхожестью при каждой итерации, производит окончательное совмещение.

В некоторых вариантах воплощения полипептиды экзогенной КЛЛ в соответствии с изобретением включают варианты последовательностей дикого типа. Эти варианты попадают в один или более из трех классов: замещающий, инсерционный и делеционный варианты. Эти варианты могут представлять собой аллельные или межвидовые варианты естественного происхождения, или они могут быть приготовлены посредством сайт-специфического мутагенеза нуклеотидов в белке, кодирующем ДНК. Сайт-специфический мутагенез может быть выполнен, используя кассету или мутагенез ПЦР или другие способы, хорошо известные в этой области, для производства ДНК, кодирующей вариант, и после этого выражая ДНК в рекомбинантной клеточной культуре. Фрагменты целевого белка варианта, содержащие до 100-150 аминокислотных остатков, могут быть приготовлены посредством in vitro синтеза, используя принятые способы. Таблицы консервативного замещения, содержащие функционально подобные аминокислоты, хорошо известны в этой области (Henikoff и Henikoff, Proc. Natl. Acad. Sci. U.S.A. 89:10915- 10919 (1992)).

Аминокислотные замещения обычно выполняются для одиночных остатков. Вставки обычно выполняются для примерно от 1 до примерно 20 аминокислот, хотя значительно более длинные вставки допустимы. Диапазон делеций составляет от примерно 1 до примерно 20 остатков, хотя в некоторых случаях делеции могут быть намного длиннее. Замещения, делеции и вставки или их какие-либо комбинации могут использоваться для достижения окончательной производной.

В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность, равную, по меньшей мере, примерно 100 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность, равную, по меньшей мере, примерно 200 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность, равную, по меньшей мере, примерно 250 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность от примерно 100 Е/мг до примерно 1000 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность от примерно 100 Е/мг до примерно 500 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность от примерно 100 Е/мг до примерно 350 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность от примерно 200 Е/мг до примерно 350 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность от примерно 250 Е/мг до примерно 350 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность, равную примерно 250 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность, равную примерно 275 Е/мг. В некоторых вариантах воплощения экзогенная КЛЛ имеет удельную активность, равную примерно 300 Е/мг. КЛЛ человека имеет 6 потенциальных сайтов в своей аминокислотной последовательности для гликозилирования с N-связями: Asn36, Asn72, Asn101, Asnl61, Asn273, и Asn321, как сформулировано в ПОСЛ. ИД №:1. В некоторых вариантах воплощения по меньшей мере, 1, 2, 3, 4 или 5 из сайтов гликозилирования с N-связями гликозилируются. В некоторых вариантах воплощения все шесть сайтов гликозилирования гликозилируются. В некоторых вариантах воплощения Asn36, Asn101, Asnl61, Asn273 и Asn321 гликозилируются. В некоторых вариантах воплощения Asn36, Asn101, Asn161, Asn273 и Asn321 гликозилируются и Asn72 не гликозилируется. В некоторых вариантах воплощения N-гликановые структуры содержат би-, три- и тетраантеннальные структуры с N-ацетилглюкозамином(GlcNAc), маннозой и/или манноза-6-фосфатом (М6Р). В некоторых вариантах воплощения экзогенная КЛЛ содержит М6Р-модифицированные N-гликаны при Asn101, Asn161 и Asn273. В некоторых вариантах воплощения экзогенная КЛЛ не содержит гликаны с 0-связями. В некоторых вариантах воплощения экзогенная КЛЛ не содержит сиаловую кислоту. В некоторых вариантах воплощения экзогенная КЛЛ имеет профиль гликозилирования, как описано в заявке PCT/US2011/033699, поданной 23 апреля 2011 г., которая включена в данную заявку во всей полноте путем ссылки.

В некоторых вариантах воплощения молекулярный вес экзогенной КЛЛ равен примерно 55 кД.

В определенных вариантах воплощения при лечении субъекта может использоваться молекула нуклеиновой кислоты, кодирующая экзогенную КЛЛ, например, в векторе. Дозы нуклеиновых кислот, кодирующих полипептиды, находятся в диапазоне от примерно 10 нг до 1 г, от 100 нг до 100 мг, от 1 мкг до 10 мг или 30-300 мкг ДНК на пациента. Дозы для инфекционных вирусных векторов меняются от 10 до 100 или больше вирионов на дозу.

В некоторых вариантах воплощения настоящего изобретения, экзогенная КЛЛ вводится в соответствии со способом лечения, который включает: (1) трансформацию или перенос имплантируемой клетки-хозяина с нуклеиновой кислотой, например вектора, который выражает КЛЛ или активный фрагмент, вариант или их производную; и (2) имплантацию трансформированной клетки-хозяина в млекопитающее. В некоторых вариантах воплощения изобретения, имплантируемая клетка-хозяин извлекается из млекопитающего, временно культивируется, трансформируется или переносится с изолированной нуклеиновой кислотой, кодирующей экзогенную КЛЛ, и снова имплантируется в это же млекопитающее, из которого она была извлечена. Ячейка может быть извлечена из того же сайта, где она была имплантирована, но это не обязательно. Такие варианты воплощения иногда известные как генная терапия ex vivo, могут обеспечить непрерывную поставку полипептидов экзогенной КЛЛ в течение ограниченного периода времени.

В то время как лечебный белок, предусмотренный в настоящем изобретении, может рекомбинировать КЛЛ, предназначенную для введения в исходном виде, предпочтительно вводить лечебный белок как часть фармацевтического состава.

Таким образом, изобретение дополнительно предоставляет фармацевтические составы, включающие птичьи производные гликозилированные лечебные белки или их фармацевтически приемлемые производные вместе с одним или более фармацевтически приемлемыми носителями и, дополнительно, другие лечебные и/или профилактические ингредиенты и способы введения таких фармацевтических составов. Изобретение также предоставляет фармацевтические составы, содержащие производные гликозилированные лечебные белки млекопитающих или их фармацевтически приемлемые производные вместе с одним или более фармацевтически приемлемыми носителями и, дополнительно, другие лечебные и/или профилактические ингредиенты и способы введения таких фармацевтических составов.

Носитель (носители) должен (должны) быть «приемлемым (приемлемыми)» в смысле совместимости с другими ингредиентами состава и не быть вредными для реципиентов. Способы лечения пациента (например, количество вводимого лечебного белка, частота введения и продолжительность лечения) с использованием фармацевтических композиций в соответствии с изобретением могут быть определены, используя стандартные методологии, известные врачам-специалистам в этой области.

Фармацевтические составы включают составы, пригодные для перорального, ректального, назального, топического (в том числе буккального и сублингвального), вагинального или парентерального введения. Фармацевтические составы включают составы, пригодные для введения путем инъекции, включая внутримышечное, подкожное и внутривенное введение. Фармацевтические составы также включают составы для введения путем ингаляции или инсуффляции. Составы могут быть, где соответствует, удобно представлены в виде единиц дискретного дозирования и могут быть приготовлены каким-либо из способов, хорошо известных в области фармации. Способы производства фармацевтических составов обычно включают этап соединения лечебных белков с жидкими носителями или окончательно разделенными твердыми носителями, или с обоими и затем, если необходимо, придания продукту требуемой формы.

Фармацевтические составы, пригодные для перорального введения, могут быть удобно представлены в виде дискретных единиц, таких как капсулы, облатки или таблетки, каждая из которых содержит предварительно определенное количество активного ингредиента в виде: порошка или гранул; раствора; суспензии; или эмульсии. Активный ингредиент также может быть представлен в виде шарика, электуария или пасты. Таблетки и капсулы для перорального введения могут содержать традиционные формообразующие, такие как связующие вещества, наполнители, смазывающие вещества, дезинтегрирующие вещества или смачивающие вещества. Таблетки могут быть покрыты в соответствии со способами, хорошо известными в этой области. Пероральные жидкие препараты могут иметь вид, например, водных или масляных суспензий, растворов, эмульсий, сиропов или эликсиров или могут быть представлены в виде сухого продукта для смешивания с водой или другой пригодной средой перед приемом. Такие жидкие препараты могут содержать традиционные добавки, такие как суспендирующие вещества, эмульгаторы, безводные среды (которые могут включать пищевые масла) или консерванты.

Лечебные белки в соответствии с изобретением могут быть также предназначены для парентерального введения (например, посредством инъекции, например быстрой инъекции или непрерывного вливания) и могут быть представлены в виде дозы в ампулах, предварительно заполненных шприцах, в виде контейнеров для вливаний небольшого объема или упаковок, содержащих множество доз с добавленными консервантами. Лечебные белки могут вводиться посредством, например, подкожных инъекций, внутримышечных инъекций и внутривенных вливаний или инъекций. В одном варианте воплощения экзогенная КЛЛ вводится посредством внутривенного вливания любым пригодным способом. В одном примере экзогенная КЛЛ может вводиться посредством внутривенного вливания через периферийную линию. В другом примере экзогенная КЛЛ может вводиться посредством внутривенного вливания через вставленный периферийно центральный катетер. В другом примере экзогенная КЛЛ может вводиться посредством внутривенного вливания с использованием машины для амбулаторного вливания, подсоединенной к порту сосудистого доступа. В одном варианте воплощения внутривенного вливания лекарственное средство вводится в течение периода времени от 1 до 8 часов, в зависимости от количества лекарственного средства, предназначенного для вливания, и история реакций пациента при предыдущих вливаниях, как определяется врачом-специалистом в этой области. В другом варианте воплощения экзогенная КЛЛ вводится посредством внутривенной инъекции. В другом варианте воплощения экзогенная КЛЛ может вводиться посредством интраперитонеальной инъекции. В еще одном варианте воплощения экзогенная КЛЛ вводится посредством фармацевтически приемлемой капсулы лечебного белка. Например, капсула может представлять собой желатиновую капсулу с энтеросолюбильной оболочкой.

В некоторых вариантах воплощения лечебные белки вводятся посредством вливания, и вливание может осуществляться в течение продленного периода времени, например, от 30 минут до 10 часов. Таким образом, вливание может осуществляться, например, в течение периода времени примерно 1 час, примерно 2 часа, примерно 3 часа, примерно 4 часа или примерно 5 часов. Вливание также может осуществляться при разных скоростях. Так, например, скорость вливания может быть равна от примерно 1 мл в час до примерно 20 мл в час. В некоторых вариантах воплощения скорость вливания равна от примерно 5 мл в час до примерно 10 мл в час. В одном варианте воплощения скорость вливания составляет 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20 мл в час. В одном варианте воплощения скорость вливания равна от 0,1 до 5 мг/кг/ч. В одном варианте воплощения скорость вливания составляет примерно 0,1, примерно 0,2, примерно 0,3, примерно 0,5, примерно 1,0, примерно 1,5, примерно 2,0 или примерно 3 мг/кг/ч.

Лечебные белки могут иметь такие формы, как суспензии, растворы или эмульсии в масляных или водных средах, и могут содержать такие формообразующие средства, как суспендирующие, стабилизирующие и/или диспергирующие вещества. Лечебные белки могут применяться в виде порошка, полученного путем асептического выделения стерильного твердого вещества или путем лиофилизации из раствора, для смешивания с пригодной средой, например стерильной апирогенной водой, перед использованием.

Для топического введения в эпидермис лечебные белки могут иметь вид мазей, кремов или лосьонов или трансдермального пластыря. Мази и кремы могут, например, иметь водную или масляную основу с добавлением пригодных загустителей и/или гелеобразующих веществ. Лосьоны могут иметь водную или масляную основу и, как правило, также содержат один или более эмульгаторов, стабилизаторов, диспергаторов, суспендирующих агентов, загустителей или красителей.

Составы, пригодные для топического введения во рту, включают таблетки, содержащие активный ингредиент с ароматной основой, обычно сахарозой и акацией или трагакантом; пастилки, содержащие активный ингредиент с инертной основой, такой как желатин и глицерин или сахароза и акация; и жидкость для полоскания рта, содержащую активный ингредиент с пригодным жидким носителем. Фармацевтические составы, пригодные для ректального введения, где носителем является твердое вещество, наиболее предпочтительно имеют вид суппозиториев с единичной дозой. Пригодные носители включают масло какао и другие продукты, обычно используемые в этой области, и суппозитории должны легко производиться из смеси активного состава с размягченным или расплавленным носителем (носителями) с последующим охлаждением и формованием в формах.

Составы, пригодные для вагинального введения, могут быть представлены в виде пессариев, тампонов, кремов, гелей, паст, пен или спреев, содержащих добавку к активному ингредиенту, носителей, известных в соответствующей области.

Для интраназального введения лечебные белки в соответствии с изобретением могут использоваться в виде жидкого спрея или дисперсного порошка или в виде капель.

Капли могут формироваться из водной или неводной основы, также включающей одно или более диспергирующих веществ, растворяющих веществ или суспендирующих веществ. Жидкие спреи подаются с баллонов под давлением.

Для ингаляционного введения лечебные белки в соответствии с изобретением могут просто доставляться с инсуффлятора, распылителя или баллона под давлением или других подходящих средств подачи аэрозоля. Баллоны под давлением могут включать соответствующий газ-вытеснитель, такой как дихлордифторметан, трихлорфторметан, дихлортетрафторэтан, диоксид углерода или другой пригодный газ. В случае использования аэрозоля под давлением единица дозы может задаваться посредством применения клапана для подачи необходимого количества.

Для ингаляционного или инсуффляционного введения, лечебные белки в соответствии с изобретением могут иметь вид сухой порошковой композиции, например порошковой смеси состава и соответствующей порошковой основы, такой как лактоза или крахмал. Порошковая композиция может быть представлена в виде единичных доз, например, капсул или картриджей, или, например, желатиновых или блистерных упаковок, из которых порошок может быть введен с помощью ингалятора или инсуффлятора. Когда требуется, описанные выше составы, предназначенные для непрерывного высвобождения активного ингредиента, могут использоваться.

Фармацевтические композиции в соответствии с изобретением могут также содержать другие активные ингредиенты, такие как антимикробные средства или консерванты.

В некоторых вариантах воплощения концентрация экзогенной КЛЛ в фармацевтической композиции равна от примерно 0,5 до примерно 10 мг/мл. В некоторых вариантах воплощения концентрация КЛЛ равна от примерно 1 до примерно 5 мг/мл. В некоторых вариантах воплощения концентрация КЛЛ равна примерно 1, примерно 1,5, примерно 2, примерно 2,5, примерно 3, примерно 3,5, примерно 4, примерно 4,5, примерно 5, примерно 5,5, примерно 6, примерно 6,5 или примерно 7,5 мг/мл.

В некоторых вариантах воплощения фармацевтическая композиция, включающая экзогенную КЛЛ, дополнительно содержит буфер. Типичные буферы включают ацетатные, фосфатные, цитратные и глутаматные буферы. Типичные буферы также включают цитрат лития, цитрат натрия, цитрат калия, цитрат кальция, лактат лития, лактат натрия, лактат калия, лактат кальция, фосфат лития, фосфат натрия, фосфат калия, фосфат кальция, малеат лития, малеат натрия, малеат калия, малеат кальция, тартрат лития, тартрат натрия, тартрат калия, тартрат кальция, сукцинат лития, сукцинат натрия, сукцинат калия, сукцинат кальция, ацетат лития, ацетат натрия, ацетат калия, ацетат кальция и их смеси. В некоторых вариантах воплощения буфер представляет собой дигидрат тринатрийцитрата. В некоторых вариантах воплощения буфер представляет собой моногидрат лимонной кислоты. В некоторых вариантах воплощения фармацевтическая композиция содержит дигидрат тринатрийцитрата и моногидрат лимонной кислоты.

В некоторых вариантах воплощения фармацевтическая композиция, включающая экзогенную КЛЛ, дополнительно содержит стабилизатор. Типичные стабилизаторы включают альбумин, трегалозу, сахара, аминокислоты, полиолы, циклодекстрин, соли, такие как хлорид натрия, хлорид магния и хлорид кальция, лиопротекторы и их смеси. В некоторых вариантах воплощения фармацевтическая композиция включает сывороточный альбумин человека.

В конкретном примере рекомбинантная КЛЛ человека, произведенная в соответствии с описанием в данной заявке, применяется в фармацевтическом составе, где каждый 1 миллилитр содержит экзогенную КЛЛ (например, 2 мг КЛЛ), дигидрат тринатрийцитрата (например, 13,7 мг), моногидрат лимонной кислоты (например, 1,57 мг) и сывороточный альбумин человека (например, 10 мг) и приводится к кислотному числу рН, равному 5,9±0,1. Настоящее изобретение рассматривает любой способ введения, который облегчает ввод экзогенной КЛЛ в лизосомы соответствующих органов или тканей.

ПРИМЕРЫ

Следующие конкретные примеры предназначены для иллюстрации изобретения и не должны рассматриваться как ограничивающие объем формулы изобретения.

Пример 1

Лечение дефицита КЛЛ с ранним началом (болезнь Вольмана) посредством введения рекомбинантной КЛЛ.

Мальчик в 15-недельном возрасте был направлен в больницу в связи с низким увеличением веса со дня рождения (вес при рождении 3,88 кг). Больной поступил с рвотой, проблемами питания, с плохим состоянием питания, диареей, повышенным вздутием живота и анемией. Поставленный диагноз - болезнь Вольмана.

При первоначальном физическом обследовании вес пациента составлял 5,62 кг, что соответствовало 5% по шкале зависимости веса от возраста. В течение следующих 4 недель после первоначального обследования в 15-недельном возрасте и перед первоначальным вливанием в 19-недельном возрасте вес пациента не увеличивался. Оценочная скорость роста составляла менее 1 процента по шкале зависимости веса от возраста. Живот был заметно вздут вследствие значительной гепатомегалии и спленомегалии. Ультразвуковое обследование и КТ-сканирование подтвердили гепатоспленомегалию и двухстороннее симметричное увеличение надпочечных желез с кальцификацией. Уровень сывороточной аланинаминотрансферазы (АЛТ) составлял 119 Е/л (нормальный уровень - 10-50 Е/л), а уровень сывороточной аспартатаминотрансферазы (ACT) - 216 Е/л) (нормальный уровень - 10-45 Е/л). Перед началом лечения количество сывороточного ферритина, являющегося показателем воспаления, составляло приблизительно 1500 мкг/л (нормальный уровень - 7-144 мкг/л). Перед началом лечения наблюдалось устойчивое малокровие при уровне гемоглобина от 7,2 до 8,3 г/дл.

В 19-недельном возрасте были начаты еженедельные внутривенные вливания rhLAL (SBC-102) с начальной дозой 0,2 мг/кг. Было проведена предварительная подготовка пациента с введением 1 мг/кг дифенгидрамина приблизительно за 90 минут перед вливанием SBC-102 для предотвращения возможных реакций на вливание. Продолжительность вливания составляла приблизительно 4 часа. Вливания были правильно рассчитаны, и у пациента отсутствовали какие-либо нежелательные явления или соответствующие реакции.

Второе вливание было проведено пациенту через семь дней после первого вливания. Пациенту была введена доза, равная 0,3 мг/кг SBC-102, в течение приблизительно 4 часов без появления признаков нежелательных явлений.

В течение двух недель после начала лечения у пациента наблюдалось заметное улучшение общего самочувствия, включая повышение живости и восприимчивости. Диарея и рвота были стабилизированы. Пациент начал набирать вес и показал заметное снижение количества сывороточных трансаминаз (например, ACT и АЛТ) в основном до нормальных уровней (Фигуры 1А и 1В). Скорость роста пациента быстро нормализовалась (Фигуры 3 и 4). Вздутие живота уменьшилось соответственно снижению размера живота. Тесты функции печени показали постоянные улучшения (Фигуры 1А и 1В).

При третьем визите пациент получил дозу SBC-102 0,5 мг/кг. Вливания выполнялись без нежелательных явлений. Клиническое состояние показывало непрерывное улучшение с увеличением веса на 150 г через 7 дней и увеличением окружности плеча на 1,5 см после начала лечения (Фигуры 3 и 4). Тесты печени были стабильные, уровень гемоглобина повысился (10-11 г/дл), и уровень ферритина продолжал снижаться (Фигура 2). Уровень щелочной фосфатазы перед началом лечения был нормальный и составлял 137 Е/л (нормальный уровень - 110-300 Е/л) и повысился при лечении (204 Е/л). Этот эффект введения SBC-102 был устойчивый и подтверждался наблюдениями для доклинической модели болезни.

Начиная с четвертого вливания, пациент начал получать еженедельную дозу 1,0 мг/кг. Через два месяца после начала лечения процесс роста пациента в основном улучшился при оценочной скорости роста около 95%. Это улучшение роста привело к увеличению веса на 1,25 кг или 2,79 фунтов через 63 дня при весе 7,21 кг, что соответствовало 30% по шкале зависимости веса от возраста (Фигуры 3 и 4). Уровни ACT и АЛТ быстро снизились после первого вливания.

Через три месяца лечения уровни ACT и АЛТ стали нормальными. В дополнение к улучшению функции печени наблюдалось заметное снижение уровня ферритина (Фигура 2).

После 4-месячного курса лечения симптомы в желудочно-кишечной системе пациента уже не проявлялись и состояние питания пациента было отличным. Пациент продолжал набирать вес (Фигуры 3 и 4) и демонстрировал физические признаки нормального здорового ребенка. Пациент продолжал нормально переносить вливания без каких-либо реакций или побочных эффектов. Пациент получил 21-ю дозу, равную 1,0, мг/кг в качестве амбулаторного пациента.

Пример 2

Дизайн клинического исследования дефицита КЛЛ с ранним началом SBC-102, рекомбинантная КЛЛ, произведенная в трансгенном петухе, вводится посредством еженедельного внутривенного вливания. Исследование предназначено для оценки безопасности, переносимости и эффективности двух режимов дозирования SBC-102 при еженедельном внутривенном вливании. При этом основные выходные переменные в этом исследовании определяют безопасность и переносимость SBC-102 детьми с нарушениями роста вследствие дефицита КЛЛ и включают: основные признаки состояния и результаты физического обследования; клинические лабораторные тесты; тесты на антитела к лекарству и использование соответствующих медикаментов. Учитывая, что нарушение роста у детей является универсальным клиническим признаком дефицита КЛЛ/фенотипа Вольмана, успешное лечение этой болезни должно повлиять на нарушение роста, наблюдаемого у детей, страдающих дефицитом КЛЛ. Параметры, относящиеся непосредственно к росту ребенка и питательному состоянию, оцениваются как вторичные или диагностические цели: например, скорость инкрементального роста, относящегося к весу; увеличение веса; и скорость линейного роста. Это исследование также изучает воздействия SBC-102 на фармакодинамические биомаркеры; размер печени и селезенки, лимфаденопатию; гемоглобин и тромбоциты; лабораторные оценки функции печени и питания; размер живота, средневерхняя окружность плеча; и окружность головы. Это исследование также описывает предварительную фармакокинетику SBC-102 у детей с нарушением роста вследствие дефицита КЛЛ, включая значение Cmax для плазмы и оценочный клиренс.

Таблица 1
График оценок: наблюдение в течение 24 недель
Оценки Нач.диагноз Нед. 1 Нед.2 Нед.3 Нед.4 Нед. 6 Нед.8 Нед. 10 Нед. 12 Нед. 14 Нед. 16 Нед. 18 Нед. 20 Нед. 22 Нед. 24
Предв. вливание ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня ±2 дня
Информированное согласие Х
Включение / исключение Х
История болезни Х
Образец для молекулярногенетического анализа
Способ "сухой капли"
Лечебно- Х Х Х
оздоровительная
ЭКГ в 12 отведениях Х Xp
Физическое обследование2 Х Xp Xp
Гест на беременность3 Х Xp Xp Xp Xp Xp
Клиническая лаборатория Х Xp Xp Xp
Печень, липид Х Xp Xp Xp Xp
Острая фаза Х Xp Xp Xp Xp
Анти SBC-102 Х Xp Xp Xp Xp Xp Xp
Сбор биомаркеров сыворотки и мочи Х Xp Xp Xp Xp Xp Xp
MRI/MRS 6 живота Х X
Основные признаки7 Х Х Х X X X X X X9 X X X X X
Вливание SBC-102 Х Х Х X X X X X X10 X X X X X
Нежелательные явления Непрерывно
Соответствующие медикаменты/лечения Непрерывно
р Предварительное вливание.
1Качество жизни, обусловленное состоянием здоровья в соответствии с возрастом.
2Физическое обследование будет включать измерение веса (рост только при осмотре), оценка размера печени и селезенки, лимфаденопатии и артериальной болезни.

Субъекты регистрируются в двух последовательных группах одинакового размера (4 субъекта в каждой группе). Дозирование меняется в пределах каждой группы и между группами, начиная с введения дозы первому субъекту в группе с более низкими дозами (Группа 1; начальная доза 0,35 мг·кг-1). Введение доз дополнительным субъектам в Группе 1 и начало введения доз в группе с более высокими дозами (Группа 2; начальная доза 1 мг·кг-1) основано на приемлемой безопасности и переносимости предыдущими субъектами.

Группа 1

Первые четыре субъекта, зарегистрированные в исследовании, составляют Группу 1. Первый субъект в группе получает одноразовую дозу 0,35 мг·кг-1 SBC-102 и, если утверждается продолжение введения доз на основе анализа безопасности в течение, по меньшей мере, 24 часов после введения дозы, получает вторую дозу 0,35 мг·кг-1 SBC-102 через одну неделю. После введения субъекту второй дозы SBC-102 все доступные данные, относящиеся к безопасности, анализируются и принимается решение относительно приемлемости, т.е. возможности, повышения дозы для первого субъекта до 1 мг·кг-1 и начала введения дозы другим субъектам в Группе 1. Введение доз трем другим субъектам из Группы 1 осуществляется подобным образом. Если анализ безопасности не гарантирует безопасности повышения дозы, вводимой субъекту, с 0,35 мг·кг-1 до 1 мг·кг-1, но показывает безопасность продолжения лечения субъекта при введении начальной дозы, субъект может продолжать получать дозу 0,35 мг·кг-1. Если какой-либо субъект в Группе 1 проявляет субоптимальную реакцию на лечение после получения, по меньшей мере, 4 доз по 1 мг·кг-1 SBC-102, рассматривается дополнительное повышение дозы до 3 мг·кг-1.

Группа 2

Начало введения доз в Группе 2 осуществляется после полной регистрации Группы 1 и анализа безопасности для, по меньшей мере, 2 субъектов, которые получили 2 или более доз по 1 мг·кг-1 SBC-102 в Группе 1. Остальные 4 субъекта вовлекаются в исследование и регистрируются и получают дозы в Группе 2. Первый субъект в этой группе получает одноразовую дозу 1 мг·кг-1 SBC-102 и, если утверждается продолжение введения доз на основе анализа безопасности в течение, по меньшей мере, 24 часов после введения дозы, получает вторую дозу 1 мг·кг-1 SBC-102 через одну неделю. После введения субъекту второй дозы SBC-102 все доступные данные, относящиеся к безопасности, анализируются и принимается решение относительно приемлемости, т.е. возможности, повышения дозы для первого субъекта до 3 мг·кг-1 и начала введения дозы другим субъектам в Группе 2. Введение доз трем другим субъектам из Группы 2 осуществляется подобным образом, с анализом безопасности. Если анализ безопасности не гарантирует безопасность повышения дозы, вводимой субъекту, с 1 мг·кг-1 до 3 мг·кг-1, но показывает безопасность продолжения лечения субъекта при введении начальной дозы, субъект может продолжать получать дозу 1 мг·кг-1. Если начальная доза 1 мг·кг-1 не переносится хорошо субъектом, может рассматриваться введение пониженной дозы 0,35 мг·кг-1.

Исследование состоит из приблизительно 22 визитов в соответствии с графиком: Визит 1 (осмотр), Визит 2 (базисная оценка, начало использования исследуемого лекарственного средства) по Визит 21 (еженедельное введение исследуемого лекарственного средства), Визит 22 (окончание завершенного исследования). Учитывая сложность и жизненную важность лечения нарушения роста с ранним началом вследствие дефицита КЛЛ, вероятно, что эти субъекты будут госпитализированы.

Для исследований будут привлекаться мальчики и девочки с нарушением роста вследствие дефицита КЛЛ. Субъекты могут участвовать в исследованиях при выполнении следующих критериев: (1) родитель или юридический опекун понимает полностью природу и цель исследования, включая возможные риски и побочные эффекты, и дает информированное согласие/разрешение до начала выполнения каких-либо исследовательских процедур; (2) мальчик или девочка с пониженной активностью КЛЛ относительно нормального уровня, подтвержденной документально лабораторией, выполняющей анализ, или документированными результатами молекулярно-генетического исследования, подтверждающего диагноз дефицита КЛЛ; и (3) нарушение роста с ранним началом при возрасте меньше 6 месяцев.

Безопасность

Основные пункты безопасности включают возникновение нежелательных явлений (НЯ) и реакций, относящихся к вливанию (РОВ);

отклонения от базиса основных признаков (кровяное давление, частота сердечных сокращений, интенсивность дыхания, температура), результаты физического осмотра и клинические лабораторные тесты (клинический анализ крови/гематология, сывороточная химия и анализ мочи); использование соответствующих медикаментов/лечений; и характеристика антител к SBC-102 (АДА), включая показатель конверсии сыворотки, время до конверсии сыворотки, титр АДА среднего и пикового иммуноглобулина G (IgG) и время до титра АДА пикового IgG.

Эффективность

Основные пункты эффективности включают: (1) отклонение и/или относительное отклонение от базиса размера печени и селезенки (посредством ультразвукового исследования) и объема печени и селезенки и содержания жиров (посредством магниторезонансного изображения [МРИ]); и (2) отклонение от базиса трансаминазы сыворотки, липидов сыворотки (общий холестерин, триглицериды, липопротеин высокой плотности [ЛВП]) и липопротеин низкой плотности [ЛНП]), уровень гемоглобина и тромбоцитов. Параметры роста, включая отклонение от базиса в процентах и z-баллах, также оцениваются для субъектов моложе 18-летнего возраста. Эти параметры роста основаны на картах роста Центров контроля болезни (ЦКБ) и включают карты зависимости веса от возраста (ВВ), веса от роста (ВР), роста от возраста (РВ) и окружности головы от возраста (ОГВ) у субъектов, чей возраст меньше 30 месяцев, и ВВ, телосложения от возраста (ТВ; отношение телосложения к росту) и веса от телосложения (ВТ) у субъектов, чей возраст превышает или равен 36 месяцам и до 18-летнего возраста, а также при соответствующем росте индикаторы пониженного веса, истощения и низкорослости у всех субъектов.

Пример 3

Физические оценки пациентов с дефицитом КЛЛ с ранним началом

Пациенты, клинически достаточно стабильные для того, чтобы перенести общую анестезию, должны рассматриваться с точки зрения возможности использования центрального катетера для долговременного доступа к сосудистой системе. У субъектов, подвергаемых общей анестезии и/или воздействию седативных средств для других процедур, рассматривается базисное магниторезонансное изображение (МРИ) брюшной полости. В случае новых процедур, требующих общей анестезии и/или воздействия седативных средств, рассматривается контрольное МРИ, если прошло не менее трех месяцев после первого вливания. Измеряются антропометрические характеристики (вес, рост, окружность живота, средневерхняя окружность плеча и окружность головы). Выполняется общее физическое обследование. Проводится полное физическое обследование. Обследование включает оценку общего вида субъекта, кожи, головы, глаз, ушей, носа и горла, сердца, легких, живота, конечностей/суставов и неврологического состояния. Каждое физическое обследование также включает следующее:

Размер печени: выполняется клиническая оценка размера печени (прощупываемая/непрощупываемая и сантиметры ниже реберного края), правильность (гладкая/узловатая) и чувствительность (болезненная/не болезненная).

Размер селезенки: выполняется клиническая оценка размера селезенки (прощупываемая/непрощупываемая и сантиметры ниже реберного края), правильность (гладкая/узловатая) и чувствительность (болезненная/не болезненная).

Лимфаденопатия: выполняется оценка размера, расположения и характера всех прощупываемых лимфатических узлов. Предназначенные для обследования зоны включают: головная (затылочная, расположенная впереди ушной раковины, расположенная за ушной раковиной, подподбородочная, подчелюстная), шейная, ключичная, подмышечная и ингвинальная. Все увеличенные узлы характеризуются как болезненные и не болезненные.

Фотография: выполняется цифровое изображение субъекта в положении лежа на спине (полный рост и увеличенное изображение живота).

Ультразвуковое обследование и МРИ печени/селезенки

Ультразвуковая эхография брюшной полости может выполняться для измерения размера печени и селезенки. МРИ брюшной полости может обеспечить лучшее количественное определение объема печени и селезенки и может рассматриваться при базисе и при визите через, по меньшей мере, 3 месяца после первого вливания.

Основные признаки

Основные признаки включают частоту пульса, интенсивность дыхания, систолическое и диастолическое артериальное давление, и центральную температуру тела (ректально или орально). Оценка частоты пульса и кровяного давления выполняется после положения субъекта лежа на спине. Основные признаки измеряются при всех визитах во время исследования. В дни введения доз основные признаки записываются перед вливанием, каждые 15 минут (±10) во время вливания и в течение 2 часов после вливания, и затем каждые 30 минут (±15) в период времени с 2 до 4 часов после завершения вливания.

Пример 4

Лабораторные оценки

Следующие лабораторные оценки выполняются в виде диагностических тестов и для определения эффективности:

1) Общий анализ крови/гематология: уровень лейкоцитов в крови, уровень эритроцитов в крови, гемоглобин, гематокрит, средний клеточный объем (СКО), средний эритроцитарный гемоглобин (СЭГ), среднеклеточная концентрация гемоглобина (СККГ), уровень бляшек, нейтрофил, лимфоциты, моноциты, эозинофилы, базофилы, мазок периферической крови для исследования клеточной морфологии.

2) Биохимический анализ крови: глюкоза, азот мочевины крови, креатинин, натрий, калий, хлорид, кальций (общий и ионизированный), магний, неорганический фосфор, общий белок, лактатдегидрогеназа.

3) Тесты функции печени: ACT/сывороточная аспартатаминотрансфераза (САСТ), АЛТ/сывороточная аланинаминотрансфераза (САЛТ), щелочная фосфатаза, гаммаглутаминтрансфераза (ГГТ), альбумин, билирубин (прямой, общий)

4) Антитела к лекарственному препарату: антитела к SBC-102

5) Анализ мочи: рН, глюкоза, кетоны, кровь, белок, нитрит

6) Исследование коагуляции: лейкоциты (может быть выполнено микроскопическое исследование, если наблюдаются отклонения от нормы для крови, нитрита и/или лейкоцитов)

7) Лабораторная оценка питания: альфа-токоферол сыворотки:

коэффициент холестерина, 25 ОН витамин D, сывороточный ретинол, дидегидроретинол, транстиретин, ферритин сыворотки

8) Липидограмма: общий холестерин, триглицерид, ЛВП, ЛНП

9) Генетический профиль

Последовательности ДНК, включая последовательность кодирования белка и последовательности, регулирующие транскрипцию гена, стабильность информационной рибонуклеиновой кислоты (иРНК) и эффективность трансляции белка, которые могут быть идентифицированы, включают:

1. Кислую лизосомную липазу (ген ЛИПА)

2. Кодирование генов для других белков, участвующих в липидной биологии, которые могут внести свой вклад и/или модифицировать фенотип дефицита КЛЛ, например АВСА1

3. Гены, которые могут модифицировать восприимчивость к какому-либо SBC-102

10) Фармакокинетическая оценка

Для снижения риска ятрогенной анемии ФК выборка может быть ограничена. В порядке важности, образцы собираются для определения следующих параметров: 1) Cmax и 2) оценка смертельной концентрации (СК). Собираются образцы для измерения уровней сыворотки SBC-102 в день О (доза 1) и день 105 (доза 16). У всех субъектов образцы берутся до введения дозы (в течение 30 минут введения дозы); через 90(±5) минут после начала вливания; и через 110(±5) минут после начала вливания. Все ФК образцы в моменты времени, совпадающие с оценкой основных признаков, должны браться до надувания манжеты для оценки кровяного давления (КД) на руке, где вливание не выполняется. ФК образцы в другие моменты времени берутся, по меньшей мере, через 5 минут после сдувания манжеты.

Пример 5

Подготовка дозы и вливание

SBC-102 предоставляется в стеклянных пробирках с одноразовой дозой 10 мл в виде прозрачной жидкости. Раствор (всего 10,5 мл, включая 5% переполнения) имеет концентрацию 2 мг·мл-1. Все пробирки с SBC-102 хранились при контролируемой температуре 2-8°С. Пробирки замораживаются и защищаются от воздействия света при хранении. Шприц, содержащий препарат SBC-102, разбавленный в 0,9% соляном растворе, был подготовлен непосредственно перед вливанием. После подготовки шприца с SBC-102 разбавленный раствор был маркирован и использован в течение 4 часов после приготовления.

Вес пациента, записанный перед введением дозы утром в день вливания и округленный до 0,1 кг, был использован для вычисления объема SBC-102 для каждого вливания. Общий объем вливаний, используемый при исследовании, основывается на режиме введения доз, показанном в Таблице 2.

Таблица 2
Доза Объем вливания
0,35 мг/кг 10 мл
1 мг/кг 10 мл
3 мг/кг 20 мл

Приготовление и введение дозы должны выполняться с использованием стерильных апирогенных одноразовых материалов, включая, но не ограничиваясь этим, шприцы, иглы, переходные трубки и бюретки с краном.

Скорость вливания должна устанавливаться на регуляторе потока таким образом, чтобы ввести весь объем в течение приблизительно 120 минут, как показано в Таблице 3.

Таблица 3
Доза Расход в час Расход в минуту Расход на килограмм в час
0,35 мг/кг 5 мл 0,083 мл 0,175 мг/кг/ч
1 мг/кг 5 мл 0,083 мл 0,5 мг/кг/ч
3 мг/кг 10 мл 0,167 мл 1,5 мг/кг/ч

Пример 6

Нежелательные явления (НЯ)

В случае наблюдения у субъектов НЯ или реакций, относящихся к вливанию (РОВ) с клинически значительными сердечнососудистыми, респираторными или другими эффектами, вливание должно быть прекращено и субъект должен получить лечение для устранения анафилкатической реакции в соответствии с руководством по управлению серьезными реакциями при вливании у детей, чей возраст меньше 2 лет. Лечение может включать внутривенное введение антистаминов, кортикостероидов и эпинефрина, если необходимо. Для родственных биологических продуктов большинство задержанных РОВ проявляется позднее чем через 24 часа после вливания. Симптомы включают артралгию, миалгию, симптомы, похожие на симптомы при гриппе, головную боль, усталость и раздражение или крапивницу. Задержанные реакции могут лечиться анальгетиками или антигистаминами в соответствии с клиническими показаниями. РОВ классифицируются или как острые (проявляющиеся в течение 24 часов после начала вливания), или как задержанные (проявляющиеся в течение от 1 до 6 дней после вливания). Медикаменты и оборудование для лечения реакций гиперчувствительности должны быть готовы для немедленного использования в случае неожиданных неблагоприятных реакций гиперчувствительности. Эти средства включают, но не ограничиваются этим, кислород, ацетаминофен, антигистамины (например, дифенгидрамин, парентеральные и пероральные препараты), кортикостероиды, эпинефрин и аппараты восстановления сердечной деятельности и дыхания. В подобных биологических продуктах наиболее острые РОВ проявляются в течение 24 часов вливания (Инструкция по медицинскому применению препарата Cerezyme®, VPRIV®, Fabrazyme®). Признаки возможной острой РОВ могут классифицироваться следующим образом: гиперемия, прилив крови, жар и/или озноб, тошнота, зуд, крапивница, желудочно-кишечные симптомы (рвота, диарея, спазмы в животе). Слабые реакции определяются как самоограничивающиеся, самопроизвольно исчезающие реакции после временного завершения или снижения скорости вливания. Средние реакции определяются как неустранимые простыми мерами и требуют расширенного наблюдения и приостановки лечения. Серьезные реакции влекут за собой боль в груди, одышку, хрипы, стридор гипотонию или гипертонию, остановку дыхания, апноэ одышку, брадикардию или тахикардию. Если какой-либо из описанных выше признаков или симптомов наблюдается во время вливания, и субъект остается гемодинамически стабильным, скорость вливания может быть уменьшена (снижение до половины скорости, используемой в начале реакции, например, с 10 мл·ч-1 до 5 мл·ч-1), а время вливания увеличено. После устранения реакции вливание должно продолжаться не менее 30 минут при пониженной скорости перед повышением скорости до 75% от первоначальной скорости вливания. Если субъект продолжает проявлять признаки гиперчувствительности, доза антигистамина может быть введена внутримышечно или медленно внутривенно в соответствии с руководством по управлению серьезными реакциями при вливании у детей, чей возраст меньше 2 лет.

Пример 7

Введение рекомбинантной КЛЛ пациенту-человеку с дефицитом КЛЛ с поздним началом

Основной целью исследования является оценка безопасности и переносимости SBC-102 у пациентов с дисфункцией печени вследствие дефицита КЛЛ с поздним началом (основные признаки, физическое обследование, клинические лабораторные тесты, тесты на иммуногенность, оценка неблагоприятных явлений, соответствующие лечения). Вторичной целью является характеристика фармакинетики SBC- 102, доставленного посредством внутривенного вливания, после введения одинарных и множественных доз (перед и после вливания, день 0 и 21). Критерии включения в состав субъектов с дефицитом КЛЛ с поздним началом следующие.

1. Пациент понимает полностью природу и цель исследования, включая возможные риски и побочные эффекты, и желает и способен соответствовать всем процедурам исследования и предоставляет информированное согласие;

2. Мужчины и женщины в возрасте ≥ 18 и ≤ 65 лет;

3. Пониженная активность КЛЛ, подтвержденная документально лабораторией, выполняющей анализ, или документированными результатами молекулярно-генетического исследования, подтверждающего диагноз дефицита КЛЛ;

4. Доказательство поражения печени на основании клинического представления (гепатомегалия) и/или результатов лабораторных тестов (АЛТ или ACT ≥ 1,5× ВГН (верхняя граница нормы);

5. При приеме статина или эзетимиба пациент должен принимать стабильную дозу, по меньшей мере, 4 недели до обследования;

6. Все женщины должны иметь отрицательный результат сывороточного теста на беременность при обследовании и не могут кормить грудью; и

7. Женщины с репродуктивным потенциалом должны согласиться принимать высокоэффективные и утвержденные контрацептивные способы на протяжении всего исследования и в течение 30 дней после введения последней дозы.

Клинические оценки включают физическое обследование, анализ мочи, клинический биохимический анализ крови, КАК/гематологию, агенты острой фазы, изучение коагуляции, ЭКГ в 12 отведениях, антитела к SBC-102 и ФК для управления Cmax, AUCinf, T1/2, Cl и Vss.

Пациентам вводятся дозы 0,35 мг·кг-1, 1 мг·кг-1 или 3 мг·кг-1 КЛЛ еженедельно посредством внутривенного вливания в течение 2 часов. Первому субъекту вводятся дозы, и он контролируется на переносимость в течение, по меньшей мере, 24 часов перед введением доз другим субъектам группы. Каждый субъект остается стационарным пациентом на протяжении 24 часов после первого вливания SBC-102. Субъектам продолжают вводиться дополнительные 3 дозы SBC-102 еженедельно внутривенно при условии, что переносимость и безопасность остаются приемлемыми.

Фармакокинетика

ФК данные анализируются у всех субъектов, включенных в исследование, получающих, по меньшей мере, одну дозу исследуемого препарата, исключая все данные, на которые могло подействовать отклонение от основного протокола. ФК анализы выполняются с использованием одной модели вливания. Следующие ФК параметры определяются и представляются группой (Cmax, AUCinf, Т1/2, Cl и Vss) - ФК параметры одинарной и множественной дозы сравниваются с использованием данных Визита 2 и Визита 6.

Предлагаемое увеличение дозы в этом исследовании может быть 3, 4, 5 или 6-кратное, что может позволить оценивать начальную безопасность, переносимость и фармакокинетические параметры у людей в 6-кратном диапазоне доз на базе единицы измерения мг·кг-1. В соответствующей доклинической модели с использованием крысы, фармакодинамические эффекты при введении дозы 1 мг·кг-1 1 раз еженедельно, 3 мг·кг-1 каждую вторую неделю и 5 мг·кг-1 один раз еженедельно сравнимы. Таким образом, хотя не предполагается, что дозы выше 3 мг·кг-1 один раз еженедельно потребуются, доза выше 3 мг·кг-1, такая как 4, 5, 6, 7, 8, 9 или 10 мг·кг-1 может рассматриваться в зависимости от тяжести болезни.

Дизайн исследований

При условии редкости пациентов с таким состоянием окончательное количество для этого исследования составляет 9 оцениваемых субъектов. Субъекты включаются в три последовательные группы по 3 субъекта в каждой группе. Субъекты, входящие в группу 1, получают дозы первыми, после них - субъекты группы 2, а затем - группы 3.

Таблица 4
График исследования дефицита КЛЛ с поздним началом: визиты, оценка и интервалы
Оценки Предв. печение Активная фаза Постактивная фаза
Визит 1 Визит 2 Визит 3 Визит 4 ГС Визит 5 ГС Визит 6 ГС Визит 7 Визит 7.1 Визит 8
(День - (День (День (День (День (День (День (День (День (День (День (День
28-7) 0) 1) 7±1) 8) 14±1) 15) 21±1) 22) 28±1) 35±1) 52±1)
Сформированное согласие X
Критерии включения / исключения X X
Демографическая информация X
Результаты обследования здоровья пациента X
История болезни1 X
ЭКГ в 12 отведениях X Х
Физическое обследование X X Х Xp Х
Основные показатели3 X Xp X Xp Xp Xp Х X
Анализ мочи X Xp Xp X X X Х X
Тест на беременность4 X Xp Xp X
КАК/Гематология X Xp Xp Xp Xp Xp X X
Биохимический анализ крови X Xp Xp Xp Xp Xp X X
Показатели печени X Xp Xp Xp Xp Xp X Х X
Липидные показатели X Xp X
Реагенты острой фазы X Xp X X
Гесты коагуляции X X
Вирусный гепатит X
Автоиммунный гепатит X
Образец ДНК X
Активность KJIJ МКПК X Xp X
Антитело к SBC-102 (АДА) X Xp X X
Образец X Xp X X X
исследовательского биомаркера
ФК образец5 Х Х
Дозирование SBC-102 Х Х Х Х
Нежелательные явления Х Х Х Х Х Х Х Х Х Х Х Х
Соответствующие лечения Х Х Х Х Х Х Х Х Х Х Х Х
ТС = Вызов по телефону
р Предварительная доза
1 Включая алкогольную историю (анкета AUDIT)
2 Включая рост и вес
3 Предварительная доза, каждые 15 минут во время вливания, каждые 15 минут в течение 2 часов после вливания и каждые 30 минут в период времени с 2 до 4 часов после вливания
4 Сыворотка при визите 1 и визите 8; моча при визите 2 и визите 6
5 Предварительная доза, 10, 15, 20, 40, 60, 90 минут во время вливания, в конце вливания (приблизительно 120 минут) и через 5, 10, 20, 30, 40, 60 и 120 минут после вливания

Группа 1

Три субъекта получают внутривенно дозу 0,35 мг·кг-1 SBC-102. Первый субъект получает дозу и контролируется на переносимость в течение, по меньшей мере, 24 часов перед введением дозы 2 другим субъектам в группе. Каждый субъект остается стационарным пациентом на протяжении 24 часов после первого вливания SBC-102. Субъектам вводится внутривенно 3 дополнительные дозы 0,35 мг·кг-1 при условии приемлемости переносимости и безопасности.

Группа 2

Три субъекта получают внутривенно дозу 1 мг-кг-1 SBC-102. Первый субъект из группы 2 получает дозу и контролируется на переносимость в течение, по меньшей мере, 24 часов перед введением дозы 2 другим субъектам в группе. Каждый субъект остается стационарным пациентом на протяжении 24 часов после первого вливания SBC-102. Субъектам вводится внутривенно 3 дополнительных дозы 1 мг·кг-1 при условии приемлемости переносимости и безопасности.

Группа 3

Три субъекта получают путем внутривенного вливания дозы 3 мг·кг-1 SBC-102. Первый субъект в Группе 3 получает дозу и контролируется на переносимость в течение, по меньшей мере, 24 часов перед введением дозы другим субъектам в группе. Каждый субъект остается стационарным пациентом на протяжении 24 часов после первого вливания SBC-102. Субъектам вводится внутривенно 3 дополнительные дозы 3 мг·кг-1 один раз в неделю при условии приемлемости переносимости и безопасности.

Комитет по безопасности (КБ) может остановить введение доз для всей группы или для отдельного субъекта в любой момент вследствие плохой переносимости или потенциальных рисков.

Если для субъекта прерывается исследовательское лечение во время визита по графику, отличающегося от визита 8 (конец исследования), или во время незапланированного визита, субъект возвращается не ранее чем через 7 дней после последнего введения дозы SBC-102 для завершения исследовательских оценок, проводимых во время визита 8.

SBC-102 вводится посредством внутривенного вливания во время визитов 2, 4, 5 и 6. Соответствующие лечения регистрируются на протяжении всего исследования. Нежелательные явления записываются, начиная с момента подписания информированного согласия.

Каждый субъект получает всего четыре еженедельные дозы SBC-102 при условии, что переносимость и безопасность остаются приемлемыми.

Продолжительность исследования

Исследование включает 4 недели введения доз SBC-102 и период промывки для поддержания оценки безопасности и графика введения доз для последующих клинических исследований. После завершения этого исследования субъекты могут наделяться правом продолжать получать SBC-102 в соответствии с отдельным протоколом для оценки долгосрочной безопасности и эффективности SBC-102 у пациентов с дефицитом КЛЛ/фенотипом БНЭХ.

Физическое обследование

Общее физическое обследование выполняется квалифицированным медицинским специалистом. Данные систем (включая, но не ограничиваясь этим, сердечнососудистую, дыхательную, желудочно-кишечную и неврологическую систему) должны задаваться и регистрироваться. Все отклонения от нормы должны устанавливаться при каждом выполнении обследования. Диагноз новых отклонений от нормы должен записываться в виде нежелательных явлений, если применимо.

Дополнительные оценки физического обследования должны выполняться во время скринингового визита:

а) Размер печени: выполняется клиническая оценка размера печени (прощупываемая/непрощупываемая и сантиметры ниже реберного края), правильность (гладкая/узловатая) и чувствительность (болезненная/не болезненная).

б) Лимфаденопатия: выполняется оценка размера, расположения и характера всех прощупываемых лимфатических узлов. Предназначенные для обследования зоны включают: головная (затылочная, расположенная впереди ушной раковины, расположенная за ушной раковиной, подбородочная, подчелюстная), шейная, ключичная, подмышечная и ингвинальная. Все увеличенные узлы характеризуются как болезненные и не болезненные.

в) Артериальная болезнь: пульс правой и левой задней большеберцовой артерии и тыльной артерии стопы оцениваются клинически и лодыжечно-плечевые индексы (ЛПИ) для правой и левой стороны записываются. ЛПИ определяется как отношение систолического давления в тыльной артерии стопы или в задней большеберцовой артерии к систолическому давлению в правом или левом плече (что выше).

Основные признаки

Измеряются основные признаки, включая частоту пульса, интенсивность дыхания, систолическое и диастолическое артериальное давление и температуру. Оценка частоты пульса и кровяного давления выполняется после того, как субъект находился в лежачем положении, по меньшей мере, 5 минут. В дни введения доз основные признаки записываются перед вливанием, каждые 15 минут (±5) во время вливания и в течение 2 часов после вливания и затем каждые 30 минут (±10) в период времени с 2 до 4 часов после завершения вливания. Дополнительные показания могут использоваться на усмотрение исследователя в случае реакции, относящейся к вливанию (РОВ). Электрокардиограммы (ЭКГ) в 12 отведениях с формальными записями могут быть получены после того, как субъект находился в лежачем положении, по меньшей мере, 5 минут.

Лабораторные оценки

Образцы для лабораторных тестов собираются в моменты времени, указанные в графике оценок. Выполняются следующие лабораторные анализы (кроме СОЭ, исследования коагуляции и антител к SBC-102).

Общий анализ крови/гематология: уровень лейкоцитов в крови, уровень эритроцитов в крови, гемоглобин, гематокрит, средний клеточный объем (СКО), средний эритроцитарный гемоглобин (СЭГ), среднеклеточная концентрация гемоглобина (СККГ), уровень бляшек, нейтрофил, лимфоциты, моноциты, эозинофилы, базофилы.

Биохимический анализ крови: глюкоза, азот мочевины крови, креатинин, натрий, калий, хлорид, кальций, магний, неорганический фосфор, общий белок, лактатдегидрогеназа, мочевая кислота.

Тесты функции печени: ACT/САСТ, АЛТ/САЛТ, щелочная фосфатаза, ГГТ, альбумин, билирубин (прямой, общий)

Липидограмма: общий холестерин, триглицерид, ЛВП, ЛНП

Исследование коагуляции: Международный нормализованный коэффициент (МНК) протромбинового времени (ПВ), активированное парциальное протромбиновое время (аПТВ)

Анализ мочи: глюкоза, кетоны, кровь, рН, белок, нитрит и лейкоциты (может быть выполнено микроскопическое исследование, если наблюдаются отклонения от нормы для крови, нитрита и/или лейкоцитов)

Исследование вирусного гепатита: серология поверхностного антигена гепатита В (HBsAg) и вируса гепатита С (ВГС) (при скрининге или клиническом выявлении во время исследования)

Исследование автоиммунного гепатита: антитело к гладкой мышце (АТГМ), антиядерные антитела (АЯА), антитело к ЛКМИ, антитело к растворимым печеночным антигенам (РПА)

Антитело к лекарственному средству: антитело к SBC-102

Реагенты острой фазы: С-реактивный белок (СРБ) высокой чувствительности, скорость осаждения эритроцитов (СОЭ) и сывороточный ферритин

Тест на беременность: Все женщины должны не реже одного раза в месяц проходить тестирование на беременность. Тесты проводятся с использованием сыворотки во время визита 1 и визита 8 и мочи во время визита 2 и визита 6.

Фармакокинетичекие оценки (ФК): ФК образцы берутся с плеча, противоположного катетеру для вливания. Выполняется интенсивный отбор образцов для измерения уровня сыворотки SBC-102 в день 0 (доза 1, визит 2) и день 21 (доза 4, визит 6): непосредственно перед введением дозы (в течение 30 минут введения дозы); через 10(±1), 15(±1), 20(±1), 40(±2), 60(±2) и 90(±2) минут во время вливания и в конце вливания (приблизительно 120 минут); и через 5(±1), 10(±1), 20(±1), 30(±1), 40(±2), 60(±2) и 120(±2) после завершения вливания.

Приготовление SBC-102

Вес субъекта, записанный во время визита 1, используется для вычисления объема SBC-102 для каждого вливания. Лекарственный продукт SBC-102 для внутривенного вливания приготавливается разбавлением, используя следующие этапы:

1. Пробирки извлекаются из холодильника.

2. Подтверждается, что срок годности, указанный на пробирке, не истек.

3. Определяется вычисленный общий объем SBC-102, требуемый для введения дозы Пример:

Вес субъектов (в кг): 70 кг

Уровень дозы для субъекта: 3 мг·кг-1

Концентрация лекарственного средства: 2,0 мг·мл-1

1. Вычисление дозы для субъекта:

2. Вычисление дозы инъекции:

4. Следующие инфузионные пакеты с 0,9% соляным раствором используются на основании назначения группы дозирования:

Группа Доза (мг·кг-1) Объем инфузионного пакета (мл)
1 0,35 100
2 1
3 3 250

5. Объем, эквивалентный объему SBC-102, требуемому для введения (в соответствии с вычислениями при выполнении этапа 3 выше) извлекается из 100 мл или 250 мл инфузионного пакета с 0,9% соляным раствором (т.е., используя пример выше, 105 мл соляного раствора извлекается из 250 мл инфузионного пакета).

6. Вычисленный общий объем SBC-102 извлекается и передается в инфузионный пакет с 0,9% соляным раствором (т.е., используя пример выше, 105 мл раствора SBC-102 извлекается и передается в инфузионный пакет).

7. Для смешивания пакет осторожно переворачивается.

Введение рекомбинантной КЛЛ

1. Трубка для внутривенного вливания подсоединяется к пакету с разбавленным SBC-102.

2. Трубка заливается, и весь воздух выходит.

3. Регулятор потока вливания устанавливается в положение введения всего объема при следующих скоростях в течение приблизительно 100 минут:

Группа Доза (мг·кг-1) Скорость вливания(в час) Скорость вливания (в минуту)
1 0,35 60 мл 1 мл
2 1
3 3 150 мл 2,5 мл

4. Выбирается участок внутривенного вливания, который меняется субъектом и может включать вены перед локтевым суставом или вены запястья (или центральный венозный катетер).

5. Трубка для внутривенного вливания подсоединяется к ангиокатетеру. Соляной раствор впрыскивается в капельницу для доступа к сосудам и проверки легкого прохождения соляного раствора.

6. Капельница закрепляется лентой.

7. Вливание SBC-102 начинается, при этом используется регулятор скорости потока.

8. Вливание регулярно контролируется.

9. Когда пакет опорожняется, 25 мл 0,9% соляного раствора незамедлительно впрыскивается в инфузионный пакет, используя порт впрыскивания.

10. В капельнице устанавливается такая же скорость вливания (60 мл в час [1 мл в минуту] для дозы 0,35 мг·кг-1 и 1 мг·кг-1 и 150 мл в час [2,5 мл в минуту] для дозы 3 мг·кг-1) до завершения вливания. Окончание вливания определяется, когда вливание и промывка завершается и документируется.

Инфузионные реакции

Реакция, относящаяся к вливанию (РОВ), определяется как любое иммунное нежелательное явление, которое, по меньшей мере, возможно связано с вливанием. РОВ классифицируются как острые (проявляющиеся в течение 24 часов после начала вливания) или задержанные (проявляющиеся в 1-14 день после вливания).

Медикаменты и оборудование для лечения реакций гиперчувствительности должны быть готовы для немедленного использования в случае неожиданных неблагоприятных реакций гиперчувствительности. Эти средства включают, но не ограничиваются этим, кислород, ацетаминофен, антигистамины (например, дифенгидрамин, парентеральные и пероральные препараты), кортикостероиды, эпинефрин (адреналин) и аппараты восстановления сердечной деятельности и дыхания.

Признаки возможной острой РОВ могут классифицироваться следующим образом: гиперемия, прилив крови, жар и/или озноб, тошнота, зуд, крапивница, желудочно-кишечные симптомы (рвота, диарея, спазмы в животе), сердечно-легочные реакции, включая боль в груди, одышку, хрипы, стридор, гипотонию или гипертонию. Если какой-либо из описанных выше признаков или симптомов наблюдается во время вливания и субъект остается гемодинамически стабильным, скорость вливания должна быть уменьшена или вливание должно быть остановлено. Если субъект продолжает проявлять признаки гиперчувствительности, доза антигистамина может быть введена внутримышечно или медленно внутривенно. Субъектам с серьезными инфузионными реакциями с клинически значительными сердечнососудистыми или респираторными эффектами вливание прекращается. При таких анафилактических реакциях субъект может лечиться посредством антигистаминов, кортикостероидов и эпинефрина.

Пример 8

Введение рекомбинантной КЛЛ в организм крысы

Влияние повторяющихся доз рекомбинантной КЛЛ человека на вес, триглицериды и холестерин в ткани, гепатомегалию, спленомегалию, лимфаденопатию, брюшную массу и другие параметры были оценены для крыс Донриу с дефицитом КЛЛ, описанных в Yoshida и Kuriyama (1990) Laboratory Animal Science, том 40, с. 486-489 (см. также Kuriyama и др. (1990) Journal of Lipid Research, том 31, с. 1605-1611; Nakagawa и др., (1995) Journal of Lipid Research, том 36, с. 2212-2218), раскрытие которых включено в данную заявку во всей полноте путем ссылки. В 4-недельном возрасте, крысы Донриу, являющиеся гомозиготными для делеции КЛЛ (КЛЛ -/-), были назначены в группы для введения рекомбинантной КЛЛ человека, произведенной в яйцеводе трансгенной курицы, или для введения доз соляного плацебо. Крысы этого же помета дикого типа были использованы в качестве контрольных. Крысам с КЛЛ -/- вводились дозы один раз в неделю на протяжении четырех недель (всего четыре дозы) или один раз в две недели в течение четырех недель (всего две дозы) посредством инъекций в хвостовую вену в виде одной дозы или двух равных доз с интервалом 30 минут. Дозы рекомбинантной КЛЛ составляли 1 мг/кг или 5 мг/кг. График введения доз показан в Таблице 5. Крысы были подготовлены с использованием дифенгидрамина (5 мг/кг) для предотвращения возможных анафилактических реакций и процедуры, основанной на предыдущем опыте ферментозамещающей терапии у животных для лечения лизосомной болезни накопления (Shull и др. (1994) Proceedings of the National Academy of Science, Tом 91, c.12937; Вiеliсk и др. (1999) The Journal of Biological Chemistry, 274, c.36335; Vogler и др. (1999) Pediatric Research, 45, c.838), раскрытие которых включено в данную заявку во всей полноте путем ссылки.

Фигура 9 иллюстрирует ежедневный прогресс в увеличении веса крыс, которым вводилась доза 1 мг/кг рекомбинантной КЛЛ раз в неделю или 5 мг/кг рекомбинантной КЛЛ один раз в две недели. На фигуре видно небольшое различие или его отсутствие в терапевтическом эффекте между размерами и частотой двух доз.

Таблица 5
График взвешивания и введения доз крысам с дефицитом КЛЛ
Возраст дней Выполненные оценки / инъекции
Взвешенные
День 13
День 14
День 20
День 21 Прекращение кормления молоком
День 24
День 25
День 27
День 28 Первая инъекция для введения один раз в неделю и один раз в две недели
День 31
День 32
День 34
День 35 Вторая инъекция для введения один раз в неделю
День 38 -
День 39
День 41
День 42 Третья инъекция для введения один раз в неделю; вторая инъекция для введения один раз в две недели
День 45
День 48
День 49 Четвертая инъекция для введения один раз в неделю
День 55
День 56 Аутопсия

Пример 9

Патологическое исследование крыс с КЛЛ-/- с рекомбинантной КЛЛ

После прекращения исследования, описанного в Примере 8, животные были усыплены и подвергнуты вскрытию для исследования общей патологии, гистопатологии и клинической биохимии.

Общая аутопсия включала исследование наружной поверхности тела, всех отверстий и черепных, грудных и брюшных полостей и их содержания. Масса внутренних органов и тканей была определена для крыс, и органы и ткани были собраны и помещены в 10% формалин с нейтральным буфером. После фиксации ткани были обработаны и гистологические препараты гематоксилина и окрашенные срезы были приготовлены и оценены.

Общее патологическое исследование животных после лечения показало в основном нормализацию размера печени и цвета, как можно видеть на срезе, показанном на Фигуре 10. Отношения массы органа к массе тела были определены и показали снижение относительного размера органа для печени, селезенки, мезентеральной ткани, двенадцатиперстной кишки, тощей кишки и подвздошной кишки у успешно полностью вылеченных животных при сравнении с крысами, которым вводилось плацебо. Гистопатология ткани печени крыс, которым вводилась рекомбинантная КЛЛ, показала в основном нормальную гистологию печени при заметном контрасте со значительной аккумуляцией пенистых макрофагов у животных, которым вводилось плацебо (Фигура 10).

Пример 10

Интернализация рекомбинантной КЛЛ человека в лизосомы макрофага и фибробласта

Способность рекомбинантной КЛЛ человека, произведенной в трансгенной птице («SBC-102»), связывать ячейки и быть интернализированной в лизосомальный компартмент была исследована in vitro с использованием клеток макрофагов и фибробластов. При культивировании с клетками макрофагов было выявлено, что SBC-102 с флуоресцентной меткой был расположен рядом с лизосомами. Этот эффект может быть ослаблен, используя конкурента полисахарида маннозы, рассматривая рецептор N-ацетилглюкозамина/маннозы как механизм распознавания и поглощения этими клетками. SBC-102 повысил активность КЛЛ, связанную с клетками, в фибробластах человека с дефицитом КЛЛ и нормальных фибробластах крыс после культивирования in vitro, показывая, что воздействие SBC-102 может привести к значительной замене недостаточной ферментативной активности.

Манноза-6-фосфат (М6Р) присутствует в олигосахаридных структурах SBC-102, которые были вовлечены в доставку лизосомных ферментов к клеткам различного типа через убиквитарный рецептор МР6.

Рекомбинантная КЛЛ была очищена от яичного белка трансгенной курицы. Орегон Зеленый НСЗ был получен от Invitrogen™ (#0-10241). Линия альвеолярного макрофага, NR8383, и линия фибробласта мыши, NIH-3T3, были получены от АТСС. Фибробласты Вольмана с дефицитом КЛЛ были получены от Института медицинских исследований Кориэлла, и LysoTracker® Красный был получен от Invitrogen™.

Маркировка ферментов: 4 мг КЛЛ, произведенной в трансгенной птице, в ФСБ были маркированы Орегоном Зеленым, в соответствии с рекомендациями производителя, и реакция затем была диализирована в ФСБР, а затем сконцентрирована.

Поглощение макрофага: КЛЛ с флуоресцентной меткой, произведенная в трансгенной птице (5 мкг/мл), и LysoTracker® Красный культивировались с клетками NR8383 в течение 2 часов. Ячейки были исследованы с помощью софокусной флуоресцентной микроскопии, используя режим последовательного сканирования при длине волны 488 нм, а затем 514 нм.

Конкурентное ингибирование маннаном: SBC-102 с флуоресцентной меткой (5 мкг/мл) и маннан культивировались с клетками NR8383 в течение 2 часов. Клетки были трипсинизированы и поглощение рекомбинантной КЛЛ было измерено посредством сортировки флуоресцентно активированной клетки, используя интенсивность медианного свечения в качестве конечной точки.

Способность КЛЛ, произведенной в трансгенной птице, поглощаться и затем включаться в лизосомы целевых клеток была исследована с использованием клеточной линии макрофага, NR8383. КЛЛ с флуоресцентной меткой, произведенная в трансгенной птице, и лизосомальный маркер, «LysoTracker® Red» (Invitrogen™), были культивированы с клетками в течение 2 часов. Близкое расположение КЛЛ, произведенной в трансгенной птице, и лизосомального маркера в лизосомах этих клеток было затем исследовано посредством софокусной микроскопии, используя режим последовательного сканирования (Фигура 11). Рекомбинантная КЛЛ продемонстрировала близкое расположение к лизосомам, что согласуется с подобной картиной при исследовании в искусственных условиях с использованием рекомбинантной КЛЛ человека с различных источников.

Способность связи КЛЛ, произведенной в трансгенной птице, с рецептором N-ацетилглюкозамина/маннозы была оценена посредством анализов конкурентной связи, используя клеточную линию макрофага, NR8383 (Фигура 12). КЛЛ с флуоресцентной меткой (Орегон Зеленый), произведенная в трансгенной птице (5 мкг/мл), и различные концентрации олигосахарида маннана с содержанием маннозы были культивированы с клетками в течение 2 часов. Относительная ингибиция поглощения КЛЛ, произведенной в трансгенной птице, маннаном при сравнении с продуктом без маннана была определена количественно посредством сортировки флуоресцентно активированной клетки, используя интенсивность медианного свечения в качестве конечной точки. Наблюдалась ингибиция, зависящая от дозы маннозы, связи/поглощения, КЛЛ, произведенной в трансгенной птице, что согласуется с взаимодействием КЛЛ, произведенной в трансгенной птице, с N-ацетилглюкозамином.

В дополнение, поглощение маннозы-6-фосфата в клетках фибробласта было продемонстрировано в конкурентных опытах с маннозой-6-фосфатом.

Пример 11

Повышение активности КЛЛ в клетках, подвергаемых лечению КЛК, катализирует гидролиз эфиров холестерина и триглицеридов до свободного холестерина, глицерина и свободных жирных кислот. Таким образом, активность КЛЛ может быть измерена, например, посредством расщепления флуорогенного субстрата олеата 4-метилумбеллиферила (4МУО).

Фибробласты

Способность воздействия КЛЛ, произведенной в трансгенной птице, на повышение активности КЛЛ была исследована с использованием нормальных клеток и клеток с дефицитом КЛЛ в искусственных условиях. Фибробласты были выделены из пациента с болезнью Вольмана, а нормальные фибробласты крысы (NIH-3T3) культивировались в присутствии КЛЛ, произведенной в трансгенной птице, при концентрациях 0, 0,16 или 0,5 мкг/мл в течение 5 часов. Затем клетки были промыты для удаления побочного сигнала и клеточные лизаты были проанализированы для определения активности КЛЛ, используя субстрат олеата 4-метилумбеллиферила (4МУО). Фигура 13 показывает, что активность эндогенной КЛЛ, ассоциируемая с клетками, была ниже в фибробластах Вольмана по сравнению с NIH-3T3, и зависящие от дозы повышения активности КЛЛ наблюдались в клетках обоих типов после культивирования с КЛЛ, произведенной в трансгенной птице (Фигура 13).

Лейкоциты

Сывороточные мононуклеарные лейкоциты были получены от пациентов с дефицитом КЛЛ перед и после введения. Образцы крови хранились в охлажденном виде без потери ферментной активности. Мононуклеарные лейкоциты (лимфоциты) были выделены из крови, используя препарат из фиколла и диацетат натрия. 4-8 мл крови, предварительно разбавленной 1:1 сбалансированным солевым раствором Хенкса, было осторожно помещено на 3 мл фиколл-пака и центрифугирован. Кольцо мононуклеарной клетки было аспирировано и промыто один раз раствором Хенкса, затем, по меньшей мере, дважды ресуспендированием осадка в 1-2 мл воды. Гранулы были заморожены при -20°С перед использованием. Перед анализом гранулы были разморожены, ресуспендированы в дистиллированной воде и подвегнуты воздействию ультразвука на льду. Препарат затем был центрифугирован при 20000 × g в течение 15 минут при 4°С. Надосадочная жидкость (содержащая 0,5-1,5 мг белка/мл) хранилась на льду до анализа.

Субстрат кислой липазы был приготовлен путем добавления 1 мл 10 мМ 4МУО (олеат 4-метилумбеллиферила) в гексане до 1 мл 16 мМ L-α-фосфатидилхолина в CHCl3. Растворители были выпарены в присутствии N2, и 25 мл 2,4 мМ тауродезоксихолевой кислоты (натриевая соль) в воде было добавлено. Смесь была подвергнута воздействию ультразвука на льду в течение 1-2 минут при 30-40 Вт. Перед анализом 1 объем субстрата был разбавлен 7 объемами 200 мМ буфера - ацетата натрия /уксусной кислоты (рН 4,0). Каждая 2 мл реакционная кювета содержала 100 нмоль олеата 4-метилумбеллиферила, 160 нмоль L-α-фосфатидилхолина и 600 нмоль тауродезоксихолата натрия.

Реакция была инициирована добавлением 5-100 мкл фермента и контролировалась при 37°С, используя спектрофотофлюорометр. Было обнаружено расщепление 4МУО, например, возбуждением при длине волны примерно 360 нм и эмиссией при примерно 460 нм освобожденного флюрофора, 4-метилумбеллиферона (4МУ). Изменение флуоресценции во времени было записано.

Пример 12

Анализ рекомбинантной КЛЛ человека (SBC-102) в естественных условиях

Крысы Йошила (т.е. гомозиготный) (см. Kuriyama и др. (1990), Journal of Lipid Research, том 31, с. 1605-1611; Nakagawa и др., (1995) Journal of Lipid Research, т.36, с. 2212-2218; и Yoshida и Kuriyama (1990) Laboratory Animal Science, том 40, с. 486-489) с дефицитом КЛЛ были подвернуты лечению посредством введения SBC-102 (5 мг/кг, внутривенно) или плацебо один раз в неделю в течение 4 недель, начиная с 4-недельного возраста. При каждом введении SBC-102 впрыскивался в хвостовую вену мыши двумя равными дозами (2,5 мг/кг) с интервалом 30 минут. Крысы и контрольные особи такого же возраста были исследованы через одну неделю после введения последней дозы. Анализы были выполнены три раза.

Общее патологическое исследование животных после лечения посредством SBC-102 показало нормализацию цвета печени в дополнение к уменьшению размера органа. Крысы после лечения посредством SBC-102 показали по существу нормальную гистологию печени при заметном контрасте со значительной аккумуляцией пенистых макрофагов у животных, которым вводилось плацебо. Уровни сывороточного аланина и аспарагиновой трансферазы, повышенные у крыс с КЛЛ-/-, были также снижены у крыс после лечения посредством SBC-102.

Масса внутренних органов и тканей определялась для каждой крысы, и данные показаны на Фигуре 14. Размер органа представлен в виде процентов от массы тела, определенной в 8-недельном возрасте крыс с КЛЛ-/- и крыс с КЛЛ+/+ после еженедельного введения плацебо или SBC-102 5 мг/кг на протяжении 4 недель.

Вес тела крыс Йошида после лечения посредством SBC-102 или плацебо сравнивался с весом крыс дикого типа, как показано на Фигуре 15. SBC-102 (5 мг/кг) или плацебо вводились внутривенно в виде одной дозы или разделенных доз (в пределах 4-часового периода времени) крысам с КЛЛ-/-. Крысы с КЛЛ+/+ представляли собой контрольные особи этого же помета.

Пример 13

Анализ триглицеридов

Анализ триглицеридов был выполнен для ткани печени и селезенки, взятой у гомозиготных животных дикого типа после введения плацебо или SBC-102. Анализы триглицеридов выполнялись с использованием стандартных методологий (т.е. Международного каталога наборов количественного определения триглицеридов MBL № JM-K622-100) и были выполнены три раза.

Таблица 6
Уровни триглицерида в печени и селезенке у крыс дикого типа с дефицитом КЛЛ
Триглицерид (мкг/мг мокрой ткани)
Дикий тип (n=3) Плацебо (n=3) SBC-102 (n=3)
Печень 48 84 57
Селезенка 3 22 4

Уровень субстрата печени

Фигура 16 показывает уровни холестерина, эфира холестерина и триглицерида в печени, определенные у крыс в 8-недельном возрасте с БВ и дефицитом КЛЛ после еженедельного введения плацебо или SBC-102 5 мг·кг-1 на протяжении 4 недель.

Пример 14

Исследование реакции крыс на введение дозы

Основываясь на исследованиях, описанных выше, фармакодинамические эффекты (ФД) диапазона доз и графиков введения (один раз в неделю и один раз в две недели) доз КЛЛ («SBC-102») были исследованы у крыс с КЛЛ-/-. В этих исследованиях SBC-102 вводился в виде внутривенных инъекций в дозах 0,2, 1, 3 и 5 мг/кг, один раз в две недели, или 0,35, 1,0 и 5,0 мг/кг, один раз в неделю, на протяжении одного месяца, начиная с 4-недельного возраста. Результаты показывают улучшение в увеличении массы тела (МТ) (Фигура 17) органомегалии (Фигура 18) и в уровнях субстрата ткани (Фигура 19). Уровень сывороточной трансаминазы также снизился при повышении дозы SBC-102 и достиг по существу уровня для дикого типа при более высоких дозах.

Пример 15

Фармакокинетика SBC-102

а. Отбор образцов

ФК образцы были взяты у взрослых пациентов, страдающих дефицитом КЛЛ с поздним началом. Пациентам вводились дозы 0,35 мг/кг в течение 2 часов. Образцы сыворотки в день 0 (доза 1, визит 2) и день 21 (доза 4, визит 6) были собраны непосредственно перед введением дозы (в течение 30 минут введения дозы); через 10(±1), 15(=±1), 20(=±1), 40(±2), 60(±2) и 90(±2) минут во время вливания (ВВ) и в конце вливания (KB) приблизительно через 120 минут после начала вливания); и через 5(±1), 10(±1), 20(±1), 30(±1), 40(±2), 60(±2) и 120(±2) минут после завершения вливания (ПВ).

б. Анализ сывороточного фермента

4-МУО (4 мМ), хранящийся в морозильной камере при -20°С, был разморожен при 4°С в холодильнике в темноте и помещен в инкубатор при 25°С на 1,5 часа в темноте перед использованием. Стандарт был приготовлен путем разбавления лекарственного продукта SBC-102 до 1,56 нг/мл. Нейтральный буфер для анализа был добавлен. Все образцы были разбавлены до 50 нг/мл для первого разбавления. Стандарты и образцы были высеяны на планшет сразу после разбавления. После приготовления стандартов и образцов, 62,5 мкл буфера для анализа (0,2 мол/л тригидрата ацетата натрия, рН 5.5) было добавлено в каждую лунку. 12,5 мкл стандартов и образцов были добавлены в каждую лунку с дублированием. 4- МУО (4 мМ) был разбавлен до 1,6×4% раствором Triton Х-100 и добавлен в количестве 25 мкл в каждую лунку. Многолунковый планшет, герметично закрытый, несколько раз встряхивался для перемешивания и затем был помещен в инкубатор при 37°С на 30 минут. После инкубирования 50 мкл стоп-раствора (0,77М Tris рН 8,0) было добавлено в каждую лунку для получения окончательного объема 150 мкл/лунка. Планшет был помещен на считывающее устройство для микропланшетов, и уровни флуоресценции были измерены снизу планшета при возбуждении 360 нм и эмиссии 460 нм.

Как показано в Таблицах 7-11, сывороточное значение Cmax рекомбинантной КЛЛ, вводимой взрослым пациентам, страдающим дефицитом КЛЛ с поздним началом, находилось в диапазоне приблизительно от 270 нг/мл до 720 нг/мл. Период полураспада (t1/2) находился в диапазоне от 7,6 минут до 16,7 минут, среднее значение периода полураспада t1/2 равнялось приблизительно 13 минутам (стандартное отклонение равно 3,812).

Таблица 7
ИД пациента
(Доза: 0,35 мг/кг)
Визит № Концентрация (нг/мл) Номинальное время
02-001 2 5,63 Перед вливанием
02-001 2 241,88 10 мин ВВ
02-001 2 369,44 15 мин ВВ
02-001 2 369,93 20 мин ВВ
02-001 2 359,64 40 мин ВВ
02-001 2 294,64 60 мин ВВ
02-001 2 71,85 90 мин ВВ
02-001 2 71,20 KB
02-001 2 37,95 5 мин ПВ
02-001 2 24,91 10 мин ПВ
02-001 2 14,16 20 мин ПВ
02-001 2 9,76 30 мин ПВ
02-001 2 9,02 40 мин ПВ
02-001 2 7,20 60 мин ПВ
02-001 2 7,51 120 мин ПВ
Cmax=369,93 нг/мл; t1/2=16,8 мин; НПКО=4,68 нг/мл
Таблица 8
ИД пациента
(Доза: 0,35 мг/кг)
Визит № Концентрация (нг/мл) Номинальное время
03-001 2 8,23 Перед вливанием
03-001 2 199,80 10 мин ВВ
03-001 2 215,10 15 мин ВВ
03-001 2 228,12 20 мин ВВ
03-001 2 237,25 40 мин ВВ
03-001 2 210,73 60 мин ВВ
03-001 2 262,41 90 мин ВВ
03-001 2 102,39 KB
03-001 2 52,20 5 мин ПВ
03-001 2 33,75 10 мин ПВ
03-001 2 17,60 20 мин ПВ
03-001 2 12,17 30 мин ПВ
03-001 2 10,82 40 мин ПВ
03-001 2 9,39 60 мин ПВ
03-001 2 8,72 120 мин ПВ
Cmax - 262 нг/мл; t1/2=15,3 мин; НПКО=4,68 нг/мл
Таблица 9
ИД пациента
(Доза: 0,35 мг/кг)
Визит № Концентрация (нг/мл) Номинальное время
03-002 2 <4,68 Перед вливанием
03-002 2 480,55 10 мин ВВ
03-002 2 531,16 15 мин ВВ
03-002 2 613,85 20 мин ВВ
03-002 2 717,75 40 мин ВВ
03-002 2 84,46 60 мин ВВ
03-002 2 54,34 90 мин ВВ
03-002 2 171,41 KB
03-002 2 87,95 5 мин ПВ
03-002 2 49,70 10 мин ПВ
03-002 2 16,47 20 мин ПВ
03-002 2 11,01 30 мин ПВ
03-002 2 9,76 40 мин ПВ
03-002 2 6,28 60 мин ПВ
03-002 2 5,19 120 мин ПВ
Cmax=718 нг/мл; t1/2=10,8 мин; НПКО=4,68 нг/мл
Таблица 10
ИД пациента
(Доза: 0,35 мг/кг)
Визит № Концентрация (нг/мл) Номинальное время
02-001 6 5,12 Перед вливанием
02-001 6 249,91 10 мин ВВ
02-001 6 294,37 15 мин ВВ
02-001 6 313,75 20 мин ВВ
02-001 6 330,04 40 мин ВВ
02-001 6 245,48 60 мин ВВ
02-001 6 262,78 90 мин ВВ
02-001 6 81,09 KB
.02-001 6 32,10 5 мин ПВ
02-001 6 20,39 10 мин ПВ
02-001 6 10,74 20 мин ПВ
02-001 6 8,08 30 мин ПВ
02-001 6 6,38 40 мин ПВ
02-001 6 5,82 60 мин ПВ
02-001 6 <4,68 120 мин ПВ
Cmax=330 нг/мл; t1/2=15,3 мин; НПКО=4,68 нг/мл
Таблица 11
ИД пациента
(Доза: 0,35 мг/кг)
Визит № Концентрация (нг/мл) Номинальное время
03-001 6 6,63 Перед вливанием
03-001 6 317,45 10 мин ВВ
03-001 6 333,46 15 мин ВВ
03-001 6 310,83 20 мин ВВ
03-001 6 378,68 40 мин ВВ
03-001 6 234,49 60 мин ВВ
03-001 6 246,07 90 мин ВВ
03-001 6 206,06 KB
03-001 6 253,80 5 мин ПВ
03-001 6 70,81 10 мин ПВ
03-001 6 24,61 20 мин ПВ
03-001 6 12,32 30 мин ПВ
03-001 6 9,03 40 мин ПВ
03-001 6 7,18 60 мин ПВ
03-001 6 5,56 120 мин ПВ
Cmax - 379 нг/мл; t1/2=7,7 мин; НПКО=4,68 нг/мл

Пример 16

Анализ иммуногенности: Измерение антитела к SBC-102

Неизвестный образец, положительный образец и отрицательный образец были разбавлены 1:20 в 5% сухом молоке в 1 × PBS и инкубировались при 4°C в течение 12-18 часов на ротаторе (500 об/мин). Перед анализом образцы были центрифугированы при 2000 × g в течение 20 минут и надосадочная жидкость была перемещена в новую 1,5 мл трубку.

SBC-102 был разбавлен в IX PBS до концентрации 0,5 мкг/мл, и 100 мкл было помещено в каждую лунку планшета ELISA с 96 лунками. Планшет был закрыт адгезионной крышкой и инкубировался при комнатной температуре в течение 8 часов или всей ночи при 4°С. После инкубирования лунки были промыты три раза 1х буфером для промывки. 200 мкл 5% BSA-IgG было добавлено в каждую лунку, и планшет был герметично закрыт и инкубировался при 4°С в течение 12-18 часов или при комнатной температуре в течение 2 часов. После инкубирования лунки были промыты три раза 1х буфером для промывки. По 100 мкл контрольного образца, неизвестного образца, и отрицательного образца были добавлены в лунки по три раза. Планшет инкубировался при комнатной температуре в течение 1,5 часа на устройстве для встряхивания микропланшетов (500 об/мин). После инкубирования лунки были промыты три раза 1х буфером для промывки. 100 мкл биотинилированного SBC-102, разбавленного в буфере для разбавления до концентрации 100 нг/мл, было добавлено в каждую лунку, и планшет инкубировался при комнатной температуре в течение 1,5 часа на устройстве для встряхивания микропланшетов (500 об/мин). После инкубирования лунки были промыты три раза 1х буфером для промывки. 100 мкл состава стрептавидин-хреносодержащая пероксидаза, разбавленного 1:4000 в буфере для разбавления, было добавлено в каждую лунку. Планшет инкубировался при комнатной температуре в течение 1,5 часа на устройстве для встряхивания микропланшетов (500 об/мин). После инкубирования лунки были промыты четыре раза 1х буфером для промывки. 100 мкл ТМБ субстрата бы до добавлено в каждую лунку, и планшет инкубировался в течение 15 минут в темноте. 50 мкл стоп-раствора (0,5N H2SO4) было добавлено в каждую лунку для прекращения реакции. ОД был измерен при длине волны 450 нм.

Как показано в Таблице 12, пациенты, получавшие еженедельные дозы 0,35 мг/кг SBC-102 на протяжении 4 недель, не демонстрировали повышенный уровень антитела к SBC-102, и можно предположить, что ферментозамещающая терапия посредством вливания SBC-102 не вызывает какой-либо значительной иммуногенности у пациентов-людей. Эти пациенты не демонстрируют какие-либо нежелательные явления или реакции, относящиеся к вливанию (РОВ).

Таблица 12
Образец Среднее значение ОД Стандартное отклонение. SBC-102 Концентрация (нг/мл)
Отриц. Контр. 0.056 Н/0 0
Полож. Контр. 1 0.076 0.005 15.6
Полож. Контр. 2 0.090 0.003 31.2
Полож. Контр. 3 0.132 0.008 62.5
Полож. Контр. 4 0.201 0.009 125
Полож. Контр. 5 0.349 0.019 250
Полож. Контр. 6 0.635 0.012 500
Полож. Контр. 7 0.958 0.101 1000
ИД пациента Среднее значение ОД Стандартное отклонение
01-001 Визит 1 0.053 0.000
02-001 Визит 1 0.051 0.000
02-001 Визит? 0.053 0.002
02-001 Визит 8 0.050 0.001
03-001 Визит 1 0,051 0.001
03-001 Визит 2 0.051 0.001
03-001 Визит 7 0.050 0.000
03-002 Визит 1 0.052 0.004
03-002 Визит 2 0.056 0.006

Пример 17

Лечение болезни Вольмана (БВ) введением рекомбинантной КЛЛ

В 7-недельном возрасте пациент-девочка направлена в больницу в связи с нарушением увеличения веса и слабым прогрессом со дня рождения. При первоначальном физическом обследовании пациент весит 3,6 кг (вес при рождении 3,7 кг) и худой со складками кожи. Живот растянутый, с выраженной гепатомегалией 6 см и выраженной спленомегалией примерно 4 см. Увеличенные лимфатические узлы отмечены в паховой области, мускульная активность слабая.

Начальный уровень гемоглобина составляет 9,2 гм, бляшек - 506000 и лейкоцитов - 11550. Анализ мочи нормальный и мазки костного мозга демонстрируют вакуолизированные лимфоциты и большое количество пенистых клеток. Измерения биохимических параметров сыворотки: общие липиды: 834 мг/100 мл, фосфолипиды: 176 мг/ 100 мл, триглицериды: 141 мг/ 100 мл, холестерин: 129 мг/ 100 мл, билирубин: 0,3 мг/ 100 мл, щелочная фосфатаза: 9.0 ЕБ %, СГОТ: 90 единиц, СГПТ: 50 единиц, холинэстераза: 20 единиц, азот мочевины крови: 8.3 мг, содержание сахара в крови натощак: 45 мг/100 мл. КТ-сканирование живота показывает гепатоспленомегалию и двухстороннее симметричное увеличение надпочечных желез с кальцификацией.

Пациенту хирургическим путем имплантирован порт доступа к сосудистой системе для введения доз. После подсоединения порта к амбулаторному инфузионному аппарату пациенту вводится подготовительная доза дифенгидрамина 1 мг/кг за 20 минут до вливания рекомбинантной КЛЛ для предотвращения возможной анафилактической реакции при вливании. Затем пациенту вводится рекомбинантная КЛЛ в виде дозы 1 мг/кг в течение 5 часов посредством внутривенного вливания. Это лечение повторяется один раз каждые 7 дней без определения количества введений.

В течение двух недель введения первой дозы рекомбинантной КЛЛ оценивается увеличение веса и размер основных брюшных органов с помощью ультразвукового обследования. Также выполняются лабораторные исследования активности кислой лизосомной липазы.

Пример 18

Лечение болезни накопления эфиров холестерина (БНЭХ) введением рекомбинантной КЛЛ

3-летний мальчик с зудящим брюшным раздражением обследуется педиатром. При обследовании брюшной полости врачом отмечается гепатомегалия, которая подтверждается ультразвуковым обследованием. На этот момент времени никакой диагноз не ставится, и пациент периодически наблюдается.

В 8-летнем возрасте он направляется в больницу с гастроэнтеритом. Световая микроскопия биопсии печени показывает повышенный внутрицитоплазматический гликоген и небольшие липидные капли в гепатоцитах. Электронная микроскопия показывает липидные капли с мембранными связями с небольшими электронными плотными гранулами. Поставлен рабочий диагноз - болезнь накопления гликогена типа III (гликогеноз III типа), но активность фибробластов кожи нормальная.

В 10-летнем возрасте гепатомегалия присутствует, и берется вторая биопсия печени, световая микроскопия показывает измененную дольковую архитектуру паренхимы печени с разрыхленными гепатоцитами, содержащими цитоплазматические гранулы и вакуоли с легкими перипортальными фиброзами. Обнаружено, что активность кислой липазы фибробласта составляет 7% от нормальной активности, что подтверждает диагноз БНЭХ. Концентрации в плазме общего холестерина (ОХ), триглицеридов (ТГ), холестерина липопротеинов низкой плотности (ЛНП-Х) выше 95 процентиля для возраста и пола при 7,51, 3,24 и 5,58 ммоль/л соответственно, в то время как концентрация холестерина липопротеина высокой плотности (ПВП-Х) в плазме ниже 5 процентиля при 0,47 ммоль/л; он комбинирует гиперлипиемию (гиперхолестеринемию, гипертриглицеридемию, гипоальфалипопротеинемию и гипербеталипопротеинемию).

Пациенту хирургическим путем имплантирован порт доступа к сосудистой системе для введения доз. После подсоединения порта к амбулаторному инфузионному аппарату пациенту вводится подготовительная доза дифенгидрамина 5 мг/кг за 20 минут до вливания рекомбинантной КЛЛ для предотвращения возможной анафилактической реакции при вливании. Затем пациенту вводится рекомбинантная КЛЛ в виде дозы 5 мг/кг в течение 5 часов посредством внутривенного вливания. Это лечение повторяется один раз каждые 14 дней без определения количества введений.

В течение двух недель введения первой дозы рекомбинантной КЛЛ оценивается увеличение веса и размер основных брюшных органов с помощью ультразвукового обследования. Также выполняются лабораторные исследования активности кислой лизосомной липазы.

Каждый пример в описании выше приводится для объяснения изобретения и не является ограничением изобретения. Действительно, специалистом в этой области будет очевидно, что различные модификации, комбинации, добавления, удаления и вариации могут осуществляться в настоящем изобретении без отклонения от объема или сущности изобретения. Например, свойства, иллюстрируемые или описываемые как часть одного варианта воплощения могут использоваться в другом варианте воплощения для получения дополнительного варианта воплощения. Подразумевается, что настоящее изобретение охватывает такие модификации, комбинации, дополнения, удаления и вариации.

Все публикации, патенты, заявки на патент, сайты Интернета и номера доступа/последовательности в базе данных (включая как полинуклеотидные, так и полипептидные последовательности), цитируемые в данной заявке, включены в данную заявку во всей полноте путем ссылки для всех целей в той же мере, как если каждая индивидуальная публикация, патент, заявка на патент, сайт Интернета или номер доступа/последовательность в базе данных были конкретно и индивидуально указаны для включения путем ссылки.

1. Способ лечения пациента-человека с дефицитом кислой лизосомной липазы (КЛЛ), включающий введение указанному пациенту-человеку рекомбинантной КЛЛ человека в количестве, эффективном для снижения уровня трансаминазы печени в сыворотке или крови до нормального уровня, при этом указанную рекомбинантную КЛЛ человека вводят от одного раза примерно каждые 7 дней до одного раза примерно каждые 30 дней и указанное введение является достаточным для уменьшения поражения печени у указанного пациента-человека.

2. Способ по п.1, отличающийся тем, что указанная трансминаза печени выбрана из группы, состоящей из сывороточной аспартатаминотрансферазы (ACT) и аланинаминотрансферазы (АЛТ).

3. Способ по п.1, отличающийся тем, что указанная трансминаза печени представляет собой ACT.

4. Способ по п.1, отличающийся тем, что указанная трансминаза печени представляет собой АЛТ.

5. Способ по п.1, отличающийся тем, что указанное введение является достаточным для улучшения гепатомегалии.

6. Способ по п.1, отличающийся тем, что указанное введение является достаточным для повышения уровня сывороточного гемоглобина.

7. Способ по п.1, отличающийся тем, что указанное введение является достаточным для уменьшения размеров печени.

8. Способ по п.1, отличающийся тем, что указанное введение является достаточным для уменьшения уровня сывороточного ферритина.

9. Способ по п.1, отличающийся тем, что указанную рекомбинантную КЛЛ человека вводят один раз примерно каждые 7 дней.

10. Способ по п.1, отличающийся тем, что указанную рекомбинантную КЛЛ человека вводят один раз примерно каждые 14 дней.

11. Способ по п.1, отличающийся тем, что указанный пациент-человек страдает болезнью Вольмана.

12. Способ по п.1, отличающийся тем, что указанный пациент-человек страдает болезнью накопления эфиров холестерина.

13. Способ по п.1, отличающийся тем, что указанная рекомбинантная КЛЛ человека включает по меньшей мере одну терминальную маннозу или по меньшей мере один терминальный маннозо-6-фосфат.

14. Способ по п.1, отличающийся тем, что указанное количество, эффективное для снижения уровня трансаминазы печени в сыворотке или крови до нормального уровня, составляет примерно 1 мг на килограмм веса тела указанного пациента-человека.

15. Способ по п.1, отличающийся тем, что период полураспада (t1/2) указанной рекомбинантной КЛЛ человека в сыворотке меньше примерно 20 минут.

16. Способ по п.1, отличающийся тем, что период полураспада (t1/2) указанной рекомбинантной КЛЛ человека в сыворотке составляет примерно 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 или 17 минут.

17. Способ по п.1, отличающийся тем, что Cmax указанной рекомбинантной КЛЛ человека составляет от примерно 200 нг до примерно 800 нг на мл сыворотки.

18. Способ по п.1, отличающийся тем, что Cmax указанной рекомбинантной КЛЛ человека составляет по меньшей мере 200 нг на мл сыворотки.

19. Способ по п.1, отличающийся тем, что указанную рекомбинантную КЛЛ человека вводят внутривенно.

20. Способ по п.19, отличающийся тем, что указанную рекомбинантную КЛЛ человека вводят путем вливания.

21. Способ по п.20, отличающийся тем, что указанное вливание указанному пациенту-человеку выполняют в течение времени от примерно одного до примерно четырех часов.

22. Способ по п.1, отличающийся тем, что указанное введение является достаточным для снижения лимфаденопатии.

23. Способ по п.1, отличающийся тем, что возраст указанного пациента-человека меньше одного года и указанное введение достаточно для увеличения скорости роста указанного пациента-человека.

24. Способ по п.1, дополнительно включающий введение второго лекарственного средства.

25. Способ по п.24, отличающийся тем, что указанное второе лекарственное средство представляет собой средство, понижающее холестерин.

26. Способ по п.25, отличающийся тем, что указанное второе лекарственное средство представляет собой статин.

27. Способ по п.25, отличающийся тем, что указанное второе лекарственное средство представляет собой эзетимиб.

28. Способ по п.24, отличающийся тем, что указанное второе лекарственное средство представляет собой иммунодепрессант.

29. Способ по п.24, отличающийся тем, что указанное второе лекарственное средство представляет собой антигистамин.

30. Способ по п.29, отличающийся тем, что указанный антигистамин представляет собой дифенгидрамин.

31. Способ по п.30, отличающийся тем, что указанный дифенгидрамин вводят в количестве от примерно 1 до примерно 5 мг на килограмм веса тела указанного пациента-человека.

32. Способ по п.30, отличающийся тем, что указанный дифенгидрамин вводят в течение от примерно 20 до примерно 90 минут до указанного введения рекомбинантной КЛЛ человека.



 

Похожие патенты:

Изобретение относится к пролекарственным препаратам пептидов глюкагонового надсемейства, в которых пептид глюкагонового надсемейства модифицирован связыванием дипептида с пептидом глюкагонового надсемейства амидной связью.
Изобретение относится к области медицины, в частности к фармацевтической промышленности, и описывает твердую лекарственную форму гиполипидемического действия, содержащую розувастатин или его фармацевтически приемлемую соль в количестве от 3 до 15%, технологические добавки и фармацевтически приемлемый наполнитель, включающий целлюлозу микрокристаллическую, лактозы моногидрат, поливинилпирролидон и кроскармеллозу натрия.

Группа изобретений относится к соединению формулы (I) или его фармацевтически приемлемым солям формулы (I), где X представляет собой О, S; Υ представляет собой О, S; R1 независимо представляет собой Н, алкил; G1 представляет собой этил; G2 и G3 каждый независимо выбраны из Н, алкила, трифторметила, галогена, нитро, амидо, циано и тетразолила.

Изобретение относится к новым соединениям формулы I, в которой R1 и R2 являются одинаковыми или разными и выбраны из алкильной или алкенильной углеводородной цепи, значения группы R3, которая отщепляется липазой, определены в формуле изобретения.

Изобретение относится к соединениям общей формулы I, или их рацемической смеси, или индивидуальным оптическим изомерам, или фармацевтически приемлемым солям, обладающим свойствами агониста рецепторов желчных кислот TGR.

Изобретение относится к фармацевтической промышленности и представляет собой способ получения лекарственного средства на основе полипренилфосфатов и бета-ситостерина, заключающийся в предварительном смешивании полипренилфосфатов и сорбита в ступке, размер которой соответствует суммарному объему смешиваемых веществ, при этом между стенкой и/или дном ступки и вводимыми полипренилфосфатами находится слой сорбита, полученную при смешивании смесь полипренилфосфатов в сорбите гомогенизируют, при этом в гомогенизатор добавляют сорбит, сухую смесь полипренилфосфатов в сорбите в соотношении 1:8 и бета-ситостерин, и гомогенизация производится в течение 10 минут в импульсном режиме, причем гомогенизацию осуществляют при скорости вращения 500-700 об/мин в течение 4 минут, 1000-1200 об/мин в течение 2 минут и затем со скоростью 500-600 об/мин в течение 4 минут, при этом при изменении скорости вращения делают перерыв 20 минут, причем после каждой остановки процесса производится интенсивное встряхивание чаши со смесью, после чего полученный порошок просеивают через сито с размером ячейки 20 мкм и, если масса отсева составляет менее 0,1% от массы загруженных ингредиентов, процесс гомогенизации заканчивают.

Изобретение относится к области органической химии, а именно к соединению формулы I, к его изомерным формам и фармацевтически приемлемым солям. Также изобретение относится к фармацевтической композиции на основе соединения формулы I.

Изобретение относится к новому веществу - дихлорацетату 2-этил-6-метил-3-гидроксипиридина формулы I: его стабильной кристаллической форме и способу ее получения.

Изобретение относится к области органической химии, а именно к гетероциклическому соединению формулы (I) или к его фармацевтически приемлемой соли, где Alk представляет собой линейную C1-6 алкиленовую группу, разветвленную C1-6 алкиленовую группу или C1-6 алкиленовую группу, имеющую кольцевую структуру, где часть атомов углерода, составляющих кольцевую структуру, необязательно может быть замещена атомом кислорода, в кольце X, X1 представляет собой N или CRX1, X2 представляет собой N или CRX2, X3 представляет собой CRX3, X4 представляет собой N или CRX4, где RX1, RX2, RX3 и RX4 каждый независимо представляет собой атом водорода; линейную или разветвленную C1-6 алкильную группу; линейную или разветвленную C1-6 алкоксигруппу; или атом галогена, в кольце Y, Y1 представляет собой CRY1, Y2 представляет собой N или CRY2, Y3 представляет собой N или CRY3, Y4 представляет собой N или CRY4, RY1, RY2, RY3 и RY4 каждый независимо представляет собой атом водорода; линейную или разветвленную C1-6 алкильную группу, которая может быть замещена атомом (атомами) галогена; C3-7 алкильную группу, имеющую кольцевую структуру; линейную или разветвленную C1-6 алкоксигруппу; атом галогена или цианогруппу, в кольце Z, RZ представляет собой линейную или разветвленную C1-6 алкильную группу, которая может быть замещена атомом (атомами) галогена, или C3-7 алкильную группу, имеющую кольцевую структуру, которая может быть замещена атомом (атомами) галогена.

Группа изобретений относится к области медицины и фармакологии и касается лекарственного средства пептидной природы для лечения гиперхолестеринемии и процессов тромбообразования.

Изобретение относится к области фармации и медицины и касается конъюгата наноалмаза с пирофосфатазой для доставки пирофосфатазы в организм и способа его получения.

Изобретение относится к подготовительному набору, предоставляемому пациенту перед введением терапевтического ботулинического токсина. Заявленный набор содержит добавку в форме капсул или таблеток, которые включают ионы цинка в органической или неорганической форме в дозе, достаточной для потребления от 10 мг до 400 мг элементарного цинка в день, и добавку фитазы в количестве 0,8-10000 единиц, достаточном для введения вместе с добавкой ионов цинка в течение периода нагрузки ионами цинка.

Группа изобретений относится к композиции, содержащей смесь по меньшей мере одного протеолитического фермента, такого как субтилизин или наттокиназа, и по меньшей мере одного липолитического фермента, выбранного из группы, включающей липазу Cal А или Cal В из Candida anthartica, Geotrichum candidum, Candida rugosa или смесь этих липаз, для применения в предотвращении синтеза триглицеридов путем расщепления 2-моноацилглицерина в кишечнике и к комбинированному продукту указанных ферментов того же назначения.
Изобретение относится к фармацевтической промышленности и представляет собой композицию для наружного лечения и профилактики инфекций, вызванных вирусом герпеса типа 1, 2, и бактериальных осложнений, вызываемых герпетической инфекцией, содержащую в качестве активных ингредиентов лизоцим, пероксидазу, повиаргол, в качестве противовоспалительных ингредиентов эсцин и глициризиновую кислоту или ее соли, в качестве носителей - липосомы на основе высокоактивных гидрированных лецитинов в комбинации с холестерином и фармацевтически приемлемые носители и эксципиенты, причем компоненты в композиции находятся в определенном соотношении в мас.%.

Изобретение относится к медицине, а именно к хирургии. Для этого в брыжейку кишки устанавливают полиэтиленовую трубку.

Настоящее изобретение относится к медицине, а именно к терапии, и касается лечения лизосомной болезни накопления - болезни Нимана-Пика А или В. Для этого вводят фермент кислую сфингомиелиназу интравентрикулярно медленно, в течение трех часов.
Изобретение относится к медицине. Описано биодеградируемое гемостатическое лекарственное средство для остановки кровотечений, согласно которому на 1 г диальдегидцеллюлозы со степенью окисления 12% соиммобилизуют: ε-аминокапроновой кислоты 50 мг, лизоцима 5 мг в 6,5 л дистиллированной воды в течение 3 часов при комнатной температуре.

Группа изобретений относится к медицине и может быть использована для улучшения реологических свойств мокроты и подавления образования бактериальных биопленок в бронхах при лечении муковисцидоза.
Изобретение относится к фармацевтической промышленности и представляет собой лекарственный препарат для лечения заболеваний, вызванных вирусом простого герпеса 1-го типа и цитамегаловирусом, включающий рекомбинантный человеческий интерферон 2α, лизоцим, ликопид, левокарнитин 20%, витамин Е и жировую основу.
Настоящее изобретение относится к медицине, а именно к фармацевтической композиции, содержащей фермент дезоксирибонуклеазу и глицирризиновую кислоту или ее соли: глицирризинат аммония или дикалия или тринатрия, которая может быть использована в медицине для лечения и профилактики вирусных инфекций, вызываемых ДНК-содержащими вирусами, такими как герпес, опоясывающий лишай, папиллома человека, аденовирусы и другие. В изобретении предложена фармацевтическая композиция, включающая в себя в качестве активных ингредиентов - 0,001-0,5 мас.% дезоксирибонуклеазы (ДНК-азы) и 0,001-0,5 мас.% глицирризиновую кислоту или ее соли: глицирризинат аммония или дикалия или тринатрия, в качестве носителей: β-циклодекстрины или лецитины 0,001-5,0 мас.%, полимерный носитель 0,05-1,00 мас.% и приемлемые эксципиенты. 2 з.п., 7 пр., 2 табл. .

Изобретение относится к применению 1-{4-[1-(4-циклогексил-3-трифторметилбензилоксиимино)-этил]-2-этилбензил}азетидин-3-карбоновой кислоты или ее фармакологически приемлемой соли при лечении демиелинизирующей периферической невропатии, выбранной из хронической воспалительной демиелинизирующей полирадикулоневропатии, мультифокальной моторной невропатии с блоком проведения или парапротеинемической демиелинизирующей периферической невропатии.
Наверх