Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека



Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека
Штамм клеток яичников китайского хомячка - продуцент рекомбинантного антитела против фактора некроза опухоли альфа человека

 


Владельцы патента RU 2556816:

Открытое акционерное общество "Фармацевтический импорт, экспорт" (ОАО "Фармимэкс") (RU)

Изобретение относится к области биотехнологии, конкретно к рекомбинантной продукции белков человека, и может быть использовано в производстве химерных антител к фактору некроза опухоли человека. Получен штамм клеток яичников китайского хомячка CHO-Inflix 20/5, трансфецированных векторами, экспрессирующими легкую и тяжелую цепи химерного антитела против фактора некроза опухоли альфа (ФНО-α) человека. Штамм депонирован в Российскую коллекцию клеточных культур под №РККК(П)760Д. Изобретение позволяет получать химерное антитело с удельной продуктивностью не менее 33,5 пикограмм на клетку в сутки. 4 ил., 2 табл., 4 пр.

 

Изобретение относится к биотехнологии, в частности к производству химерных антител к фактору некроза опухоли человека.

Фактор некроза опухоли (в настоящее время под этим термином понимается фактор некроза опухолей альфа) (ФНО-α) является цитокином, продуцируемым рядом клеток и тканей, в первую очередь макрофагами, моноцитами, CD4+ и CD8+ Т-лимфоцитами в ответ на стимуляцию бактериальным эндотоксином (Кетлинский С.А., Симбирцев А.С. Цитокины, С-Пб, 2008). ФНО-α в своей биологически активной форме является тримером, и желобок, образованный соседними субъединицами, важен для взаимодействия цитокин-рецептор. Обладая плейотропным действием, ФНО-α является медиатором воспалительного процесса. В патологических состояниях усиленная продукция ФНО может сопровождаться повреждением тканей, сосудистыми и клеточными реакциями, развивающими и поддерживающими хроническое воспаление В частности, повышенная продукция ФНО-α играет важную роль при сепсисе, отторжение трансплантатов и ряде аутоиммунных заболеваний, таких как ревматоидный артрит, болезнь Крона, системная красная волчанка, неспецифический язвенный колит, рассеянный склероз, аутоиммунный диабет, язвенный колит и многие другие заболевания и патологические состояния.

Ингибиторы ФНО-α - это молекулы, в первую очередь, искусственно синтезированные фармацевтические средства, способные ингибировать активность провоспалительного цитокина ФНО-α и тем самым влиять на симптомы ряда заболеваний. В этой связи поиск ингибиторов ФНО-α приобретает важное практическое значение, так как вещество, обладающее достаточной специфичностью и селективностью в отношении ФНО-α, может являться эффективным профилактическим или лечебным фармацевтическим соединением для предупреждения или лечения расстройств, в которые ФНО-α вовлекается как причинный фактор. Наиболее перспективным направлением при этом является использование для этих целей антител. Лечебные средства на основе антител имеют существенные преимущества по сравнению с химико-фармацевтическими препаратами, поскольку они имеют совершенную селективность в отношении своей мишени и низкую собственную токсичность.

В настоящее время описаны способы лечения токсического шока, регрессии опухолей, ингибирования цитотоксичности, аутоиммунной болезни, такой как ревматоидный артрит и болезнь Крона, реакции "трансплантат против хозяина", бактериального менингита с помощью антител к ФНО-α (RU 2455312, 2012; US 6448380, 2002; US 6451983, 2002; US 6498237, 2002; US 5672347, 1997; US 5656272, 1997).

Однако пока ни одно из доступных в настоящее время лекарственных средств не является достаточно эффективным для лечения аутоиммунных заболеваний и большинство имеют ограничения из-за сильной токсичности. Кроме того, традиционные антитела обладают связывающей активностью, которая зависит от рН, и, следовательно, они не подходят для применения в средах, выходящих за пределы физиологического интервала рН, например, при лечении желудочного кровотечения, операции на желудке и т.п.

Среди антител, способных ингибировать ФНО-α наиболее известны, такие как инфликсимаб (Ремикейд) - химерное иммуноглобулиновое моноклональное антитело к ФНО-α, адалимумаб (Хумира) - человеческое моноклональное антитело к ФНО-α, а также гибридные белки, такие как этанерцепт (Энбрел) - человеческий рекомбинантный белок-рецептор к ФНО-α и цертолизумаба пэгол (Симзия) - пегилированное моноклональное антитело к ФНО-α, свободное от Fc-фрагмента (www.rheumatology.kiev.ua/wp-content/uploads/magazine/38/21.pd).

При этом самый обширный (более 300000 пациентов) и длительный (более 6 лет) клинический опыт накоплен в отношении препарата инфликсимаб (Ремикейд, Шеринг-Плау) - химерных моноклональных антител к фактору некроза опухоли, который широко применяется практически во всех странах мира, в том числе в России (medline.uz/article/rheumatology/1177.htm). Препарат показал высокую эффективность при лечении ревматоидного артрита (после однократного введения эффект длился примерно 6-12 нед, а повторные введения позволяли поддерживать ремиссию примерно у половины пациентов), при болезни Крона, при серонегативных спондилоартропатиях (Насонов Е.Л. Фактор некроза опухоли - новая мишень для противовоспалительной терапии ревматоидного артрита. Русский медицинский журнал, 2000; 8 (17): 718-722; Furst D.E., Keystone Е., Maini R.N., Smolen J.S. Recapulation of the round-table discussion - assessing the role of anti-tumor necrosis factor therapy in the treatment of rheumatoid arthritis. Rheumatol., 1999; 38 (suppl.): 50-53.; Bosch van den F., Kruithof E., Baeten D., et al. Effects of a loading dose regimen of three infusions of chimeruic monoclonal antibody to tumor necrosis factor a (infliximab) in spondyloarthropathy: an open pilot study. Ann. Rheum. Dis., 2000; 59: 428-433).

Химерное (мышь-человек) антитело инфликсимаб (Ремикейд) состоит из вариабельной (Fv) области высокоафинных нейтрализующих мышиных моноклональных антител к ФНО, соединенных с фрагментом молекулы IgG1k человека, в целом занимающей две трети молекулы антитела и обеспечивающей его эффекторные функции. Инфликсимаб связывает ФНО-α с Ка=1,8×109 л/моль и эффективно нейтрализует его биологическую активность. По данным опытов in vitro, препарат, образуя стабильные комплексы с ФНО-α, эффективно подавляет биологическую активность секрецируемого и мембран-ассоциированного ФНО-α и индуцирует лизис ФНО-продуцирующих клеток, комплемент-зависимым путем или за счет антитело-зависимой клеточной цитотоксичности (www.mednovosti.by. Архив, №8, 1995).

Инфликсимаб производят культивированием клеток миеломы мыши SP2/0, трансформированных плазмидными векторами, экспрессирующими легкую и тяжелую цепи, с последующей очисткой секретированного антитела из среды культивирования клеток (WO 9216553, 1992). Линия на основе клеток мыши SP2/0 - продуцент инфликсимаба была получена более 20 лет назад с применением технологий, существовавших в то время, и не позволяет получать антитело с достаточно высоким выходом. Кроме того, в настоящее время установлено, что гликозилирование белков, в частности, антител, в клетках мыши имеет ряд отличий от гликозилирования в клетках человека, что указывает на потенциальную угрозу развития иммунного ответа при введении рекомбинантных антител, произведенных клетками мыши, в организм человека. В этой связи более перспективным является получение рекомбинантных антител для терапевтического применения в клетках китайского хомячка (например, в клетках СНО), где характер гликозилирования антител более близок к человеческому (Raju T.S. Glycosylation variations with expression systems and their impact on biological activity of therapeutic immunoglobulins. BioProcess International, 2003: 44-52).

Наиболее близким по технической сущности к заявляемому изобретению является технология получения антитела инфликсимаб в клетках яичников китайского хомячка с использованием генов, кодирующих легкую и тяжелую цепи химерного (мышь-человек) антитела инфликсимаб (WO 2011015916, 2011)., где в качестве векторов использовали вектор содержащий последовательность S/MAR.

Недостатком данной технологии является достаточно сложная технология выделения целевого продукта (WO 2011015919, 2011) и по предварительным данным недостаточно высокий выход целевого продукта (в патенте информация о результатах использования изобретения отсутствует).

Задачей, решаемой авторами, являлось расширение ассортимента используемых штаммов культивируемых клеток яичников китайского хомячка (СНО) с целью получения штамма, обеспечивающего более высокий и стабильный выход химерного антитела против ФНО-α человека.

Технической задачей являлась разработка нового более эффективный штамм клеток СНО-продуцент химерного антитела против ФНО-α человека

Технический результат был достигнут созданием штамма клеток яичников китайского хомячка CHO-Inflix 20/5 - продуцента химерного антитела с удельной продуктивностью 33,5 пг антитела на клетку в сутки, путем трансформации клеток экспрессионными векторами, содержащими Seq ID No 1 и 2, физические карты которых представлены на фиг. 1 и 2.

Данный штамм клеток яичников китайского хомячка СНО-Inflix 20/5 - продуцент химерных антител против ФНО-α человека был помещен в Российскую коллекцию клеточных культур 16.09.2013 под № РККК(П)760Д.

Штамм имеет следующие характеристики:

Регистрационный номер: РККК(П)760Д,

Авторское наименование штамма: CHO-Inflix 20/5

Причины депонирования: Продуцент рекомбинантных химерных антител против фактора некроза опухолей (ФНО)-α человека

Родословная штамма: Родительская клеточная линия CHOdhfr-. Котрансфекция плазмидами pIRES-DHFR/InflixH и pIRES-NEO/InflixL, отбор стабильного высокопродуктивного клона на среде без гипоксантина/тимидина с 500 мкг/мл G-418 и постепенным увеличением концентрации метотрексата.

Число пассажей к моменту паспортизации и депонирования: 20

Стандартные условия выращивания: Среда α-МЕМ с 4 нМ глутамина, 10% фетальной сыворотки, 500 мкг/мл G-418, 500 нМ метотрексата, 37°С, 5% СО2.

Культуральные свойства: Адгезионный тип роста, культивирование в матрасах, посевная доза 10000 клеток/см2, достижение монослоя через 4 суток. Для снятия с пластика используется раствор Версена-трипсин (1:1).

Характеристика культивирования клеток в организме животного: культивирование в организме животного не применяется

Данные по видовой принадлежности: Cricetulus griseus (ПЦР-анализ с видоспецифичными праймерами).

Маркерные признаки штамма и методы их оценки: способность к росту в присутствии 500 мкг/мл G-418 и 500 нМ метотрексата

Контроль контаминации бактериями, грибами, микоплазмами и вирусами: контаминации нет

Характеристики полезного вещества, продуцируемого штаммом: Рекомбинантное химерное антитело (изотип IgG1, каппа) к фактору некроза опухолей альфа человека, нейтрализующее биологическую активность ФНО-альфа (оценка с помощью иммуноферментного анализа, вестерн-блота, биологического теста на клеточной линии L-929)

Характеристика биосинтеза полезных продуктов (выход продукта в среду, уровень активности и способ ее определения): рекомбинантное антитело секретируется в культуральную среду в количестве не менее 33,5 пг на клетку в сутки. Стабильность культивирования - не менее 30 пассажей.

Способ криоконсервирования: фетальная сыворотка с 10% DMSO, 3-4×106 клеток/мл, заморозка до -70°С со скоростью 1°С/мин, далее помещение в жидкий азот, жизнеспособность после размораживания и отмывки от криоконсерванта 85% (с трипановым синим).

Сущность заявляемого изобретения поясняется прилагаемыми чертежами:

Фиг. 1. Карта экспрессионной плазмиды pIRES-DHFR/InflixH, где CMV Promoter - промотор предранних белков цитомегаловируса;

a-TNF heavy chain - ген тяжелой цепи химерного антитела против ФНО-альфа человека;

IRES - внутренний сайт посадки рибосомы;

DHFR - ген дигидрофолатредуктазы;

PolyA - сайт полиаденилирования РНК из гена гормона роста быка;

pUC Ori - точка начала репликации;

AmpR - ген устойчивости к ампициллину;

Фиг. 2. Карта экспрессионной плазмиды pIRES-NEO/InflixL, где

CMV promoter - промотор предранних белков цитомегаловируса;

a-TNF light chain - ген легкой цепи химерного антитела против ФНО-альфа человека;

Synthetic intron - интрон;

IRES - внутренний сайт посадки рибосомы;

NEO - ген устойчивости к неомицину;

Poly А - сайт полиаденилирования РНК из гена гормона роста быка;

pUC Ori - точка начала репликации;

AmpR - ген устойчивости к ампициллину;

Фиг. 3. Результаты суспензионного культивирования клеток штамма CHO-Inflix 20/5 в бессывороточной среде, где КЖК - концентрация жизнеспособных клеток;

Фиг. 4. Нейтрализующая активность антител, продуцируемых клетками клона CHO-Inflix 20/5, в отношении ФНО-α человека.

Перечень прилагаемых последовательностей:

Seq ID No 1 - последовательность ДНК, кодирующая легкую цепь химерного антитела против ФНО-α человека

Seq ID No 2 - последовательность ДНК, кодирующая тяжелую цепь химерного антитела против ФНО-α человека

Seq ID No 3 - последовательность аминокислот легкой цепи химерного антитела против ФНО-α человека

Seq ID No 4 - последовательность аминокислот тяжелой цепи химерного антитела против ФНО-α человека.

Сущность и преимущества изобретения иллюстрируются следующими примерами:

Пример 1. Конструирование искусственных генов, кодирующих легкую и тяжелую цепи химерного (мышь-человек) антитела против ФНО-α человека и векторных конструкций для их экспрессии

С целью повышения продуктивности штамма последовательности нуклеотидов в генах, кодирующих легкую (Seq ID No 1) и тяжелую (Seq ID No 2) цепи известного варианта (RU 2004117915, WO 03042247) химерного антитела против ФНО-α человека, конструировали с учетом частот использования кодонов в геноме китайского хомячка (Cricetulus griseus) из codon usage database [2], при этом на 5′-концах данных генов были помещены последовательности, кодирующие сигнальный пептид из иммуноглобулина мыши (MDFQVQIFSFLLISASVIISRG), и последовательности Козак. Фрагменты ДНК, содержащие данные гены с добавлением фланкирующих сайтов рестрикции (BamHI с 5′-конца и NotI с 3′-конца), были получены с помощью автоматизированного химического синтеза и лигирования. Полученные фрагменты были клонированы в экспрессионные вектора pIRES-DHFR и pIRES-NEO с получением двух экспрессионных плазмид pIRES-DHFR/InflixH (Фиг. 1) и pIRES-NEO/InflixL (Фиг. 2). Правильность сборки плазмид и отсутствие мутаций в синтезированных генах были проверены сиквенированием.

Пример 2. Получение штамма клеток CHO-Inflix 20/5 - продуцента химерного антитела против ФНО-α человека

Клетки линии яичников китайского хомячка, дефектные по дигидрофолатредуктазе (CHOdhfr-), трансфецировали смесью плазмид pIRES-DHFR/InflixH и pIRES-NEO/InflixL, взятых в соотношении 2:3 и предварительно обработанных рестриктазой PvuI, с помощью реагента TurboFect. Через 48 часов после трансфекции в супернатантах с помощью ИФА определялось 142±30 нг/мл человеческих иммуноглобулинов. Тогда клетки были переведены на селективную среду без тимидина и гипоксантина, содержавшую 500 мкг/мл G-418. В последующие дни наблюдалось прекращение роста, а затем активное отмирание основной массы клеток. Через 12-14 суток был зафиксирован стабильный рост колоний, устойчивых к росту в селективной среде. Колонии были пулированы, перенесены в 6-луночные культуральные платы, а затем посеяны по 105 клеток на лунку в 4 мл среды. Через шесть суток концентрация антител человека в супернатантах составила 507±17 нг/мл. Полученный пул клеток был криоконсервирован, после чего было проведено клонирование с целью отбора индивидуальных клонов с высокой продукцией рекомбинантных антител. Клонирование выполнялось методом лимитирующих разведений в 96-луночных платах. Через 10 суток визуально отбирали лунки, содержащие единственный клон. Всего было отобрано 295 таких клонов. Далее с помощью ИФА анализировали содержание человеческих иммуноглобулинов в супернатанте. В результате скрининга было отобрано 36 клонов, в супернатантах которых концентрация IgG человека превышала 230 нг/мл.

Эти клоны были перенесены в 12-луночные платы, а затем по достижении монослоя посеяны по 105/лунку в 6-луночные платы в объеме 4 мл. Через 6 суток концентрацию иммуноглобулинов в супернатантах определили повторно. По результатам данного скрининга было отобрано 9 клонов с устойчивой высокой продукцией IgG человека (3 мкг/мл и выше). Далее отобранные кандидатные клоны криоконсервировали.

Последующее культивирование клеток отобранных клонов и сравнение их продуктивности показало, что клонами с максимальной удельной и волюметрической продуктивностью и минимальной скоростью роста оказались клоны №7, 11, 19, 20 и 24. Показатели этих клонов приведены в таблице 1.

Далее клетки пяти кандидатных клонов культивировали в присутствии постепенно увеличивающихся концентраций метотрексата (20 нМ - 100 нМ - 500 нМ) для амплификации целевых генов. После успешной адаптации к 500 нМ метотрексата было проведено сравнение волюметрической продукции полученных клонов. Максимальная концентрация IgG человека в супернатанте оказалась у клона №20 - 35,8 мкг/мл. Удельная продуктивность при этом составила 22,3±6,0 пг/кл/сут.

Клетки этого клона были субклонированы с помощью лимитирующих разведений, проанализировано 12 субклонов. Клетки высевали по 105/лунку в 6-луночные платы в объеме 4 мл и измеряли концентрацию иммуноглобулинов в супернатанте через 5, 6 и 7 суток. Результаты представлены в таблице 2.

Максимальная волюметрическая продукция была зафиксирована в супернатанте субклона 20/5. Удельная продуктивность данного субклона оказалась равна 33,5 пг/кл/сут. Клетки субклона, названные CHO-Inflix 20/5, были размножены, криоконсервированы и депонированы в РККК под номером РККК(П)760Д.

Пример 3. Продукция рекомбинантных антител клетками CHO-Inflix 20/5 в бессывороточной среде.

Клетки клона CHO-Inflix 20/5, предварительно адаптированные к суспензионному культивированию, засевали в 150 мл бессывороточной среды CDM4CHO (HyClone), с 6 мМ аланилглутамина в колбу Эрленмейера объемом 500 мл (плотность при посеве 5×105 клеток/мл). Далее клетки культивировали на шейкере (130 об/мин, 37°С, 5% СО2) и ежедневно оценивали плотность и жизнеспособность клеток, а также содержание рекомбинантных иммуноглобулинов. Результаты, представленные на фиг. 3, показывают, что максимальная плотность жизнеспособных клеток наблюдалась на 6 сутки и составила 5,0×106/мл. На 7 сутки жизнеспособность снизилась до 75%, при этом концентрация иммуноглобулинов составила более 0,2 г/л.

Пример 4. Очистка рекомбинантного антитела и анализ биологической активности.

На 7 день культивирования (пример 3) клетки штамма CHO-Inflix 20/5 удаляли с помощью микрофильтрации и полученную культуральную жидкость подвергали трех-стадийной хроматографической очистке на аффинном сорбенте с иммобилизованным белком А, анионите Q-Сефарозе XL и катионите SP-Сефарозе FF, после чего концентрировали и стерилизовали с помощью ультрафильтрации. Всего было получено 18 мг высокоочищенного антитела с выходом 70%.

Тестирование нейтрализующей активности полученных антител проводили в цитотоксическом тесте на клеточной линии L-929 (коллекция ИНЦ РАН). Клетки высевали в плотности 3×104 клеток на лунку в 96-луночный плоскодонный планшет. На следующий день среду в клетках полностью заменяли на свежую с добавлением актиномицина Д (Sigma) в конечной концентрации 1 мкг/мл.

Антитело, полученное из клона CHO-Inflix 20/5, известное химерное антитело к ФНО-альфа человека (препарат «Ремикейд»), а также контрольные рекомбинантные человеческие антитела, не взаимодействующие с ФНО-α, раститровывали в диапазоне концентраций от 200 до 0,78 нг/мл и инкубировали в течение 1 часа при комнатной температуре с ФНО-α человека (ProSpec) в концентрации 1 нг/мл. Далее смеси антител и ФНО-α человека вносили в планшет с клетками.

Через 24 ч среду удаляли, окрашивали клетки раствором кристаллического фиолетового и высушивали. Затем окрашенный осадок растворяли в растворе додецилсульфата натрия с глицерином и фотометрировали при 595 нм на планшетном счетчике Victor2. Результаты выражали в единицах оптической плотности. Результаты, представленные на фиг. 4, показывают, что продуцируемое клетками штамма CHO-Inflix 20/5 антитело ингибирует активность ФНО-α человека идентично коммерческому химерному антителу инфликсимаб - «Ремикейд».

Таким образом, получен штамм клеток CHO-Inflix MG20/5 - продуцент химерного рекомбинантного антитела против ФНО-α человека, нейтрализующие свойства которого идентичны препарату инфликсимаб (Ремикейд).

Штамм клеток яичников китайского хомячка CHO-Inflix 20/5, трансфецированных экспрессионными векторами, содержащими последовательности ДНК SEQ ID NO:1 и SEQ ID NO:2 - продуцент химерного антитела к фактору некроза опухоли альфа человека, депонированный в Российскую коллекцию клеточных культур под № РККК(П)760Д.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к интернализации терапевтических молекул внутрь клетки, и может быть использовано в медицине. Получают композицию для доставки молекул нуклеиновых кислот в клетки, содержащую по меньшей мере один пептид с по меньшей мере 92% идентичностью к GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); или YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), присоединенный к одной или нескольким молекулам нуклеиновых кислот.

Группа изобретений относится к области биотехнологии. Предложена рекомбинантная плазмидная ДНК, кодирующая химерное антитело против фактора некроза опухолей-альфа человека (ФНО-альфа), на основе плазмиды pOptiVECTM-TOPO®.

Изобретение относится к области биотехнологии и иммунологии. Описаны различные варианты антител, специфические в отношении IL-1R1.

Изобретение относится к области биотехнологии и может быть использовано для идентификации гетеромультимерных убиквитинов со способностью связываться с лигандом-антигеном.

Предложенное изобретение относится к иммунологии. Предложены варианты антител, нейтрализующих инфекцию субтипа группы 1 и субтипа группы 2 вируса гриппа А.

Изобретения касаются инфекционной молекулы нуклеиновой кислоты, кодирующей инфекционный вирус Torque teNO свиней (PTTV), которая содержит по меньшей мере одну копию геномной последовательности, выбранной из группы, состоящей из последовательностей, соответствующих генотипам или подтипам PTTV1a-VA, PTTV1b-VA, PTTV2b-VA и PTTV2c-VA, а также биологически функциональной плазмиды или вирусного вектора, содержащего такую инфекционную нуклеотидную геномную последовательность, и клетки-хозяина, содержащей такую плазмиду или вектор.

Изобретение относится к области биотехнологии, конкретно к лентивирусной доставке апоптина в опухолевые ткани, и может быть использовано в медицине. Способ включает получение лентивирусного конструкта, экспрессирующего модифицированный апоптин, слитый с секреторным сигналом лактотрансферрина и трансдукторным сигналом (ST-CTP-апоптин), с последующим получением рекомбинантных лентивирусных частиц, дефектных по репликации и несущих модифицированный апоптин, которые затем вводятся в Т-лимфоциты (TILs), полученные при хирургическом удалении опухоли или в процессе получения биопсии, которые обладают способностью проникать в опухолевые ткани.
Изобретение относится к области биотехнологии и генетической инженерии. Предложен способ получения по меньшей мере одной трансфицированной эукариотической клетки-хозяина, экспрессирующей целевой продукт, включающий введение в клетку полинуклеотида, кодирующего целевой продукт, и полинуклеотида, кодирующего мутантный фермент дигидрофолатредуктазу по крайней мере одним вектором экспрессии, получение множества эукариотических клеток-хозяев, жизнеспособность которых зависит от потребления фолата, причем указанные эукариотические клетки-хозяева включают по меньшей мере чужеродный полинуклеотид, кодирующий целевой продукт, и чужеродный полинуклеотид, кодирующий фермент дигидрофолатредуктазу (ДГФР), культивирование указанного множества эукариотических клеток-хозяев в селективной культуральной среде, включающей метотрексат в концентрации 2,3-500 нМ и фолиевую кислоту в концентрации 12,5-50 нМ, и отбор по меньшей мере одной эукариотической клетки-хозяина, экспрессирующей целевой продукт.

Настоящее изобретение относится к области иммунологии. Предложено полностью человеческое моноклональное антитело, которое связывает инсулиноподобный фактор роста-II (IGF-II) и имеет перекрестную реактивность к IGF-I, а также его антигенсвязывающий фрагмент.

Изобретение относится к области иммунологии. Предложено выделенное антитело к белку ICOS человека с повышенной эффекторной функцией.

Изобретение относится к области биотехнологии. Предложен способ культивирования эпителиальных стволовых клеток или выделенных фрагментов ткани, содержащих указанные эпителиальные стволовые клетки, включающий обеспечение внеклеточного матрикса, инкубирование эпителиальной стволовой клетки или выделенного фрагмента ткани, содержащего указанные эпителиальные стволовые клетки, с внеклеточным матриксом, культивирование эпителиальной стволовой клетки или выделенного фрагмента ткани в присутствии клеточной культуральной среды, содержащей базальную среду для клеток животного или человека, в которую добавлены ингибитор морфогенетического белка кости (BMP) и 5- 500 нг/мл митогенного фактора роста, а также клеточная культуральная среда, ее применение, способ культивирования трехмерного органоида, способ его получения, трехмерный органоид и его применение.

Изобретение относится к биотехнологии. Раскрыт способ выращивания эмбриональных стволовых клеток человека.

Изобретение относится к биотехнологии и медицине. Предложен способ дифференцировки мезенхимальных стволовых клеток фиброзированных легких в фибробластные клетки, характеризующийся тем, что из правой доли фиброзированных легких выделяют клетки с фенотипом мезенхимальных стволовых клеток (CD44+, CD73+, CD90+, CD106+, CD31-, CD34-, CD45-), способные самообновляться in vitro в течение 60 дней, затем при добавлении в культуру мезенхимальных стволовых клеток фактора роста фибробластов 2 мкг/мл получают фибробластные клетки.
Изобретение относится к области биотехнологии. ВНК-21/13-13 - перевиваемая монослойно-суспензионная сублиния клеток почки новорожденного сирийского хомячка задепонированна в Российской коллекции клеточных культур (РКК) в специализированной коллекции перевиваемых соматических клеточных культур сельскохозяйственных и промысловых животных при Всероссийском научно-исследовательском институте экспериментальной ветеринарии им.

Настоящее изобретение касается способа получения популяции клеток, экспрессирующих маркеры плюрипотентности и маркеры, характерные для линии сформированной эндодермы.

Группа изобретений относится к медицине, а именно к иммунологии, и может быть использована в лабораторной диагностике как тест-система и способ определения антивирусной активности интерферона альфа (ИФН-α) в сыворотке крови человека.

Изобретение относится к медицине, а именно к экспериментальной хирургии, и может быть использовано для лечения инфекционного перитонита в эксперименте. Для этого крысам внутривенно вводят суспензию аллогенных мезенхимальных стволовых клеток из расчета 1,5×106 на 100 г массы животного в 2 мл физиологического раствора.

Изобретение относится к области биотехнологии, в частности к выращиванию колоний клеток. Система культивирования плюрипотентных стволовых клеток состоит из соединенных между собой системы управления и блока культивирования.

Изобретение относится к области биотехнологии и иммунологии. Раскрыт способ промотирования регенеративных процессов в культуре ткани или культуре клеток.

Изобретение относится к области биотехнологии, конкретно к лентивирусной доставке апоптина в опухолевые ткани, и может быть использовано в медицине. Способ включает получение лентивирусного конструкта, экспрессирующего модифицированный апоптин, слитый с секреторным сигналом лактотрансферрина и трансдукторным сигналом (ST-CTP-апоптин), с последующим получением рекомбинантных лентивирусных частиц, дефектных по репликации и несущих модифицированный апоптин, которые затем вводятся в Т-лимфоциты (TILs), полученные при хирургическом удалении опухоли или в процессе получения биопсии, которые обладают способностью проникать в опухолевые ткани.
Изобретение относится к области биотехнологии и генетической инженерии. Предложен способ получения по меньшей мере одной трансфицированной эукариотической клетки-хозяина, экспрессирующей целевой продукт, включающий введение в клетку полинуклеотида, кодирующего целевой продукт, и полинуклеотида, кодирующего мутантный фермент дигидрофолатредуктазу по крайней мере одним вектором экспрессии, получение множества эукариотических клеток-хозяев, жизнеспособность которых зависит от потребления фолата, причем указанные эукариотические клетки-хозяева включают по меньшей мере чужеродный полинуклеотид, кодирующий целевой продукт, и чужеродный полинуклеотид, кодирующий фермент дигидрофолатредуктазу (ДГФР), культивирование указанного множества эукариотических клеток-хозяев в селективной культуральной среде, включающей метотрексат в концентрации 2,3-500 нМ и фолиевую кислоту в концентрации 12,5-50 нМ, и отбор по меньшей мере одной эукариотической клетки-хозяина, экспрессирующей целевой продукт.
Наверх