Эффективный транспорт в лейкоциты

Авторы патента:


Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты
Эффективный транспорт в лейкоциты

 


Владельцы патента RU 2558240:

Ксижен Инфлемейшн Лтд., (CY)

Изобретение относится к области биотехнологии. Описано применение специфических молекул-конъюгатов, которые являются транспортерами карго-молекул, для транспортировки представляющей интерес субстанции в лейкоциты. Указанные молекулы-конъюгаты, которые являются транспортерами карго-молекулы, можно применять для лечения, профилактики, ослабления и/или уменьшения интенсивности заболевания и/или нарушения, в котором принимают участие лейкоциты. Описаны также способ получения указанных молекул-конъюгатов, которые являются транспортерами карго-молекул, способ транспортировки представляющей интерес субстанции в лейкоциты и лейкоциты, содержащие указанные молекулы-конъюгаты, которые являются транспортерами карго-молекул. Изобретение может быть использовано в медицине. 5 н. и 21 з.п. ф-лы, 34 ил., 5 табл., 29 пр.

 

Настоящее изобретение относится к применению специфических молекул-конъюгатов, которые являются транспортерами переносимой молекулы (карго-молекулы), предназначенных для переноса представляющей интерес субстанции (карго-молекулы) в лейкоциты. Указанные молекулы-конъюгаты, которые являются транспортерами карго-молекул, можно применять для лечения, профилактики, ослабления и/или уменьшения интенсивности заболевания и/или нарушения, в которых принимают участие лейкоциты. Настоящее изобретение относится также к получению указанных молекул-конъюгатов, которые являются транспортерами карго-молекул, к способу переноса представляющей интерес субстанции (карго-молекула) в лейкоциты и к лейкоцитам, содержащим молекулы-конъюгаты, которые являются транспортерами карго-молекул, или их фрагменты.

Методики, позволяющие обеспечивать эффективный перенос представляющей интерес субстанции, такой как нуклеиновые кислоты, белки или цитотоксические агенты, но также и другие соединения, из внешней среды в ткань или клетки и, прежде всего в ядра клеток, представляют большой интерес в области биотехнологии. Эти методики, можно применять для переноса и транслокации нуклеиновых кислот в клетки in vitro и in vivo и, как следствие, для производства белка или полипептида, для регуляции генной экспрессии, для индукции цитотоксических или апоптозных действий, для анализа внутриклеточных процессов и для анализа воздействий, обусловленных транспортом широкого разнообразия различных карго-молекул в клетку (или ядро клетки), и т.д.

Одним из важных путей применения указанного переноса представляющей интерес карго-молекулы из наружной среды в ткань или клетку, является направленный перенос лекарственного средства. Направленный перенос лекарственного средства относится к специфическому для ткани/клетки переносу фармацевтически активного лекарственного средства. Изобретение должно обеспечивать достижение после (системного) введения в течение определенного промежутка времени высокой концентрации фармацевтически активного лекарственного средства в клетках и тканях, представляющих интерес, сохраняя при этом в остальных клетках и тканях низкую концентрацию фармацевтически активного лекарственного средства. Это повышает эффективность терапии и снижает побочные действия. Указанный направленный перенос лекарственного средства можно обеспечивать, например, с помощью высоко специфических антител.

Другой важной областью применения указанного переноса представляющей интерес карго-молекулы из внешней среды в ткань или клетку, является генная терапия, в которой карго-молекула, как правило, представляет собой нуклеиновую кислоту или ген. Хотя, как известно, в последние десятилетия достигнуты многообещающие результаты в совершенствовании этого метода, применение переноса генов, как правило, ограничено из-за отсутствия у векторов, предназначенных для транспорта генов, способности к эффективному переносу биологически активных карго-молекул в цитоплазму или ядра клеток в организме хозяина, подлежащего лечению, без воздействия на геном хозяина или изменения биологических свойств активной карго-молекулы.

С учетом этого было разработано несколько методик, способствующих более эффективной трансфекции клеток, например, нуклеиновыми кислотами, такими как ДНК или РНК. Трансфекция нуклеиновыми кислотам клеток или тканей пациентов с помощью метода переноса генов представляет собой основной метод молекулярной медицины, и она имеет решающее значение для лечения и предупреждения многочисленных заболеваний.

Репрезентативными примерами методов переноса генов являются общепринятые (физические или физико-химические) методы, такие как копреципитация нуклеиновых кислот с фосфатом кальция или ДЭАЭ-декстраном, метод, который обеспечивает проникновение нуклеиновых кислот в плазматическую мембрану, а затем поступать в клетку и/или ядро. Однако недостатком этого метода является низкая эффективность переноса и высокий процент гибели клеток. Кроме того, указанный метод можно применять только в условиях in vitro или ex vivo, но он не применим в ситуациях in vivo из-за их специфических природных особенностей.

Это же можно отнести к методам, включающим электропорацию in vitro. Электропорация in vitro основана на применении тока высокого напряжения для того, чтобы сделать клеточные мембраны достаточно проницаемыми с целью интродукции в клетку новых нуклеиновых кислот, например, ДНК или РНК. Однако такие методы, как правило, не пригодны для применения in vivo. Кроме того, недостатками этого метода являются также низкая эффективность переноса и высокий процент гибели клеток.

Другие хорошо известные физические или физико-химические методы включают (непосредственную) инъекцию («голых») нуклеиновых кислот или биобаллистический перенос генов. Биобаллистический перенос генов (известный также как бомбардировка биобаллистическими частицами) представляет собой метод, разработанный в Корнельском университете, который позволяет интродуцировать генетический материал в ткани или культуры клеток. Биобаллистический перенос генов, как правило, осуществляют путем нанесения покрытия на поверхность металлических частиц, таких как золотые или серебряные частицы, и бомбардировки этими металлическими частицами, содержащими адсорбированную ДНК, клеток с помощью генной пушки. Аналогично описанным выше методам этот метод можно применять только в условиях in vitro или ex vivo, но, как правило, он не применим в ситуациях in vivo.

Другие методы основаны на транспортных способностях так называемых молекул-транспортеров. В этом контексте предназначенные для применения молекулы-транспортеры, как правило, можно подразделять на вирусные векторы, с одной стороны, т.е. молекулы-транспортеры, которые включают вирусные элементы, и невирусные векторы, с другой стороны.

Наиболее успешные применяемые в настоящее время стратегии генной терапии основаны на вирусных векторах, таких как аденовирусы, аденоассоциированные вирусы, ретровирусы и вирусы герпеса. Эти вирусные векторы, как правило, применяют для конъюгации родственной вирусу субстанции, обладающей высокой аффинностью к ДНК и нуклеиновой кислоте. Из-за их инфекционных свойств вирусы или вирусные векторы обладают очень высоким уровнем трансфекции. Вирусные векторы, как правило, представляют собой вирусы, генетически модифицированные таким образом, чтобы в трансфектированных клетках не образовывались функциональные инфекционные частицы. Однако в свете указанных мер предосторожности, связанных с безопасностью, существует много проблем, ассоциированных с вирусными векторами, которые связаны с иммуногенностью, цитотоксичностью и инсерционным мутагенезом. Например, нельзя исключать риск неконтролируемого увеличения интродуцированных терапевтически активных генов или вирусных генов, например, из-за возможных случаев рекомбинации. Кроме того, включающие вирусы конъюгаты трудно применять, и их использование, как правило, требует длительного периода подготовки перед осуществлением обработки (см., например, US №5521291).

Невирусные векторы являются менее эффективными, чем вирусные векторы, при их применении в генной терапии; однако многие из них созданы в качестве безопасной альтернативы генной терапии. Некоторые из наиболее распространенных невирусных векторов включают транспортные системы на основе полиэтиленимина, дендримеров, хитозана, полилизина и полипептидов, например, многих типов полипептидов, которые, как правило, являются катионными по природе и обладают способностью взаимодействовать с нуклеиновыми кислотами, такими как плазмидная ДНК, посредством электростатических взаимодействий. Кроме того, невирусные векторы позволяют также осуществлять введение лекарственных средств, основой которых не являются нуклеиновые кислоты.

Для обеспечения успешного введения невирусные векторы, в частности транспортные системы на основе полипептидов, должны обладать способностью преодолевать многие барьеры. Такие барьеры включают защиту фрагмента карго-молекулы (карго-фрагмента), например, ДНК или других соединений, в процессе транспорта и предупреждают раннее расщепление или метаболизм карго-фрагмента in vivo. В случае нуклеиновых кислот, таких как молекулы ДНК и РНК, невирусные векторы также могут обладать способностью к специфическому введению этих молекул для эффективной экспрессии генов в клетках-мишенях.

Так, касательно нуклеиновых кислот, таких как молекулы ДНК и РНК, известно 4 барьера, которые должны преодолеть невирусные векторы для обеспечения успешного введения гена (см., например, Martin и др., The AAPS Journal, 9(1), 2007, статья 3). Невирусные векторы должны обладать способностью 1) плотно сжимать и защищать нуклеиновые кислоты, 2) они должны обладать способностью направленно воздействовать на специфические для клеток поверхностные рецепторы, 3) невирусные векторы должны обладать способностью разрушать эндосомальную мембрану и 4) они должны обеспечивать введение карго-молекулы, представляющей собой нуклеиновую кислоту, в ядро и давать возможность транслироваться кодируемой белковой или полипептидной последовательности.

Указанные невирусные векторы, прежде всего невирусные векторы, основой которых являются полипептиды, обладают преимуществом по сравнению с другими стратегиями, основанными на применении невирусных векторов, состоящим в том, что они, как правило, обладают способностью решать все 4 указанные задачи, однако с различной эффективностью в отношении различных барьеров.

Например, катионные полипептиды, богатые основными остатками, такими как лизин и/или аргинин, обладают способностью эффективно конденсировать нуклеиновые кислоты, такие как ДНК, в небольшие компактные частицы, которые могут стабилизоваться в сыворотке. Кроме того, присоединение полипептидного лиганда с полиплексом позволяет обеспечивать направленный перенос к специфическим рецепторам и/или специфическим типам клеток. Как отмечалось выше, полиплексы или катионные полимеры, как правило, формируют комплексы с отрицательно заряженными нуклеиновыми кислотами, что приводит к конденсации нуклеиновых кислот и защите этих нуклеиновых кислот от расщепления. Транспорт в клетки с помощью полиплексов (катионных полимеров), как правило, происходит посредством опосредуемого рецептором эндоцитоза. При этом ДНК сшивают с отличной от нее молекулой, такой как трансферрин, например, через полиплекс поли-L-лизин (PLL), который связывается с поверхностным рецептором и инициирует эндоцитоз. Полиплексы (катионные полимеры) включают, например, поли-L-лизин (PLL), хитозан, полиэтиленимин (PEI), полидиметиламиноэтилметакрилат (PD-MAEMA), полиамидоамин (РАМАМ). Известно, что такие действия характерны также для наноплексов (системы на основе наночастиц) или липоплексов (системы на основе липосом). Наноплексы (системы на основе наночастиц), как правило, предусматривают применение полиакрилатов, полиамидов, полистирола, цианакрилатов, полилактата (PLA), сополимера молочной и гликолевой кислоты (PLGA) и т.д. Липоплексы или липосомные системы, как правило, предусматривают применение катионных липидов, которые обладают способностью имитировать клеточную мембрану. При этом положительно заряженный остаток липида взаимодействует с отрицательно заряженным остатком нуклеиновой кислоты и тем самым может обеспечивать слияние с клеточной мембраной. Липоплексы или липосомные системы включают, например, DOTMA, DOPE, DOSPA, DOTAP, DC-Chol, EDMPC и т.д.

В этом контексте опосредуемый рецептором эндоцитоз также широко используется в экспериментальных системах, предназначенных для направленного введения карго-молекул, таких как нуклеиновые кислоты или терапевтические агенты, в клетки. В процессе опосредуемого рецептором эндоцитоза содержащие карго-молекулу комплексы либо избирательно интернализируются рецепторами, локализованными в клеточной мембране, которые являются специфическими для карго-молекулы, либо специфическими антителами, локализованными в компонентах мембраны. Эндоцитозная активность описана для многих рецепторов, включая IgG-Fc, рецепторы соматостатина, инсулина, IGF-I и -II, трансферрина, EGF, GLP-1, VLDL или интегрина и т.д.

Различные полипептидные или белковые последовательности всесторонне протестированы в отношении их применения в методах переноса генов с помощью опосредуемого рецептором эндоцитоза. Важно отметить, что выделение полипептидных последовательностей, которые контролируют эффективный опосредуемый рецептором эндоцитоз, в значительной степени усовершенствовалось в результате применения методов фагового дисплея. Фаговые дисплейные библиотеки представляют собой чрезвычайно эффективные инструменты, которые являются практически неограниченными источниками молекулярных вариантов, включая модификации встречающихся в естественных условиях лигандов или карго-фрагментов клеточных рецепторов и коротких полипептидов. Подобные библиотеки инъецировали также непосредственно мышам и успешно выделяли полипептидные последовательности, которые обладали 13-кратной селективностью в отношении головного мозга и почки.

Пропротеинконвертазы могут служить примером полипептидных или белковых последовательностей, которые можно применять для транспорта молекул в клетки. Пропротеинконвертазы являются примером рецептора клеточной поверхности, который интернализируется в результате опосредуемого рецептором эндоцитоза. Установлено, что эти белки ответственны за превращение предшественников полипептидных гормонов, нейропептидов и многих других белков в их биологически активные формы. Все сайты расщепления семейства пропротеинконвертаз характеризуются наличием консенсусной последовательности R-X-X-R. Пропротеинконвертазы млекопитающих можно подразделить на 3 группы на основе их распределения в тканях. Фурин, РАСЕ4, РС5/РС6 и LPCIPC7/PC8/SPC7 экспрессируются в широком разнообразии тканей и клеточных линий. В отличие от этого, экспрессия РС2 и РС1/РС3 ограничена нейроэндокринными тканями, такими как панкреатические островки, гипофиз, мозговое вещество надпочечников и многие области головного мозга. Экспрессия РС4 в значительной степени ограничена тестикулярными сперматогенными клетками. Специфические для нейроэндокринной ткани конвертазы, РС2 и РС1/РС3, главным образом локализованы в секреторных гранулах. Опубликованы также данные о том, что РС5/РС6А локализованы в секреторных гранулах. Кроме того, имеются косвенные данные, которые позволяют предположить, что часть молекул пропротеинконвертаз присутствует на клеточной поверхности, и было установлено, что фурин циркулирует между TGN (транс-сеть аппарата Гольджи) и клеточной поверхностью. Взятые в совокупности эти свойства свидетельствуют о том, что пропротеинконвертазы транспортируют внеклеточные лиганды во внутриклеточное пространство.

Представляют интерес также так называемые транслокаторные белки или домены белковой трансдукции (PTD). Полипептидные последовательности, выведенные из транслокаторных белков или доменов белковой трансдукции (PTD), как правило, обладают способностью осуществлять избирательный лизис эндосомальной мембраны в ее кислотном окружении, приводя к высвобождению полиплекса в цитоплазму. Транслокаторные белки рассматриваются в качестве группы полипептидов, обладающих способностью осуществлять транспорт макромолекул между клетками (транслокаторные белки), к ним относятся белок ТАТ вируса ВИЧ-ЦВИЧ), белок гена antennapedia (Drosophila antennapedid), VP22 HSV (вирус герпеса простого), FGF или лактоферрин и т.д. В отличие от этого домены белковой трансдукции (PTD) рассматриваются в качестве группы полипептидов, которые обладают способностью направлять белки и полипептиды, ковалентно связанные с этими последовательностями, в клетку через мембрану (Leifert и Whitton: Translocatory proteins and protein transduction domains: a critical analysis of their biological effects and the underlying mechanisms. Molecular Therapy, т.8, №1, 2003). Общей для транслокаторных белков, а также для PTD является основная область, которая рассматривается как основной элемент, ответственный за транспорт слитых полипептидов, поскольку она обладает способностью связывать полианионы, такие как нуклеиновые кислоты. Не вдаваясь в теорию, можно предположить, что PTD действуют подобно катионным трансфектирующим реагентам, используя зависящий от рецептора ненасыщаемый адсорбтивный эндоцитоз. PTD, как правило, сшивают с белками или полипептидами для того, чтобы оказывать воздействие или повышать CTL-ответ при введении вакцины на основе полипептида (см. Melikov и Chernomordik, Arginine-rich cell penetrating polypeptides: from endosomal uptake to nuclear delivery. Cell. Mol. Life Sci., 2005).

Хотя, в целом, в данной области известно несколько методов, обеспечивающих перенос представляющей интерес субстанции из наружной среды в ткань или клетки, все еще существует выраженная необходимость в методиках, позволяющих осуществлять эффективный перенос в конкретные типы тканей и клеток.

Таким образом, объектом настоящего изобретения являются новые средства для направленного переноса карго-молекулы, например, лекарственных средств и эффекторных молекул, эффективно и с улучшенной специфичностью в конкретные типы тканей и клеток.

Эта задача решается для лейкоцитов (WBC) с помощью средств, являющихся объектом изобретения, которые представлены в прилагаемой формуле изобретения. В частности, при создании настоящего изобретения неожиданно было установлено, что определенные типы полипептидов обеспечивают эффективный перенос представляющей интерес карго-молекулы в лейкоциты.

Понятие «обеспечивающий направленный перенос в WBC полипептид» в контексте настоящего описания относится к полипептиду, который обладает способностью проникать в лейкоциты с повышенной специфичностью (по сравнению, например, с HepG2-клетками (клетки карциномы печени человека) или НСТ-116-клетками (клетки карциномы ободочной кишки человека)) и который получают из белка ТАТ ВИЧ, т.е. он содержит или состоит из аминокислотой последовательности, представляющей собой фрагмент или вариант (или вариант указанного фрагмента белка ТАТ ВИЧ (SEQ ID NO:1; описана в US №№5804604 и 5674980, каждая из указанных ссылок включена в настоящее описание в качестве ссылки). В частности, указанные фрагменты, варианты и варианты указанных фрагментов получают из остатков ТАТ 49-57 (SEQ ID NO:2) или 48-57 (SEQ ID NO:3). Эта аминокислотная последовательность может содержать D-аминокислоты и/или L-аминокислоты.

Понятие «полипептиды» в контексте настоящего изобретения имеет значение, общепринятое в данной области, например, относится к цепи аминокислот. Однако не следует рассматривать, что понятие накладывает ограничение на длину аминокислотной цепи. Также не является обязательным, чтобы цепь была линейной, она может быть и разветвленной.

Предпочтительно обеспечивающий направленный перенос в WBC полипептид содержит менее 150, 100, 90, 80, 70, 60, 50, 40, 30, 20 или 10 аминокислотных остатков, более предпочтительно от 5 до 150 аминокислотных остатков, более предпочтительно от 5 до 100 аминокислотных остатков, еще более предпочтительно от 5 до 75 аминокислотных остатков и наиболее предпочтительно от 9 до 50 аминокислотных остатков, например, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40 или 50 аминокислотных остатков.

Приведенные в качестве примера последовательности полипептидов, которые обеспечивают направленный перенос в WBC, могут содержать или состоять из последовательностей, представленных в таблице 1.

Таблица 1
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
ТАТ (1-86) 1 86 MEPVDPRLEP WKHPGSQPKT ACTNCYCKKC CFHCQVCFIT KALGISYGRK KRRQRRRPPQ GSQTHQVSLS KQPTSQSRGD PTGPKE
L-TAT (s1a) 2 9 RKKRRQRRR (NH2-RKKRRQRRR-COOH)
L-TAT (s1b) 3 9 GRKKRRQRRR (NH2-GRKKRRQRRR-COOH)
D-TAT 4 9 rrrqrrkkr (NH2-RRRQRRKKR-COOH)
D-TAT 5 10 rrrqrrkkrg (NH2-RRRQRRKKRG-COOH)
L-дженерик-ТАТ (s) 6 NH2-Xnb-RKKRRQRRR-Xnb-COOH
D-дженерик-ТАТ (s) 7 NH2-Xnb-rrrqrrkkr-Xnb-СООН
TAT (37-72) 8 36 CFITKALGIS YGRKKRRQRR RPPQGSQTHQ VSLSKQ
TAT (37-58) 9 22 CFITKALGIS YGRKKRRQRR RP
TAT (38-58)GGC 10 24 FITKALGISY GRKKRRQRRR PGGC
TAT CGG (47-58) 11 15 CGGYGRKKRR QRRRP
TAT (47-58) GGC 12 15 YGRKKRRQRR RPGGC
TAT (1-72) MutCys/Ala72 13 56 MEPVDPRLEP WKHPGSQPKT AFITKALGIS YGRKKRRQRR RPPQGSQTHQ VSLSKQ
L-TAT (slc) 14 11 YDRKKRRQRRR
r3-L-TAT 15 9 rKKRrQRRr
r3-L-TATi 16 9 rRRQrRKKr
βA-r3-L-TAT 17 9 βA-rKKRrQRRr
βА-r3-L-TATi 18 9 βA-rRRQrRKKr
FITC-βA-r3-L-TAT 19 9 FITC-βA-rKKRrQRRr
FITC-βA-r3-L-TATi 20 9 FITC-βA-rRRQrRKKr
TAT (s2-1) 21 9 rAKRrQRRr
TAT (s2-2) 22 9 rKARrQRRr
TAT (s2-3) 23 9 rKKArQRRr
TAT (s2-4) 24 9 rKKRrARRr
TAT (s2-5) 25 9 rKKRrOARr
TAT (s2-6) 26 9 rKKRrQRAr
TAT (s2-7) 27 9 rDKRrQRRr
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
TAT (s2-8) 28 9 rKDRrQRRr
TAT (s2-9) 29 9 rKKDrQRRr
TAT (s2-10) 30 9 rKKRrDRRr
TAT (s2-11) 31 9 rKKRrQDRr
TAT (s2-12) 32 9 rKKRrQRDr
TAT (s2-13) 33 9 rEKRrQRRr
TAT (s2-14) 34 9 rKERrQRRr
TAT (s2-15) 35 9 rKKErQRRr
TAT (s2-16) 36 9 rKKRrERRr
TAT (s2-17) 37 9 rKKRrQERr
TAT (s2-18) 38 9 rKKRrQREr
TAT (s2-19) 39 9 rFKRrQRRr
TAT (s2-20) 40 9 rKFRrQRRr
TAT (s2-21) 41 9 rKKFrQRRr
TAT (s2-22) 42 9 rKKRrFRRr
TAT (s2-23) 43 9 rKKRrQFRr
TAT (s2-24) 44 9 rKKRrQRFr
TAT (s2-25) 45 9 rRKRrQRRr
TAT (s2-26) 46 9 rKRRrQRRr
TAT (s2-27) 47 9 rKKKrQRRr
TAT (s2-28) 48 9 rKKRrRRRr
TAT (s2-29) 49 9 rKKRrQKRr
TAT (s2-30) 50 9 rKKRrQRKr
TAT (s2-31) 51 9 rHKRrQRRr
TAT (s2-32) 52 9 rKHRrQRRr
TAT (s2-33) 53 9 rKKHrQRRr
TAT (s2-34) 54 9 rKKRrHRRr
TAT (s2-35) 55 9 rKKRrQHRr
TAT (s2-36) 56 9 rKKRrQRHr
TAT (s2-37) 57 9 rIKRrQRRr
TAT (s2-38) 58 9 rKIRrQRRr
TAT (s2-39) 59 9 rKKIrQRRr
TAT (s2-40) 60 9 rKKRrIRRr
TAT (s2-41) 61 9 rKKRrQIRr
TAT (s2-42) 62 9 rKKRrQRIr
TAT (s2-43) 63 9 rLKRrQRRr
TAT (s2-44) 64 9 rKLRrQRRr
TAT (s2-45) 65 9 rKKLrQRRr
TAT (s2-46) 66 9 rKKRrLRRr
TAT (s2-47) 67 9 rKKRrQLRr
TAT (s2-48) 68 9 rKKRrQRLr
TAT (s2-49) 69 9 rMKRrQRRr
TAT (s2-50) 70 9 rKMRrQRRr
TAT (s2-51) 71 9 rKKMrQRRr
TAT (s2-52) 72 9 rKKRrMRRr
TAT (s2-53) 73 9 rKKRrQMRr
TAT (s2-54) 74 9 rKKRrQRMr
TAT (s2-55) 75 9 rNKRrQRRr
TAT (s2-56) 76 9 rKNRrQRRr
TAT (s2-57) 77 9 rKKNrQRRr
TAT (s2-58) 78 9 rKKRrNRRr
TAT (s2-59) 79 9 rKKRrQNRr
TAT (s2-60) 80 9 rKKRrQRNr
TAT (s2-61) 81 9 rQKRrQRRr
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
TAT (s2-62) 82 9 rKQRrQRRr
TAT (s2-63) 83 9 rKKQrQRRr
TAT (s2-64) 84 9 rKKRrKRRr
TAT (s2-65) 85 9 rKKRrQQRr
TAT (s2-66) 86 9 rKKRrQRQr
TAT (s2-67) 87 9 rSKRrQRRr
TAT (s2-68) 88 9 rKSRrQRRr
TAT (s2-69) 89 9 rKKSrQRRr
TAT (s2-70) 90 9 rKKRrSRRr
TAT (s2-71) 91 9 rKKRrQSRr
TAT (s2-72) 92 9 rKKRrQRSr
TAT (s2-73) 93 9 rTKRrQRRr
TAT (s2-74) 94 9 rKTRrQRRr
TAT (s2-75) 95 9 rKKTrQRRr
TAT (s2-76) 96 9 rKKRrTRRr
TAT (s2-77) 97 9 rKKRrQTRr
TAT (s2-78) 98 9 rKKRrQRTr
TAT (s2-79) 99 9 rVKRrQRRr
TAT (s2-80) 100 9 rKVRrQRRr
TAT (s2-81) 101 9 rKKVrQRRr
TAT (s2-82) 102 9 rKKRrVRRr
TAT (s2-83) 103 9 rKKRrQVRr
TAT (s2-84) 104 9 rKKRrQRVr
TAT (s2-85) 105 9 rWKRrQRRr
TAT (s2-86) 106 9 rKWRrQRRr
TAT (s2-87) 107 9 rKKWrQRRr
TAT (s2-88) 108 9 rKKRrWRRr
TAT (s2-89) 109 9 rKKRrQWRr
TAT (s2-90) 110 9 rKKRrQRWr
TAT (s2-91) 111 9 rYKRrQRRr
TAT (s2-92) 12 9 rKYRrQRRr
TAT (s2-93) 13 9 rKKYrQRRr
TAT (s2-94) 14 9 rKKRrYRRr
TAT (s2-95) 15 9 rKKRrQYRr
TAT (s2-96) 16 9 rKKRrQRYr
r3 (дженерик) 235 9 rXXXrXXXr

В таблице 1 D-энантиомерные аминокислоты обозначены прописными буквами, а L-энантиомерные аминокислоты обозначены заглавными буквами. Все последовательности записаны в направлении от N-конца к С-концу (слева направо). «βА» обозначает бета-аланин. В SEQ ID NO:6 и SEQ ID NO:7 каждый X, как правило, обозначает аминокислотный остаток, предпочтительно выбранный из любого (нативного) аминокислотного остатка. Xna, как правило, обозначает один аминокислотный остаток, предпочтительно выбранный из любого аминокислотного остатка кроме серина или треонина, где n (число повторений X) обозначает 0 или 1. Кроме того, каждый Xnb можно выбирать из любого аминокислотного остатка, где n (число повторений X) обозначает 0-5, 5-10, 10-15, 15-20, 20-30 или более при условии, что, если n (число повторений X) обозначает 0 для Xna, Xnb предпочтительно не содержит серии или треонин на С-конце для того, чтобы избежать присутствия серина или треонина в этом положении. Предпочтительно Xnb обозначает состоящий из смежных полипептидных остатков участок, полученный из SEQ ID NO:1. Xna и Xnb могут обозначать либо D-, либо L-аминокислоты.

Обеспечивающий направленный перенос в WBC полипептид, предназначенный для применения в различных вариантах осуществления настоящего изобретения, может представлять собой, например, полипептид, который содержит или состоит из аминокислотной последовательности ТАТ ВИЧ, остатки 49-57 (SEQ ID NO:2), или ее (химического) производного или его варианта, или ее варианта, где вариант SEQ ID NO:2 выбирают из группы, включающей:

I) полипептид, который содержит или состоит по меньшей мере из одной аминокислотной последовательности, представленной в SEQ ID NO:235, ее (химического) производного или обратной ей последовательности, и

II) полипептид, который содержит или состоит по меньшей мере из одной аминокислотной последовательности, представленной в одной из SEQ ID NO:2-116, ее (химического) производного или обратной ей последовательности.

В наиболее предпочтительном варианте осуществления изобретения вариант фрагмента белка ТАТ ВИЧ представляет собой полипептид, содержащий аминокислотную последовательность, представленную в одной из SEQ ID NO:1-116, более предпочтительно полипептид, который содержит или состоит из аминокислотной последовательности L-TAT (SEQ ID NO:2), D-TAT (SEQ ID NO:4), r3-L-TAT (SEQ ID NO:15), r3-L-TATi (SEQ ID NO:16), TAT (s2-28) (SEQ ID NO:48), TAT (s2-64) (SEQ ID NO:84) или TAT (s2-91) (SEQ ID NO:111).

В конкретном предпочтительном варианте осуществления изобретения обеспечивающий направленный перенос в WBC полипептид содержит или состоит по меньшей мере из одной из последовательности, представленной в виде rXXXrXXXr (SEQ ID NO:235), в которой

r обозначает D-энантиомерный аргинин;

Х обозначает любую из L-аминокислот;

и в которой Х каждый может быть выбран индивидуально и независимо от любых других X, присутствующих в SEQ ID NO:252. Предпочтительно по меньшей мере 4 из 6 обозначенных Х L-аминокислот в SEQ ID NO:235 обозначают K или R. В другом варианте осуществления изобретения обеспечивающий направленный перенос в WBC полипептид, предлагаемый в настоящем изобретении, содержит или состоит из последовательности rX1X2X3rX4X5X6r (SEQ ID NO:235), в которой X1 обозначает K, X2 обозначает K, Х3 обозначает R и Х4, Х5 и Х6 обозначают любую L-аминокислоту, выбранную независимо друг от друга. Аналогично этому, конструкция транспортера, предлагаемая в настоящем изобретении, может содержать или состоять из последовательности rX1X2X3rX4X5X6r (SEQ ID NO:235), в которой Х4 обозначает Q, Х5 обозначает R, Х6 обозначает R и X1, X2, и Х3 обозначают любую L-аминокислоту, выбранную независимо друг от друга. Предлагаемая в изобретении конструкция транспортера может содержать также или состоять из последовательности rX1X2X3rX4X5X6r (SEQ ID NO:235), в которой один, два, три, четыре, пять или шесть аминокислотных остатков Х выбирают из группы, в которой: X1 обозначает K, X2 обозначает K, Х3 обозначает R, Х4 обозначает Q, X5 обозначает R, Х6 обозначает R, а остальные аминокислотные остатки X, которые не выбраны из указанной выше группы, могут представлять собой любую L-аминокислоту, и их выбирают независимо друг от друга. Кроме того, X1 предпочтительно обозначает Y и/или Х4 предпочтительно обозначает К или R. Аналогичные положения относятся к обратным последовательностям и/или химическим вариантам указанных выше последовательностей и вариантов SEQ ID NO:235.

Кроме того, обеспечивающие направленный перенос в WBC полипептиды можно выбирать из фрагментов или вариантов указанных выше обеспечивающих направленный перенос в WBC полипептидов, которые представлены в таблице 1, при условии, что они сохраняют функциональную активность/способность проникать в WBC с высокой селективностью. В частности, варианты последовательностей, представленных в таблице 1, не обязательно должны иметь такую же последовательность D- и L-аминокислот, т.е. они могут полностью состоять из D-аминокислот, полностью состоять из L-аминокислот или состоять из произвольной смеси D- и L-аминокислот.

В контексте настоящего изобретения варианты и/или фрагменты полипептида предпочтительно содержат или состоят из полипептидной последовательности, которая по меньшей мере на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% или 85%, предпочтительно по меньшей мере на 90%, более предпочтительно по меньшей мере на 95% и наиболее предпочтительно по меньшей мере на 99% идентична по всей длине последовательности референс-полипептида. Кроме того, фрагмент указанного полипептида может содержать также эпитопы (которые обозначают также как «антигенные детерминанты») полноразмерной последовательности. Эпитопы в контексте настоящего изобретения, как правило, представляют собой фрагменты, локализованные на наружной поверхности (нативной) белковой или полипептидной последовательности, указанной в настоящем изобретении, предпочтительно состоят из 5-15 аминокислот, более предпочтительно состоят из 5-12 аминокислот, еще более предпочтительно состоят из 6-9 аминокислот, которые могут распознаваться антителами, т.е. находятся в их исходной форме.

Под «фрагментом» в контексте настоящего описания, в частности обеспечивающего направленный перенос в WBC полипептида, представленного в таблице 1, предпочтительно подразумевается его укороченная последовательность, т.е. аминокислотная последовательность, которая на N-конце, С-конце и/или внутри последовательности укорочена по сравнению с аминокислотной последовательностью исходной последовательности.

Кроме того, в контексте настоящего изобретения под «вариантом» полипептида предпочтительно подразумевается последовательность, при этом аминокислотная последовательность варианта отличается от последовательности указанного полипептида (или его фрагмента) одной или несколькими мутацией(ями), такой(ими) как одна или несколько замен (или при необходимости инсерцией и/или делеций) аминокислот. Варианты обладают в основном такой же биологической функцией или специфической активностью, что и полноразмерная исходная последовательность. Касательно вариантов обеспечивающих направленный перенос в WBC полипептидов это означает, что они все еще обладают способностью обеспечивать транспорт в WBC-клетки. Более предпочтительно вариант может включать примерно 1-50, 1-20, еще более предпочтительно 1-10 и наиболее предпочтительно 1-5, 4, 3, 2 или 1 изменение аминокислот в пределах указанных выше значений. Варианты могут содержать консервативные аминокислотные замены. Консервативные аминокислотные замены могут включать замены аминокислотных остатков на другие аминокислотные остатки, которые обладают в достаточной степени сходными физико-химическими свойствами, что должно сохранять биологическую активность молекулы (см., например, Grantham R., Science 185, 1974, сс.862-864). Специалистам в данной области должно быть очевидно, что аминокислоты можно также встраивать и/или изымать путем делеции из указанных выше последовательностей без изменения их функции, в частности, если инсерции и/или делеции затрагивают лишь несколько аминокислот, например, менее 20 и предпочтительно менее 10, и что недопустимо удалять или заменять аминокислоты, которые имеют решающее значение для функциональной активности. Консервативные аминокислотные замены предпочтительно представляют собой замены, в которых аминокислоты, относящиеся к одному и тому же классу аминокислот (основные аминокислоты, кислые аминокислоты, полярные аминокислоты и т.д.), заменяют друг на друга. В этом отношении важными являются алифатические боковые цепи, положительно или отрицательно заряженные боковые цепи, ароматические группы в боковых цепях аминокислот, боковые цепи, которые могут обеспечивать образование водородных связей, например, боковые цепи с гидроксильной функцией. Это означает, что, например, аминокислоту с полярной боковой цепью заменяют на другую аминокислоту с подобной полярной боковой цепью или, например, аминокислоту, отличающуюся гидрофобной боковой цепью, заменяют на другую аминокислоту с подобной гидрофобной боковой цепью (например, серии (треонин) на треонин (серин) или лейцин (изолейцин) на изолейцин (лейцин)). Синонимические аминокислотные остатки, которые представляют собой остатки, отнесенные к одной и той же группе, и которые, как правило, можно заменять друг на друга путем консервативных аминокислотных замен, приведены в таблице 2.

Таблица 2
Предпочтительные группы синонимических аминокислотных остатков
Аминокислота Синонимический остаток
Ser Ser, Thr, Gly, Asn
Arg Arg, Gin, Lys, Glu, His
Leu Ile, Phe, Tyr, Met, Val, Leu
Pro Gly, Ala, (Thr), Pro
Thr Pro, Ser, Ala, Gly, His, Gln, Thr
Ala Gly, Thr, Pro, Ala
Val Met, Tyr, Phe, He, Leu, Val
Gly Ala, (Thr), Pro, Ser, Gly
Ile Met, Tyr, Phe, Val, Leu, Ile
Phe Trp, Met, Tyr, He, Val, Leu, Phe
Tyr Trp, Met, Phe, He, Val, Leu, Tyr
Cys Ser, Thr, Cys
His Glu, Lys, Gln, Thr, Arg, His
Gln Glu, Lys, Asn, His, (Thr), Arg, Gln
Asn Gln, Asp, Ser, Asn
Lys Glu, Gln, His, Arg, Lys
Asp Glu, Asn, Asp
Glu Asp, Lys, Asn, Gln, His, Arg, Glu
Met Phe, He, Val, Leu, Met
Trp Trp

В конкретном варианте осуществления изобретения вариант представляет собой вариант SEQ ID NO:2, выбранный из группы, включающей:

I) полипептид, который содержит или состоит по меньшей мере из одной аминокислотной последовательности, представленной в SEQ ID NO:235, ее (химического) производного или обратной ей последовательности, и

II) полипептид, который содержит или состоит по меньшей мере из одной аминокислотной последовательности, представленной в одной из SEQ ID NO:2-116, ее (химического) производного или обратной ей последовательности.

Функциональную способность/активность фрагментов или вариантов можно оценивать с помощью различных анализов, например, по эффективности трансфекции, правильной экспрессии белков, кодируемых карго-молекулами, представляющими собой нуклеиновые кислоты, или с помощью биофизических методов, например, с помощью спектроскопии, компьютерного моделирования, структурного анализа и т.д. Их можно исследовать с помощью анализа гидрофильности (см., например, Норр и Woods, Proc Natl Acad Sci USA 78, 1981, сс.3824-3828), который можно использовать для идентификации гидрофобных и гидрофильных областей полипептидов, что позволяет создавать субстраты для экспериментальных исследований. Для идентификации областей полипептидов или их вариантов и/или фрагментов можно осуществлять также анализ вторичной структуры, с помощью которого определяют специфические структурные мотивы (см., например, Chou и Fasman, Biochem 13, 1974, cc.222-223). Для манипуляции, трансляции, предсказания вторичной структуры, определения профилей гидрофильности и гидрофобности, предсказания и создания открытых рамок считывания и определения гомологии последовательностей можно использовать компьютерные пакеты программ, существующие в данной области. Можно применять также другие методы структурного анализа, в том числе, например, рентгеновскую кристаллографию (см., например, Engstrom, Biochem Exp Biol 11, 1974, cc.7-13), масс-спектроскопию и газовую хроматографию (см., например, methods IN protein science, изд-во J. Wiley and Sons, New York, NY, 1997). Можно применять также компьютерное моделирование (см., например, Computer Graphics and Molecular Modeling, в: Current Communications in Molecular Biology, под ред. Fletterick и Zoller, изд-во Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1986).

Для последовательностей (аминокислотных или нуклеотидных), не имеющих точного соответствия друг другу, можно определять «% идентичности» первой последовательности относительно второй последовательности. В целом, метод заключается в том, что эти две подлежащие сравнению последовательности выравнивают (подвергают сравнительному анализу), добиваясь максимальной корреляции между последовательностями. Эта процедура может включать встраивание «брешей» в одну или обе последовательности для повышения степени выравнивания (эффективности сравнительного анализа первичной структуры последовательностей). Затем % идентичности можно определять по всей длине каждой подлежащей сравнению последовательности (так называемый глобальный сравнительный анализ первичной структуры), что является более приемлемым для последовательностей, имеющих одинаковую или близкую длину, или для более коротких участков определенной длины (так называемый локальный сравнительный анализ первичной структуры), что является наиболее приемлемым для последовательностей, имеющих разную длину. В указанном контексте подразумевается, что понятие «аминокислотная последовательность, отличающаяся «идентичностью последовательности», составляющей по меньшей мере, например 95%, относительно запрашиваемой аминокислотной последовательности» означает, что последовательность рассматриваемой аминокислотной последовательности идентична запрашиваемой последовательности за исключением того, что рассматриваемая аминокислотная последовательность может включать вплоть до 5 аминокислотных изменений на каждые 100 аминокислот запрашиваемой аминокислотной последовательности. Другими словами, для получения аминокислотной последовательности, идентичной по меньшей мере на 95% запрашиваемой аминокислотной последовательности, вплоть до 5% (5 из 100) аминокислотных остатков в рассматриваемой последовательности могут быть встроены или заменены на другую аминокислоту или удалены в результате делеции, предпочтительно в рамках приведенных выше определений вариантов или фрагментов.

Все, что было указано выше для вариантов и фрагментов полипептидов равным образом применимо к нуклеотидным последовательностям.

Методы сравнения идентичности и гомологии двух или большего количества последовательностей хорошо известны в данной области. Процент идентичности двух последовательностей можно определять, например, с помощью математического алгоритма. Предпочтительным примером математического алгоритма, который можно применять, является (но, не ограничиваясь только им) алгоритм, описанный у Karlin и др., PNAS USA, 90, 1993, cc.5873-5877. Указанный алгоритм входит в семейство программ BLAST, например, в программу BLAST или NBLAST (см. также у Altschul и др., J. Mol. Biol. 215, 1990, cc.403-410 или Altschul др., Nucleic Acids Res, 25, 1997, cc.3389-3402), которые доступны на домашней странице NCBI на сайте в сети Интернет ncbi.nlm.nih.gov) и FASTA (Pearson, Methods Enzymol. 183, 1990, cc.63-98; Pearson и Lipman, Proc. Natl. Acad. Sci. U.S.A. 85, 1988, cc.2444-2448.). С помощью этих программ можно идентифицировать последовательности, идентичные в определенной степени другим последовательностям. Кроме того, для определения % идентичности двух полинуклеотидов и % идентичности и % гомологии двух полипептидных последовательностей можно использовать пакет программ анализа последовательностей Группы компьютерной генетики Биотехнологического центра Университета Висконсина (Wisconsin Sequence Analysis Package, версия 9.1, Devereux и др., Nucleic Acids Res. 12, 1984, cc.387-395), например, программы BESTFIT и GAP. В программе BESTFIT использован алгоритм «локальной гомологии» (Smith и Waterman, J. Mol. Biol. 147, 1981, cc.195-197), и она позволяет находить одну характеризующуюся наиболее высоким уровнем сходства область в двух последовательностях.

В контексте настоящего изобретения L-аминокислоты, обозначенные также как L-энантиомерные аминокислоты, предпочтительно представляют собой аминокислоты, выбранные из встречающихся в естественных условиях аминокислот или их производных. Встречающиеся в естественных условиях аминокислоты, как правило, выбирают из стандартных (протеиногенных) аминокислот, таких как аланин, аргинин, аспарагин, аспарагиновая кислота, цистеин, глутамин, глутаминовая кислота, глицин, гистидин, изолейцин, лейцин, лизин, метионин, фенилаланин, пролин, серин, треонин, триптофан, тирозин и валин, а также из нестандартных аминокислот, таких как орнитин, цитруллин, гомоцистеин, S-аденозилметионин, гидроксипролин, селеноцистеин, пирролизин, лантионин, 2-аминоизомасляная кислота, дегидроаланин, гамма-аминомасляная кислота и т.д.

Понятие (химические) «производные» в контексте настоящего описания относится к (химической) модификации аминокислот/цепей аминокислот на N-конце, С-конце, в каркасе, пептидных связей и/или остатков боковой цепи. Не подразумевается, что понятие относится к любому добавлению, замене или делеции аминокислот в аминокислотной цепи. (Химические) производные указанных L-аминокислот или L-энантиомерных аминокислот, как правило, представляют собой любое встречающееся в естественных условиях или не встречающееся в естественных условиях производное этих аминокислот, включая (но, не ограничиваясь только ими), указанные выше аминокислоты, содержащие пост-трансляционные модификации или синтетические модификации, включая ацетилирование (на N-конце полипептидной последовательности, на остатках лизина и т.д.), деацетилирование, алкилирование, например, метилирование, этилирование и т.д. (предпочтительно на остатках лизина или аргинина в полипептидной последовательности), деалкилирование, например, деметилирование, деэтилирование и т.д., амидирование (предпочтительно на С-конце полипептидной последовательности), формилирование, гамма-карбоксилирование, глутамилирование, гликозилирование (предпочтительно на остатках аспарагина, лизина, гидроксилизина, серина или треонина и т.д. в полипептидной последовательности), добавление гема или фрагмента гема, гидроксилирование, йодирование, изопренилирование, включающее добавление изопреноидного остатка, такого как фарнезил или геранилгераниол и т.д.), липоилирование (присоединение функциональной группы липоата), например, пренилирование, образование GPI-якоря, включая миристоилирование, фарнезилирование, геранилгераниолирование и т.д., окисление, фосфорилирование (например, на остатках серина, тирозина, треонина или гистидина и т.д. в полипептидной последовательности), сульфатацию (например, тирозина), селеноилирование, сульфатирование и т.д.

(Химические) производные L-аминокислот включают также (но, не ограничиваясь только ими) модифицированные L-аминокислоты, которые модифицированы путем интродукции одной из следующих меток:

(I) радиоактивные метки, т.е. радиоактивное фосфорилирование или радиоактивная метка, представляющая собой радиоактивную/радиоактивный серу, водород, углерод, азот и т.д.;

(II) окрашивающие вещества (например, дигоксигенин и т.д.);

(III) флуоресцентные группы (например, флуоресцеин, родамин, флуорохромные белки, описанные ниже и т.д.);

(IV) хемолюминесцентные группы;

(V) комбинация меток, состоящая из двух или большего количества меток, указанных в подпунктах (I)-(IV).

Наиболее предпочтительными примерами производных L-аминокислот являются (но, не ограничиваясь только ими) АМС (аминометилкумарин), дабцил (диметиламинофенилазобензоил), дансил (диметиламинонафталинсульфонил), FAM (карбоксифлуоросцеин), Мса (метоксикумаринацетил), Xan (ксантил), Abu (аминомасляная кислота), бета-Ala (бета-аланин), E-Ahx (6-аминокапроновая кислота), альфа-Aib (альфа-аминоизомасляная кислота), Ams (аминосерин), Cha (циклогексиламин), Dab (диаминомасляная кислота), Hse (гомосерин). Hyp (гидроксипролин), Mpr (меркаптопропионовая кислота), Nal (нафтилаланин), Nva (норвалин), Orn (орнитин), Phg (фенилглицин), Sar (саркозин), Sec (селеноцистеин), Thi (тиенилаланин) и т.д.

Кроме того, L-энантиомерные аминокислоты можно выбирать из конкретных комбинаций вышеуказанных L-энантиомерных аминокислот или их производных. Такие комбинации могут включать 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 или даже большее количество вышеуказанных L-энантиомерных аминокислот или их производных. Возможны также комбинации между любыми вышеуказанными L-энантиомерными аминокислотами или их производными и любыми из вышеуказанных D-энантиомерных аминокислот или их производных, которые будут описаны ниже. Указанные конкретные комбинации аминокислот могут отличаться более высокой или более низкой стабильностью при воздействии пептидаз и поэтому могут представлять собой дополнительную возможность придания in vivo или in vitro, например, обеспечивающему направленный перенос в WBC полипептиду более высокой или более низкой стабильности. Например, обеспечивающий направленный перенос в WBC полипептид может содержать дипептидную последовательность Arg-Lys в D-и/или в L-форме (т.е. либо в виде D-энантиомерных аминокислот, либо L-энантиомерных аминокислот, либо смешанных D- и L-энантиомерных аминокислот), предпочтительно в L-форме, которая обладает пониженной стабильностью при воздействии пептидаз, и поэтому их можно применять для дестабилизации полипептидной последовательности обеспечивающего направленный перенос в WBC полипептида и, таким образом, для снижения в большей степени его времени полужизни in vivo.

В контексте настоящего изобретения D-аминокислоты, обозначенные также как D-энантиомерные аминокислоты, предпочтительно обозначают ненативные (непротеиногенные) аминокислоты, где эти ненативные (непротеиногенные) аминокислоты предпочтительно выведены из встречающихся в естественных условиях L-аминокислот и/или их производных, как указано выше. Понятие «D-аминокислота» относится к изомеру встречающейся в естественных условиях L-аминокислоты, как она определена выше (и полученным из него полипептидам), в которой хиральность встречающегося в естественных условиях остатка L-аминокислоты обращена с образованием соответствующей D-аминокислоты (см., например, Jameson и др., Nature, 368, 1994, cc.744-746; Brady и др., Nature, 368, 1994, cc.692-693). Другими словами, в полипептидных связях D-аминокислот положения карбонильной и аминогрупп меняются местами, при этом положение групп боковых цепей на каждом альфа-атоме углерода сохраняется прежним. Таким образом, D-аминокислоты можно встраивать в полипептидную последовательность, которая состоит или содержит L-аминокислоты, и при этом можно конъюгировать с L-аминокислотами, как указано выше, с помощью методов, известных в данной области. Такие методы известны и включают, например (но, не ограничиваясь только ими) методы жидкофазного синтеза полипептидов или методы твердофазного синтеза полипептидов, например, методы твердофазного синтеза полипептидов согласно методу Меррифельда, твердофазный синтез полипептидов с использованием трет-Вос, твердофазный синтез полипептидов с использованием, Fmoc, твердофазный синтез полипептидов с использованием ВОР (гексафторфосфат бензотриазол-1-илокси-трис(диметиламино)фосфония). Содержание D-аминокислот обеспечивает дополнительное разнообразие ценных свойств. Например, такие полипептиды являются более стабильными (прежде всего in vivo) и отличаются пониженной иммуногенностью по сравнению с обеспечивающими направленный перенос в WBC полипептидами на основе соответствующих L-аминокислотных последовательностей. Однако они не являются столь же персистентными, что и обеспечивающие направленный перенос в WBC полипептиды, состоящие полностью из D-аминокислот, в частности, из-за того, что практически все расщепляющие ферменты, типа протеаз или пептидаз, расщепляют полипептидные связи между смежными L-аминокислотами. Следовательно, полипептиды, состоящие из D-энантиомерных аминокислот и L-энантиомерных аминокислот, обладают более значительной устойчивостью к быстрому протеолитическому расщеплению, не накапливаясь в клетке благодаря отсутствию расщепления протеазами.

Обеспечивающий направленный перенос в WBC полипептид предпочтительно содержит L-аминокислоты и D-аминокислоты или их производные, указанные выше. Такие производные могут входить в состав полного обеспечивающего направленный перенос в WBC полипептида в количестве, составляющем примерно 0%, примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80%, примерно 90% или даже примерно 100%. Другими словами, полный обеспечивающий направленный перенос в WBC полипептид может содержать примерно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 или даже большее количество таких производных.

Обеспечивающий направленный перенос в WBC полипептид, предназначенный для применения согласно настоящему изобретению, не состоит из следующих последовательностей: KRIIQRILSRNS (SEQ ID NO:236); KRIHPRLTRSIR (SEQ ID NO:237); PPRLRKRRQLNM (SEQ ID NO:238); PIRRRKKLRRLK (SEQ ID NO:239); RRQRRTSKLMKR (SEQ ID NO:240); MHKRPTTPSRKM (SEQ ID NO:241); RQRSRRRPLNIR (SEQ ID NO:242); RIRMIQNLIKKT (SEQ ID NO:243); SRRKRQRSNMRI (SEQ ID NO:244); QRIRKSKISRTL (SEQ ID NO:245); PSKRLLHNNLRR (SEQ ID NO:246); HRHIRRQSLIML (SEQ ID NO:247); PQNRLQIRRHSK (SEQ ID NO:248); PPHNRIQRRLNM (SEQ ID NO:249); SMLKRNHSTSNR (SEQ ID NO:250); GSRHPSLIIPRQ (SEQ ID NO:251); SPMQKTMNLPPM (SEQ ID NO:252); NKRILIRIMTRP (SEQ ID NO:253); HGWZIHGLLHRA (SEQ ID NO:254); AVPAKKRZKSV (SEQ ID NO:255); PNTRVRPDVSF (SEQ ID NO:256); LTRNYEAWVPTP (SEQ ID NO:257); SAETVESCLAKSH (SEQ ID NO:258); YSHIATLPFTPT (SEQ ID NO:259); SYIQRTPSTTLP (SEQ ID NO:260); AVPAENALNNPF (SEQ ID NO:261); SFHQFARATLAS (SEQ ID NO:262); QSPTDFTFPNPL (SEQ ID NO:263); HFAAWGGWSLVH (SEQ ID NO:264); HIQLSPFSQSWR (SEQ ID NO:265); LTMPSDLQPVLW (SEQ ID NO:266); FQPYDHPAEVSY (SEQ ID NO:267); FDPFFWKYSPRD (SEQ ID NO:268); FAPWDTASFMLG (SEQ ID NO:269); FTYKNFFWLPEL (SEQ ID NO:270); SATGAPWKMWVR (SEQ ID NO:271); SLGWMLPFSPPF (SEQ ID NO:272); SHAFTWPTYLQL (SEQ ID NO:273); SHNWLPLWPLRP (SEQ ID NO:274); SWLPYPWHVPSS (SEQ ID NO:275); SWWTPWHVHSES (SEQ ID NO:276); SWAQHLSLPPVL (SEQ ID NO:277); SSSIFPPWLSFF (SEQ ID NO:278); LNVPPSWFLSQR (SEQ ID NO:279); LDITPFLSLTLP (SEQ ID NO:280); LPHPVLHMGPLR (SEQ ID NO:281); VSKQPYYMWNGN (SEQ ID NO:282); NYTTYKSHFQDR (SEQ ID NO:283); AIPNNQLGFPFK (SEQ ID NO:284); NIENSTLATPLS (SEQ ID NO:285); YPYDANHTRSPT (SEQ ID NO:286); DPATNPGPHFPR (SEQ ID NO:287); TLPSPLALLTVH (SEQ ID NO:288); HPGSPFPPEHRP (SEQ ID NO:289); TSHTDAPPARSP (SEQ ID NO:290); MTPSSLSTLPWP (SEQ ID NO:291); VLGQSGYLMPMR (SEQ ID NO:292); QPIIITSPYLPS (SEQ ID NO:293); TPKTMTQTYDFS (SEQ ID NO:294); NSGTMQSASRAT (SEQ ID NO:295); QAASRVENYMHR (SEQ ID NO:296); HQHKPPPLTNNW (SEQ ID NO:297); SNPWDSLLSVST (SEQ ID NO:298); KTIEAHPPYYAS (SEQ ID NO:299); EPDNWSLDFPRR (SEQ ID NO:300); HQHKPPPLTNNW (SEQ ID NO:301); GVVGKLGQRRTKKQRRQKK (SEQ ID NO:302); GRRTKKQRRQKKPPRYMILGLLALAAVCSAA (SEQ ID NO:303); GRRTKKQRRQKKPP (SEQ ID NO:304). В конкретном варианте осуществления изобретения обеспечивающий направленный перенос в WBC полипептид, предназначенный для применения в вариантах осуществления настоящего изобретения не содержит или не состоит из SEQ ID NO:1.

Лежащая в основе настоящего изобретения задача решается путем объединения одного, двух или большего количества обеспечивающих направленный перенос в WBC полипептидов, указанных выше, по меньшей мере с одной дополнительной субстанцией (карго-молекула). Комбинация обеспечивающего направленный перенос в WBC полипептида и карго-молекулы обозначена далее как «молекула-конъюгат, являющаяся транспортером карго-молекулы». Таким образом, настоящее изобретение относится также к молекуле-конъюгату, являющейся транспортером карго-молекулы, которая содержит в качестве компонента (А) по меньшей мере один обеспечивающий направленный перенос в WBC полипептид, предлагаемый в настоящем изобретении, и в качестве компонента (Б) дополнительную субстанцию (карго-молекула). Естественно, указанная молекула-конъюгат, являющаяся транспортером карго-молекулы, может содержать также любое количество дополнительных компонентов (В), (Г), (Д) и т.д. Ниже компонент (Б) будет описан более подробно; однако его отличительные признаки можно применять также к любому другому дополнительному компоненту (В), (Г), (Д) и т.д.

Специалисту в данной области должно быть очевидно, что значение настоящего изобретения для рассматриваемой области заключается, прежде всего, в том, что в нем предложены общие средства, позволяющие эффективно вводить карго-молекулу в лейкоциты. Так, фактически компонент (Б) молекулы-конъюгата, являющейся транспортером карго-молекулы, предлагаемой в настоящем изобретении, может в принципе представлять собой любую субстанцию, которую специалисту в данной области требуется интродуцировать в лейкоциты по какой-либо причине. Такие причины представляют собой (но, не ограничиваясь только ими) терапевтические причины (такие как лечение, предупреждение, ослабление и/или уменьшение интенсивности заболевания), диагностические причины, научные причины, технические причины, коммерческие причины и т.д. Ниже представлены некоторые примеры компонента (Б). Однако эти примеры не должны рассматриваться как ограничивающие объем настоящего изобретения.

Например, карго-молекулу (компонент (Б)) можно выбирать из группы, включающей:

а) белки или полипептиды, включая терапевтически активные белки и/или полипептиды,

б) ингибиторы протеинкиназ, включая ингибиторы протеинкиназы, такой как аминоконцевая киназа c-Jun, или факторы,

в) антигены,

г) антитела,

д) проапоптозные факторы,

е) протеазы, участвующие в патологических состояниях, включая ингибиторы пептидных протеаз,

ж) ВН3-домены,

з) белки «ВН3-только»,

и) ДНК,

к) РНК, включая siPHK, антисмысловые РНК, микроРНК,

л) цитотоксические агенты,

м) небольшие органические соединения,

н) низкомолекулярные фармацевтические средства,

о) частицы золота,

п) флуоресцентные красители,

р) антибиотики и/или

с) вирусостатики и др.

В контексте настоящего изобретения терапевтически активный белок или полипептид, который можно применять в качестве эффекторной молекулы для компонента (Б) молекулы-конъюгата, являющейся транспортером карго-молекулы, предлагаемой в изобретении, можно выбирать из группы, включающей (но, не ограничиваясь только ими) белки, которые обладают способностью стимулировать или ингибировать трансдукцию сигнала в клетке, например, цитокины, антитела и др. Таким образом, терапевтически активные белки могут содержать цитокины класса I семейства цитокинов, которые имеют 4 позиционно консервативных остатка цистеина (СССС) и содержат консервативную последовательность-мотив Trp-Ser-X-Trp-Ser (WSXWS), где Х обозначает неконсервативную аминокислоту. К цитокинам класса I семейства цитокинов относится подсемейство GM-CSF, например, IL-3, IL-5, GM-CSF, подсемейство IL-6, например, IL-6, IL-11, IL-12, или подсемейство IL-2, например, IL-2, IL-4, IL-7, IL-9, IL-15 и др., или цитокины IL-1 альфа, IL-1бета, IL-10 и др. Терапевтически активные белки могут содержать также цитокины класса II семейства цитокинов, которые также имеют 4 позиционно консервативных остатка цистеина (СССС), но не содержат консервативную последовательность-мотив Trp-Ser-X-Trp-Ser (WSXWS). К цитокинам класса II семейства цитокинов относятся, например, IFN-альфа, IFN-бета, IFN-гамма и др. Терапевтически активные белки могут содержать также цитокины из семейства факторов некроза опухолей, например, TNF-альфа, TNF-бета и др., или цитокины из семейства хемокинов, которые содержат 7 трансмембранных спиралей (доменов) и взаимодействуют с G-белком, например, IL-8, MIP-1, RANTES, CCR5, CXR4 и др., или специфические для цитокинов рецепторы, такие как TNF-RI, TNF-RII, CD40, 0Х40 (CD 134), Fas, или их фрагменты или варианты. Предпочтительно указанные фрагменты, а также варианты характеризуются указанной выше гомологией или идентичностью последовательностей.

Терапевтически активные белки или полипептиды, которые можно применять в качестве компонента (Б) молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в настоящем изобретении, можно также выбирать из любых белков из группы, включающей (но не ограниченной только ими): 0ATL3, 0FC3, 0РА3, 0PD2, 4-1BBL, 5Т4, 6Ckine, 707-AP, 9D7, А2М, AA, AAAS, AACT, AASS, ABAT, ABCA1, ABCA4, ABCB1, ABCB11, ABCB2, ABCB4, ABCB7, ABCC2, АВСС6, ABCC8, ABCD1, ABCD3, ABCG5, ABCG8, ABL1, ABO, ABR ACAA1, ACACA, ACADL, ACADM, ACADS, ACADVL, ACAT1, ACCPN, ACE, ACHE, ACHM3, ACHM1, ACLS, ACPI, ACTA1, ACTC, ACTN4, ACVRL1, AD2, ADA, ADAMTS13, ADAMTS2, ADFN, ADH1B, ADH1C, ADLDH3A2, ADRB2, ADRB3, ADSL, AEZ, AFA, AFD1, AFP, AGA, AGL, AGMX2, AGPS, AGS1, AGT, AGTR1, AGXT, AH02, AHCY, AHDS, AHHR, AHSG, AIC, AIED, AIH2, AIH3, AIM-2, AIPL1, AIRE, AK1, ALAD, ALAS2, ALB, HPG1, ALDH2, ALDH3A2, ALDH4A1, ALDH5A1, ALDH1A1, ALDOA, ALDOB, ALMS1, ALPL, ALPP, ALS2, ALX4, AMACR, AMBP, AMCD, AMCD1, AMCN, AMELX, AMELY, AMGL, АМН, AMHR2, AMPD3, AMPD1, AMT, ANC, ANCR, ANK1, ANOP1, AOM, AP0A4, AP0C2, АР0С3, АР3В1, АРС, aPKC, АРОА2, APOA1, АРОВ, APOC3, APOC2, APOE, APOH, APP, APRT, APS1, AQP2, AR, ARAF1, ARG1, ARHGEF12, ARMET, ARSA, ARSB, ARSC2, ARSE, ART-4, ARTC1/m, ARTS, ARVD1, ARX, AS, ASAH, ASAT, ASD1, ASL, ASMD, ASMT, ASNS, ASPA, ASS, ASSP2, ASSP5, ASSP6, AT3, ATD, ATHS, ATM, ATP2A1, ATP2A2, ATP2C1, ATP6B1, ATP7A, ATP7B, ATP8B1, ATPSK2, ATRX, ATXN1, ATXN2, ATXN3, AUTS1, AVMD, AVP, AVPR2, AVSD1, AXIN1, AXIN2, AZF2, B2M, B4GALT7, B7H4, BAGE, BAGE-1, BAX, BBS2, BBS3, BBS4, BCA225, BCAA, BCH, BCHE, BCKDHA, BCKDHB, BCL10, BCL2, BCL3, BCL5, BCL6, BCPM, BCR, BCR/ABL, BDC, BDE, BDMF, BDMR, BEST1, бета-катенин/m, BF, BFHD, BFIC, BFLS, BFSP2, BGLAP, BGN, BHD, BHR1, BING-4, BIRC5, BJS, BLM, BLMH, BLNK, BMPR2, BPGM, BRAF, BRCA1, BRCA1/m, BRCA2, BRCA2/m, BRCD2, BRCD1, BRDT, BSCL, BSCL2, BTAA, BTD, ВТК, BUB1, BWS, BZX, C0L2A1, C0L6A1, C1NH, C1QA, C1QB, C1QG, C1S, C2, С3, С4А, C4B, C5, C6, C7, C7orf2, C8A, C8B, C9, CA125, CA15-3/CA27-29, CA195, CA19-9, CA72-4, CA2, CA242, CA50, CABYR, CACD, CACNA2D1, CACNA1A, CACNA1F, CACNA1S, CACNB2, CACNB4, CAGE, CA1, CALB3, CALCA, CALCR, CALM, CALR, CAM43, CAMEL, CAP-1, CAPN3, CARD15, CASP-5/m, CASP-8, CASP-8/m, CASR, CAT, CATM, CAV3, CB1, CBBM, CBS, CCA1, CCAL2, CCAL1, CCAT, CCL-1, CCL-11, CCL-12, CCL-13, CCL-14, CCL-15, CCL-16, CCL-17, CCL-18, CCL-19, CCL-2, CCL-20, CCL-21, CCL-22, CCL-23, CCL-24, CCL-25, CCL-27, CCL-3, CCL-4, CCL-5, CCL-7, CCL-8, CCM1, CCNB1, CCND1, CCO, CCR2, CCR5, CCT, CCV, CCZS, CD1, CD19, CD20, CD22, CD25, CD27, CD27L, cD3, CD30, CD30, CD30L, CD33, CD36, CD3E, CD3G, CD3Z, CD4, CD40, CD40L, CD44, CD44v, CD44v6, CD52, CD55, CD56, CD59, CD80, CD86, CDAN1, CDAN2, CDAN3, CDC27, CDC27/m, CDC2L1, CDH1, CDK4, CDK4/m, CDKN1C, CDKN2A, CDKN2A/m, CDKN1A, CDKN1C, CDL1, CDPD1, CDR1, CEA, CEACAM1, CEACAM5, CECR, CECR9, СЕРА, CETP, CFNS, CFTR, CGF1, CHAC, CHED2, CHED1, CHEK2, CHM, CHML, CHR39C, CHRNA4, CHRNA1, CHRNB1, CHRNE, CHS, CHS1, CHST6, CHX10, CIAS1, CIDX, CKN1, CLA2, CLA3, CLA1, CLCA2, CLCN1, CLCN5, CLCNKB, CLDN16, CLP, CLN2, CLN3, CLN4, CLN5, CLN6, CLN8, C1QA, C1QB, C1QG, C1R, CLS, CMCWTD, CMDJ, CMD1A, CMD1B, CMH2, МНЗ, СМН6, CMKBR2, CMKBR5, CML28, CML66, CMM, CMT2B, CMT2D, CMT4A, CMT1A, CMTX2, CMTX3, C-MYC, CNA1, CND, CNGA3, CNGA1, CNGB3, CNSN, CNTF, COA-l/m, COCH, COD2, COD1, COH1, COL10A, COL2A2, COL11A2, COL17A1, COL1A1, COL1A2, COL2A1, COL3A1, COL4A3, COL4A4, COL4A5, COL4A6, COL5A1, COL5A2, COL6A1, COL6A2, COL6A3, COL7A1, COL8A2, COL9A2, COL9A3, COL11A1, COL1A2, COL23A1, COL1A1, COLQ, COMP, COMT, CORDS, CORD1, COX10, COX-2, CP, CPB2, CPO, CPP, CPS1, CPT2, CPT1A, CPX, CRAT, CRB1, CRBM, CREBBP, CRH, CRHBP, CRS, CRV, CRX, CRYAB, CRYBA1, CRYBB2, CRYGA, CRYGC, CRYGD, CSA, CSE, CSF1R, CSF2RA, CSF2RB, CSF3R, CSF1R, CST3, CSTB, CT, CT7, CT-9/BRD6, CTAA1, CTACK, CTEN, CTH, CTHM, CTLA4, CTM, CTNNB1, CTNS, CTPA, CTSB, CTSC, CTSK, CTSL, CTS1, CUBN, CVD1, CX3CL1, CXCL1, CXCL10, CXCL11, CXCL12, CXCL13, CXCL16, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CYB5, CYBA, CYBB, CYBB5,, CYFRA21-1, CYLD, CYLD1, CYMD, CYP11B1, CYP11B2, CYP17, CYP17A1, CYP19, CYP19A1, CYP1A2, CYP1B1, CYP21A2, CYP27A1, CYP27B1, CYP2A6, CYP2C, CYP2C19, CYP2C9, CYP2D, CYP2D6, CYP2D7P1, CYP3A4, CYP7B1, CYPB1, CYP11B1, CYP1A1, CYP1B1, CYRAA, D40, DAD1, DAM, DAM-10/MAGE-B1, DAM-6/MAGE-B2, DAX1, DAZ, DBA, DBH, DBI, DBT, DCC, DC-CK1, DCK, DCR, DCX, DDB 1, DDB2, DDIT3, DDU, DECR1, DEK-CAN, DEM, DES, DF, DFN2, DFN4, DFN6, DFNA4, DFNA5, DFNB5, DGCR, DHCR7, DHFR, DHOF, DHS, DIA1, DIAPH2, DIAPH1, DIH1, DIO1, DISCI, DKC1, DLAT, DLD, DLL3, DLX3, DMBT1, DMD, DM1, DMPK, DMWD, DNAI1, DNASE1, DNMT3B, DPEP1, DPYD, DPYS, DRD2, DRD4, DRPLA, DSCR1, DSG1, DSP, DSPP, DSS, DTDP2, DTR, DURS1, DWS, DYS, DYSF, DYT2, DYT3, DYT4, DYT2, DYT1, DYX1, EBAF, EBM, EBNA, EBP, EBR3, EBS1, ECA1, ECB2, ECE1, ECGF1, ЕСТ, ED2, ED4, EDA, EDAR, ECA1, EDN3, EDNRB, EEC1, EEF1A1L14, EEGV1, EFEMP1, EFTUD2/m, EGFR, EGFR/Her1, EGI, EGR2, EIF2AK3, eIF4G, EKV, El IS, ELA2, ELF2, ELF2M, ELK1, ELN, ELONG, EMD, EML1, EMMPRIN. EMX2, ENA-78, ENAM, END3, ENG, EN01, ENPP1, ENUR2, ENUR1, EOS, EP300, EPB41, EPB42, EPCAM, EPD, EphA1, EphA2, EphA3, эфринА2, эфринА3, EPHX1, EPM2A, EPO,EPOR, EPX, ERBB2, ERCC2 ERCC3, ERCC4, ERCC5, ERCC6, ERVR, ESR1, ETFA, ETFB, ETFDH, ETM1, ETV6-AML1, ETV1, EVC, EVR2, EVR1, EWSR1, EXT2, ЕХТ3, ЕХТ1, EYA1, EYCL2, EYCL3, EYCL1, EZH2, F10, F11, F12, F13A1, F13B, F2, F5, F5F8D, F7, F8, F8C, F9, FABP2, FACL6, FAH, FANCA, FANCB, FANCC, FANCD2, FANCF, FasL, FBN2, FBN1, FBP1, FCG3RA, FCGR2A, FCGR2B, FCGR3A, FCHL, FCMD, FCP1, FDPSL5, FECH, FEO, FEOM1, FES, FGA, FGB, FGD1, FGF2, FGF23, FGF5, FGFR2, FGFR3, FGFR1, FGG, FGS1, FH, FIC1, FIH, F2, FKBP6, FLNA, FLT4, FMO3, FMO4, FMR2, FMR1, FN, FN1/m, FOXC1, FOXE1, FOXL2, FOX01A, FPDMM, FPF, Fra-1, FRAXF, FRDA, FSHB, FSHMD1A, FSHR, FTH1, FTHL17, FTL, FTZF1, FUCA1, FUT2, FUT6, FUT1, FY, G250, G250/CAIX, G6PC, G6PD, G6PT1, G6PT2, GAA, GABRA3, GAGE-1, GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-71), GAGE-8, GALC, GALE, GALK1, GALNS, GALT, GAMT, GAN, GAST, GASTRIN17, GATA3, GATA, GBA, GBE, GC, GCDH,GCGR, GCH1, GCK, GCP-2, GCS1, G-CSF, GCSH, GCSL, GCY, GDEP,GDF5, GDI1, GDNF, GDXY, GFAP, GFND, GGCX, GGT1, GH2, GH1, GHR, GHRHR, GHS, GIF, GINGF, GIP, GJA3, GJA8, GJB2, GJB3, GJB6, GJB1, GK, GLA, GLB, GLB1, GLC3B, GLC1B, GLC1C, GLDC, GLI3, GLP1, GLRA1, GLUD1, GM1 (fuc-GM1), GM2A, GM-CSF, GMPR, GNAI2, GNAS, GNAT1, GNB3, GNE, GNPTA, GNRH, GNRH1, GNRHR, GNS, GnT-V, gp100, GP1BA, GP1BB, GP9, GPC3, GPD2, GPDS1, GPI, GP1BA, GPN1LW, GPNMB/m, GPSC, GPX1, GRHPR, GRK1, GROα, GROβ, GROγ, GRPR, GSE, GSM1, GSN, GSR, GSS, GTD, GTS, GUCA1A, GUCY2D, GULOP, GUSB, GUSM, GUST, GYPA, GYPC, GYS1, GYS2, HOKPP2, HOMG2, HADHA, HADHB, HAGE, HAGH, HAL, HAST-2, HB 1, HBA2, HBA1, HBB, HBBP1, HBD, HBE1, HBG2, HBG1, HBHR, HBP1, HBQ1, HBZ, HBZP, НСА, НСС-1, НСС-4, HCF2, HCG, HCL2, HCL1, HCR, HCVS, HD, HPN, HER2, HER2/NEU, HER3, HERV-K-MEL, HESX1, НЕХА, НЕХВ, HF1, HFE, HF1, HGD, ННС2, ННС3, HHG, HK1 HLA-A, HLA-A*0201-R170I, HLA-A11/m, HLA-A2/m, HLA-DPB1 HLA-DRA, HLCS, HLXB9, HMBS, HMGA2, HMGCL, HMI, HMN2, HMOX1, HMS1 HMW-MAA, HND, HNE, HNF4A, HOAC, HOMEOBOX NKX 3.1, HOM-TES-14/SCP-1, HOM-TES-85, HOXA1 HOXD13, HP, HPC1, HPD, HPE2, HPE1, HPFH, HPFH2, HPRT1, HPS1, HPT, HPV-E6, HPV-E7, HR, HRAS. HRD, HRG, HRPT2, HRPT1, HRX, HSD11B2, HSD17B3, HSD17B4, HSD3B2, HSD3B3, HSN1, HSP70-2M, HSPG2, HST-2, HTC2, HTC1, hTERT, HTN3, HTR2C, HVBS6, HVBS1, HVEC, HV1S, HYAL1, HYR, 1-309, IAB, IBGC1, IBM2, ICAM1, ICAM3, iCE, ICHQ, ICR5, ICR1, ICS 1, IDDM2, IDDM1, IDS, IDUA, IF, IFNa/b, DIFNGR1, IGAD1, IGER, IGF-1R, IGF2R, IGF1, IGH, IGHC, IGHG2, IGHG1, IGHM, IGHR, IGKC, IHG1, IHH, IKBKG, IL1, IL-1 RA, IL10, IL-11, IL12, IL12RB1, IL13, IL-13Rα2, IL-15, IL-16, IL-17, IL18, IL-1a, IL-1α, IL-1b, IL-1β, IL1RAPL1, IL2, IL24, IL-2R, IL2RA, IL2RG, IL3, IL3RAJL4, IL4RJL4R, IL-5, IL6, IL-7, IL7R, IL-8, IL-9, незрелый рецептор ламинина, IMMP2L, INDX, INFGR1, INFGR2, INFα, IFNβ, INFγ, INS, INSR, INVS, IP-10, IP2, IPF1, IP1, IRF6, IRS1, ISCW, ITGA2, ITGA2B, ITGA6, ITGA7, ITGB2, ITGB3, ITGB4, ITIH1, ITM2B, IV, IVD, JAG1, JAK3, JBS, JBTS1, JMS, JPD, KALI, KAL2, KALI, KLK2, KLK4, KCNA1, KCNE2, KCNE1, KCNH2, KCNJ1, KCNJ2, KCNJ1, KCNQ2, KCNQ3, KCNQ4, KCNQ1, KCS, KERA, KFM, KFS, KFSD, KHK, ki-67, KIAA0020, KIAA0205, KIAA0205/m, KIF1B, KIT, KK-LC-1, KLK3, KLKB1, KM-HN-1, KMS, KNG, KNO, K-RAS/m, KRAS2, KREV1, KRT1, KRT10, KRT12, KRT13, KRT14, KRT14L1, KRT14L2, KRT14L3,KRT16, KRT16L1, KRT16L2, KRT17, KRT18, KRT2A, KRT3, KRT4, KRT5, KRT6A, KRT6B, KRT9, KRTHB1, KRTHB6, KRT1, KSA, KSS, KWE, KYNU, LOH19CR1, L1CAM, LAGE, LAGE-1, LALL, LAMA2, LAMA3, LAMB3, LAMB1, LAMC2, LAMP2, LAP, LCA5, LCAT, LCCS, LCCS 1, LCFS2, LCS1, LCT, LDHA, LDHB, LDHC, LDLR, LDLR/FUT, LEP, LEWISY, LGCR, LGGF-PBP, LGI1, LGMD2H, LGMD1A, LGMD1B, LHB, LHCGR, LHON, LHRH, LHX3, LIF, LIG1, LIMM, LIMP2, LIPA, LIPA, LIPB, LIPC, LIVIN, L1CAM, LMAN1, LMNA, LMX1B, LOLR, LOR, LOX, LPA, LPL, LPP, LQT4, LRP5, LRS1, LSFC, LT-β, LTBP2, LTC4S. LYL1, XCL1, LYZ, M344, MA50, MAA, MADH4, MAFD2, MAFD1, MAGE, MAGE-A1, MAGE-A10, MAGE-А12, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A9, MAGEB1, MAGE-B10, MAGE-B16, MAGE-B17, MAGE-B2, MAGE-B3, MAGE-B4, MAGE-B5, MAGE-B6, MAGE-C1, MAGE-C2, MAGE-C3, MAGE-D1, MAGE-D2, MAGE-D4, MAGE-E1, MAGE-E2, MAGE-F1, MAGE-H1, MAGEL2, MGB1, MGB2, MAN2A1, MAN2B1, MANBA, MANBB, MAOA, MAOB, MAPK8IP1, МАРТ, MART-1, MART-2, MART2/m, MAT1A, MBL2, MBP, MBS1, MC1R, MC2R, MC4R, MCC, MCCC2, MCCC1, MCDR1, MCF2, MCKD, MCL1, MC1R, MCOLN1, MCOP, MCOR, MCP-1, MCP-2, MCP-3, MCP-4, MCPH2, MCPH1, MCS, M-CSF, MDB, MDCR, MDM2, MDRV, MDS 1, ME1, ME1/m, ME2, ME20, ME3, MEAX, MEB, MECCCL-28, MECP2, MEFV, MELANA, MELAS, MEN1 MSLN, MET, MF4, MG50, MG50/PXDN, MGAT2, MGAT5, MGC1 MGCR, MGCT, MGI, MGP, MHC2TA, MHS2, MHS4, MIC2, MIC5, MIDI, MIF, MIP, MIP-5/HCC-2, MITF, MJD, MKI67, MKKS, MKS1, MLH1, MLL, MLLT2, MLLT3, MLLT7, MLLT1, MLS, MLYCD, MMA1a, MMP11, MMVP1, MN/CA IX-антиген, MNG1, MN1, MOC31, MOCS2, MOCS1, MOG, MORC, MOS, MOV18, MPD1, MPE, MPFD, MPI, MPIF-1, MPL, MPO, MPS3C, MPZ, MRE11A, MROS, MRP1, MRP2, MRP3, MRSD, MRX14, MRX2, MRX20, MRX3, MRX40, MRXA, MRX1, MS, MS4A2, MSD, MSH2, MSH3, MSH6, MSS, MSSE, MSX2, MSX1, MTATP6, MTC03, MTC01, MTCYB, MTHFR, MTM1, MTMR2, MTND2, MTND4, MTND5, MTND6, MTND1, MTP, MTR, MTRNR2, MTRNR1, MTRR, MTTE, MTTG, MTTI, MTTK, MTTL2, MTTL1, MTTN, MTTP, MTTS1, MUC1, MUC2, MUC4, MUC5AC, Мим-1, MUM-1/m, MUM-2, MUM-2/m, MUM-3, MUM-3/m, MUT, мутант p21ras, MUTYH, MVK, MX2, MXI1, MY05A, MYB, MYBPC3, MYC, MYCL2, MYH6, MYH7, MYL2, MYL3, MYMY, MY015A, MY01G, MY05A, MY07A, MYOC, миозин/m, MYP2, MYP1, NA88-A, N-ацетилглюкозаминилтрансферазу-V, NAGA, NAGLU, NAMSD, NAPB, NAT2, NAT, NBIA1, NBS1, NCAM, NCF2, NCF1, NDN, NDP, NDUFS4, NDUFS7, NDUFS8, NDUFV1, NDUFV2, NEB, NEFH, NEM1, нео-РАР, нео-PAP/m, NEU1, NEUROD1, NF2, NF1, NFYC/m, NGEP, NHS, NKS1, NKX2E, NM, NME1, NMP22, NMTC, NODAL, NOG, NOS3, NOTCH3, NOTCH1, NP, NPC2, NPC1, NPHL2, NPHP1, NPHS2, NPHS1, NPM/ALK, NPPA, NQ01, NR2E3, NR3C1, NR3C2, NRAS, NRAS/m, NRL, NROB1, NRTN, NSE, NSX, NTRK1, NUMA1, NXF2, NY-CO1, NY-ES01, NY-ESO-B, NY-LU-12, ALDOA, NYS2, NYS4, NY-SAR-35, NYS1, NYX, OA3, OA1, OAP, OASD, OAT, OCA1, OCA2, OCD1, OCRL, OCRL1, OCT, ODDD, ODT1, OFC1, OFD1, OGDH, OGT, OGT/m, OPA2, OPA1, OPD1, OPEM, OPG, OPN, OPN1LW, OPN1MW, OPN1SW, OPPG, OPTB1, TTD, ORM1, ORP1, OS-9, OS-9/m, OSM LIF, OTC, OTOF, OTSC1, OXCT1, OYTES1, P15, P190 MINOR BCR-ABL, P2RY12, P3, P16, P40, P4HB, P-501, P53, P53/m, P97, PABPN1, PAFAH1B1, PAFAH1P1, PAGE-4, PAGE-5, РАН, PAI-1, PAI-2, PAK3, PAP, PAPPA, PARK2, PART-1, PATE, PAX2, PAX3, PAX6, PAX7, PAX8, PAX9, PBCA, PBCRA1, PBT, PBX1, PBXP1, PC, PCBD, PCCA, PCCB, PCK2, PCK1, PCLD, PCOS1, PCSK1, PDB1, PDCN, PDE6A, PDE6B, PDEF, PDGFB, PDGFR, PDGFRL, PDHA1, PDR, PDX1, PECAM1, PEE1, PE01, PEPD, PEX10, PEX12, PEX13, РЕХЗ, РЕХ5, PEX6, PEX7, PEX1, PF4, PFBI, PFC, PFKFB1, PFKM, PGAM2, PGD, PGK1, PGK1P1, PGL2, PGR, PGS, PHA2A, PHB, PHEX, PHGDH, PHKA2, PHKA1, PHKB, PHKG2, PHP, PHYH, PI, PI3, PIGA, PIM1-KINASE, PIN1, PIP5K1B, PITX2, PITX3, PKD2, PKD3, PKD1, PKDTS, PKHD1, PKLR, PKP1, PKU1, PLA2G2A, PLA2G7, PLAT, PLEC1, PLG, PLI, PLOD, PLP1, PMEL17, PML, PML/RARα, PMM2, PMP22, PMS2, PMS1, PNKD, PNLIP, POF1, POLA, POLH, POMC, PON2, PON1, PORC, POTE, POU1F1, POU3F4, POU4F3, POU1F1, PPAC, PPARG, PPCD, PPGB, PPH1, PPKB, PPMX, PPOX, PPP1R3A, PPP2R2B, PPT1, PRAME, PRB, PRB3, PRCA1, PRCC, PRD, PRDX5/m, PRF1, PRG4, PRKAR1A, PRKCA, PRKDC, PRKWNK4, PRNP, PROC, PRODH, PROM1, PROP1, PROS1, PRST, PRP8, PRPF31, PRPF8, PRPH2, PRPS2, PRPS1, PRS, PRSS7, PRSS1, PRTN3, PRX, PSA, PSAP, PSCA, PSEN2, PSEN1, PSG1, PSGR, PSM, PSMA, PSORS1, PTC, PTCH, PTCH1, PTCH2, PTEN, PTGS1, PTH, PTHR1, PTLAH, PTOS1, PTPN12, PTPNI1, PTPRK, PTPRK/m, PTS, PUJO, PVR, PVRL1, PWCR, PXE, PXMP3, PXR1, PYGL, PYGM, QDPR, RAB27A, RAD54B, RAD54L, RAG2, RAGE, RAGE-1, RAG1, RAP1, RARA, RASA1, RBAF600/m, RB1, RBP4, RBP4, RBS, RCA1, RCAS1, RCCP2, RCD1, RCV1, RDH5, RDPA, RDS, RECQL2, RECQL3, RECQL4, REG1A, REHOBE, REN, RENBP, RENS1, RET, RFX5, RFXANK, RFXAP, RGR, RHAG, RHAMM/CD168, RHD, RHO, Rip-1, RLBP1, RLN2, RLN1, RLS, RMD1, RMRP, ROM1, ROR2, RP, RP1, RP14, RP17, RP2, RP6, RP9, RPD1, RPE65, RPGR, RPGRIP1, RP1, RP10, RPS19, RPS2, RPS4X, RPS4Y, RPS6KA3, RRAS2, RS1, RSN, RSS, RU1, RU2, RUNX2,RUNX1, RWS, RYR1, S-100, SAA1, SACS, SAG, SAGE, SALL1, SARDH, SART1, SART2, SART3, SAS, SAX1, SCA2, SCA4, SCA5, SCA7, SCA8, SCA1, SCC, SCCD, SCF, SCLC1, SCN1A, SCN1B, SCN4A, SCN5A, SCNN1A, SCNN1B, SCNN1G, SCО2, SCP1, SCZD2, SCZD3, SCZD4, SCZD6, SCZD1, SDF-1α/βDHA, SDHD, SDYS, SEDL, SERPENA7, SERPINA3, SERPINA6, SERPINA1, SERPINC1, SERPIND1, SERPINE1, SERPINF2, SERPING1, SERPINI1, SFTPA1, SFTPB, SFTPC, SFTPD, SGCA, SGCB, SGCD, SGCE, SGM1, SGSH, SGY-1, SH2D1A, SHBG, SHFM2, SHFM3, SHFM1, SHH, SHOX, SI, SIAL, SIALYL LEWISX, SIASD, S11, SIM1, SIRT2/m, SIX3, SJS1, SKP2, SLC10A2, SLC12A1, SLC12A3, SLC17A5, SLC19A2, SLC22A1L, SLC22A5, SLC25A13, SLC25A15, SLC25A20, SLC25A4, SLC25A5, SLC25A6, SLC26A2, SLC26A3, SLC26A4, SLC2A1, SLC2A2, SLC2A4, SLC3A1, SLC4A1, SLC4A4, SLC5A1, SLC5A5, SLC6A2, SLC6A3, SLC6A4, SLC7A7, SLC7A9, SLC11A1, SLOS, SMA, SMAD1, SMAL, SMARCB1, SMAX2, SMCR, SMCY, SM1, SMN2, SMN1, SMPD1, SNCA, SNRPN, SOD2, SOD3, SOD1, SOS1, SOST, SOX9, SOX10, Spl7, SPANXC, SPG23, SPG3A, SPG4, SPG5A, SPG5B, SPG6, SPG7, SPINK1, SPINK5, SPPK, SPPM, SPSMA, SPTA1, SPTB, SPTLC1, SRC, SRD5A2, SRPX, SRS, SRY, phCG, SSTR2, SSX1, SSX2 (HOM-MEL-40/SSX2), SSX4, ST8, STAMP-1, STAR, STARP1, STATH, STEAP, STK2, STK11, STn/KLH, STO, STOM, STS, SUOX, SURF1, SURVIVIN-2B, SYCP1, SYM1, SYN1, SYNS1, SYP, SYT/SSX, SYT-SSX-1, SYT-SSX-2, TA-90, TAAL6, TACSTD1, TACSTD2, TAG72, TAF7L, TAF1, TAGE, TAG-72, TALI, ТАМ, ТАР2, TAP1, TAPVR1, TARC, TARP, TAT, TAZ, TBP, TBX22, ТВХ3, ТВХ5, TBXA2R, TBXAS1, TCAP, TCF2, TCF1, TCIRG1, TCL2, TCL4, TCL1A, TCN2, TCOF1, TCR, TCRA, TDD, TDFA, TDRD1, TECK, ТЕСТА, ТЕК, TEL/AML1, TELAB1, TEX15, TF, TFAP2B, TFE3, TFR2, TG, TGFA, TGF-β, TGFBI, TGFB1, TGFBR2, TGFBRE, TGFβ, TGFβRII, TGIF, TGM-4, TGM1, TH, THAS, THBD, THC, THC2, THM, THPO, THRA, THRB, TIMM8A, TIMP2, TIMP3, TIMP1, TITF1, TKCR, TKT, TLP, TLR1, TLR10, TLR2, TLR3, TLR4, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLX1, TM4SF1, TM4SF2, TMC1, TMD, TMIP, TNDM, TNF, TNFRSF11A, TNFRSF1A, TNFRSF6, TNFSF5, TNFSF6, TNFα, TNFR, TNNI3, TNNT2, TOC, TOP2A, TOPI, TP53, TP63, TPA, TPBG, TPI, TPI/m, TPI1, ТРМ3, TPM1, TPMT, TPO, TPS, TPTA, TRA, TRAG3, TRAPPC2, TRC8, TREH, TRG, TRH, TRIM32, TRIM37, TRP1, TRP2, TRP-2/6b, TRP-2/INT2, Trp-p8, TRPS1, TS, TSC2, TSC3, TSC1, TSG101, TSHB, TSHR, TSP-180, TST, TTGA2B, TTN, TTPA, TTR, TUM2-PK, TULP1, TWIST, TYH, TYR, TYROBP, TYROBP, TYRP1, TYS, UBE2A, UBE3A, UBE1, UCHL1, UFS, UGT1A, ULR, UMPK, UMPS, UOX, UPA, UQCRC1, UR05, UROD, UPK1B, UROS, USH2A, USH3A, USH1A, USH1C, USP9Y, UV24, VBCH, VCF, VDI, VDR, VEGF, VEGFR-2, VEGFR-1, VEGFR-2/FLK-l, VHL, VIM, VMD2, VMD1, VMGLOM, VNEZ, VNF, VP, VRNI, VWF, VWS, WAS, WBS2, WFS2, WFS1, WHCR, WHN, WISP3, WMS, WRN, WS2A, WS2B, WSN, WSS, WT2, WT3, WT1, WTS, WWS, XAGE, XDH, XIC, XIST, XK, XM, XPA, XPC, XRCC9, XS, ZAP70, ZFHX1B, ZFX, ZFY, ZIC2, ZIC3, ZNF145, ZNF261, ZNF35, ZNF41, ZNF6, ZNF198, ZWS1 и их фрагменты или варианты. Предпочтительно указанные фрагменты, а также варианты характеризуются указанной выше гомологией или идентичностью последовательностей.

Компонент (Б) можно выбирать также из числа ингибиторов протеинкиназ, в частности ингибиторов такой протеинкиназы, как аминоконцевая киназа c-Jun, т.е. из ингибиторов JNK. Как правило, ингибитор JNK, который можно применять в качестве компонента (Б) молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в настоящем изобретении, можно выводить из человеческой или крысиной последовательности IB1 (инсулинсвязывающий белок 1), предпочтительно из аминокислотной последовательности, представленной в или кодируемой любой из следующих последовательностей: SEQ ID NO:117 (в которой представлена крысиная последовательность кДНК IB1 и предсказанная аминокислотная последовательность), SEQ ID NO:118 (в которой представлена крысиная белковая последовательность IB1, кодируемая экзон-интронным стыком гена rIB1 - донор сайта сплайсинга), SEQ ID NO:119 (в которой представлена белковая последовательность IB1 из Homo sapiens) или SEQ ID NO:120 (в которой представлена последовательность кДНК IB1 из Homo sapiens), или из любых их фрагментов или вариантов. Определение фрагментов и вариантов представлено выше.

Предпочтительно общая длина последовательности ингибитора JNK, которую можно применять в качестве компонента (Б), составляет менее 150 аминокислотных остатков, более предпочтительно 5-150 аминокислотных остатков, более предпочтительно 10-100 аминокислотных остатков, еще более предпочтительно 10-75 аминокислотных остатков и наиболее предпочтительно 10-50 аминокислотных остатков, например, 10-30, 10-20 или 10-15 аминокислотных остатков. Более предпочтительно указанную последовательность ингибитора JNK и вышеуказанные диапазоны можно выбирать из любой из представленных в настоящем описании последовательностей ингибитора JNK, еще более предпочтительно из аминокислотной последовательности, представленной в SEQ ID NO:119, или кодируемой SEQ ID NO:120, еще более предпочтительно из области, состоящей из нуклеотидов 420-980 SEQ ID NO:120 или аминокислот 105-291 SEQ ID NO:119, и наиболее предпочтительно из области, простирающейся между нуклеотидами 561 и 647 SEQ ID NO:120 или аминокислотами 152 и 180 SEQ ID NO:119.

Согласно конкретному варианту осуществления изобретения последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), как правило, связывается с JNK и/или ингибирует активацию по меньшей мере одного активируемого JNK. фактора транскрипции, например, с-Jun или ATF2 (см., например, SEQ ID NO:127 и SEQ ID NO:128 соответственно), или Elk1.

Аналогично этому последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), предпочтительно содержит или состоит по меньшей мере из одной из аминокислотных последовательностей, представленных в любой из SEQ ID NO:117-200, или их фрагмента, производного или варианта. Более предпочтительно последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать 1, 2, 3, 4 или даже большее количество копий аминокислотной последовательности, представленной в SEQ ID NO:117-200, или их варианта, фрагмента или производного. Если они присутствуют в количестве более одной копии, то эти аминокислотные последовательности, представленные в SEQ ID NO:117-200, или их варианты, фрагменты или производные, которые можно применять согласно настоящему описанию, могут быть непосредственно связаны друг с другом без какой-либо линкерной последовательности или через линкерную последовательность, содержащую 1-10, предпочтительно 1-5 аминокислот. Аминокислоты, образующие линкерную последовательность, предпочтительно выбирают из глицина или пролина в качестве аминокислотных остатков. Более предпочтительно эти аминокислотные последовательности, представленные в SEQ ID NO:117-200, или их фрагменты, варианты или производные, которые можно применять согласно настоящему описанию, могут быть отделены друг от друга шарниром, состоящим из двух, трех или большего количества остатков пролина.

Последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), может состоять из L-аминокислот, D-аминокислот или их комбинации. Предпочтительно последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, содержат по меньшей мере 1 или даже 2, предпочтительно по меньшей мере 3, 4 или 5, более предпочтительно по меньшей мере 6, 7, 8 или 9 и даже еще более предпочтительно по меньшей мере 10 или большее количество D- и/или L-аминокислот, при этом D- и/или L-аминокислоты могут располагаться в последовательности ингибитора JNK, которую можно применять согласно настоящему описанию, в виде блока, не в виде блока или в виде другой структуры.

Согласно одному из предпочтительных вариантов осуществления изобретения последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), может состоять только из L-аминокислот. Последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут также содержать или состоять по меньшей мере из одной «нативной последовательности ингибитора JNK», которая представлена в SEQ ID NO:121 или SEQ ID NO:123. В этом контексте понятие «нативная или «нативная(ые) последовательность(и) ингибитора(ов) JNK» относится к неизмененным последовательностям ингибиторов JNK, представленным в любой из SEQ ID NO:121 или SEQ ID NO:123, которые полностью состоят из L-аминокислот.

Таким образом, последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности NH2-Xnb-Xna-RPTTLXLXXXXXXXQD-Xnb-COOH (L-IB-генерик (s)) (SEQ ID NO:123) и/или JNK-связывающего домена (JBD) IB1 XRPTTLXLXXXXXXXQDS/TX (L-IB (генерик) (s)) (SEQ ID NO:131). В контексте настоящего описания Х каждый обозначает аминокислотный остаток, предпочтительно выбранный из любого (нативного) аминокислотного остатка. Xna обозначает, как правило, один аминокислотный остаток, предпочтительно представляющий собой любой аминокислотный остаток кроме серина или треонина, где n (количество повторений X) обозначает 0 или 1. Кроме того, Xnb каждый может представлять собой любой аминокислотный остаток, где n (количество повторений X) обозначает число от 0 до 5, от 5 до 10, от 10 до 15, от 15 до 20, от 20 до 30 или более, при условии, что, если n обозначает 0 в Xna, то Xnb не должен нести серин или треонин на С-конце, для того, чтобы избегать присутствия серина или треонина в указанном положении. Предпочтительно Xnb представляет собой состоящий из смежных полипептидных остатков фрагмент, выведенный из SEQ ID NO:121 или SEQ ID NO:123. Xna и Xnb могут представлять собой либо D-, либо L-аминокислоты. Кроме того, последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности, выбранной из группы, включающей JNK-связывающий домен IB1 DTYRPKRPTTLNLFPQVPRSQDT (L-IB1) (SEQ ID NO:129). Более предпочтительно последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать также или состоять по меньшей мере из одной (нативной) аминокислотной последовательности NH2-RPKRPTTLNLFPQVPRSQD-COOH (L-IB1 (s)) (SEQ ID NO:121). Кроме того, последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности, выбранной из группы, включающей JNK-связывающий домен IB1 L-IB1 (s1) (NH2-TLNLFPQVPRSQD-СООН, SEQ ID NO:133); L-IB1 (s2) (NH2-TTLNLFPQVPRSQ-COOH, SEQ ID NO:134); L-IB1 (s3) (NH2-PTTLNLFPQVPRS-COOH, SEQ ID NO:135); L-IB1 (s4) (NH2-RPTTLNLFPQVPR-COOH, SEQ ID NO:136); L-IB1 (s5) (NH2-KRPTTLNLFPQVP-COOH, SEQ ID NO:137); L-IB1 (s6) (NH2-PKRPTTLNLFPQV-COOH, SEQ ID NO:138); L-IB1 (s7) (NH2-RPKRPTTLNLFPQ-COOH, SEQ ID NO:139); L-IB1 (s8) (NH2-LNLFPQVPRSQD-COOH, SEQ ID NO:140); L-IB1 (s9) (NH2-TLNLFPQVPRSQ-COOH, SEQ ID NO:141); L-IB1 (s10) (NH2-TTLNLFPQVPRS-COOH, SEQ ID NO:142); L-IB1 (s11) (NH2-PTTLNLFPQVPR-COOH, SEQ ID NO:143); L-IB1 (s12) (NH2-RPTTLNLFPQVP-COOH, SEQ ID NO:144); L-IB1 (s13) (NH2-KRPTTLNLFPQV-COOH, SEQ ID NO:145); L-IB1 (s14) (NH2-PKRPTTLNLFPQ-COOH, SEQ ID NO:146); L-IB1 (s15) (NH2-RPKRPTTLNLFP-COOH, SEQ ID NO:147); L-IB1 (s16) (NH2-NLFPQVPRSQD-COOH, SEQ ID NO:148); L-IB1 (s17) (NH2-LNLFPQVPRSQ-COOH, SEQ ID NO:149); L-IB1 (s18) (NH2-TLNLFPQVPRS-COOH, SEQ ID NO:150); L-IB1 (s19) (NH2-TTLNLFPQVPR-COOH, SEQ ID NO:151); L-IB1 (s20) (NH2-PTTLNLFPQVP-COOH, SEQ ID NO:152); L-IB1 (s21) (NH2-RPTTLNLFPQV-COOH, SEQ ID NO:153); L-IB1 (s22) (NH2-KRPTTLNLFPQ-COOH, SEQ ID NO:154); L-IB1 (s23) (NH2-PKRPTTLNLFP-COOH, SEQ ID NO:155); L-IB1 (s24) (NH2-RPKRPTTLNLF-COOH, SEQ ID NO:156); L-IB1 (s25) (NH2-LFPQVPRSQD-COOH, SEQ ID NO:157); L-IB1 (s26) (NH2-NLFPQVPRSQ-COOH, SEQ ID NO:158); L-IB1 (s27) (NH2-LNLFPQVPRS-COOH, SEQ ID NO:159); L-IB1 (s28) (NH2-TLNLFPQVPR-COOH, SEQ ID NO:160); L-IB1 (s29) (NH2-TTLNLFPQVP-COOH, SEQ ID NO:161); L-IB1 (s30) (NH2-PTTLNLFPQV-COOH, SEQ ID NO:162); L-IB1 (s31) (NH2-RPTTLNLFPQ-COOH, SEQ ID NO:163); L-IB1 (s32) (NH2-KRPTTLNLFP-COOH, SEQ ID NO:164); L-IB1 (s33) (NH2-PKRPTTLNLF-COOH, SEQ ID NO:165) и L-IB1 (s34) (NH2-RPKRPTTLNL-COOH, SEQ ID NO:166).

Кроме того, последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности, выбранной из группы, включающей (длинный) JNK-связывающий домен (JBDs) IB1 PGTGCGDTYRPKRPTTLNLFPQVPRSQDT (IB1-длинный) (SEQ ID NO:125), (длинный) JNK-связывающий домен IB2 IPSPSVEEPHKHRPTTLRLTTLGAQDS (IB2-длинный) (SEQ ID NO:126), JNK-связывающий домен с-Jun GAYGYSNPKILKQSMTLNLADPVGNLKPH (c-Jun) (SEQ ID NO:127), JNK-связывающий домен ATF2 TNEDHLAVHKHKHEMTLKFGPARNDSVIV (ATF2) (SEQ ID NO:128). В этом контексте сравнительный анализ продемонстрировал наличие частично консервативной состоящей из 8 аминокислот последовательности, а дополнительное сравнение JBDs IB1 и IB2 продемонстрировало наличие двух блоков из семи и трех аминокислот, высоко консервативных для двух последовательностей.

Последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), может частично или полностью состоять из D-аминокислот. Более предпочтительно эти последовательности ингибиторов JNK, состоящие из D-аминокислот, представляют собой ненативные последовательности описанных выше (нативных) последовательностей ингибиторов JNK, в D-ретро-инвертированной форме.

Понятие «ретро-инвертированные последовательности» относится к изомеру линейной полипептидной последовательности, в котором направление последовательности изменено на противоположное и хиральность каждого аминокислотного остатка является инвертированной (см., например, Jameson и др., Nature, 368, 1994, cc.744-746; Brady и др., Nature, 368, 1994, cc.692-693). Преимущество объединения применения D-энантиомеров и обратного синтеза состоит в том, что положения карбонильных и аминогрупп в каждой амидной связи меняются местами, при этом положение групп боковой цепи на каждом альфа-атоме углерода сохраняется. Если специально не указано иное, предполагается, что любая L-аминокислотная последовательность или полипептид, которую/который можно применять согласно настоящему описанию, может быть превращена/превращен в D-ретро-инвертированную последовательность или полипептид путем синтеза последовательности или полипептида, обратной/обратного относительно нативной L-аминокислотной последовательности или полипептида. В отличие от этого, понятие «обратная последовательность» относится к последовательности, в которой направление последовательности является обратным (но хиральность каждого аминокислотного остатка не является инвертированной) (например, D-Arg-L-Arg-L-Arg→L-Arg-L-Arg-D-Arg).

Таким образом последовательность ингибитора JNK, которую можно применять в качестве компонента (Б), может содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности NH2-Xnb-DQXXXXXXXLXLTTPR-Xna-Xnb-COOH (D-IB1-генерик (s)) (SEQ ID NO:124) и/или XS/TDQXXXXXXXLXLTTPRX (D-IB (генерик)) (SEQ ID NO:132). В контексте настоящего описания X, Xna и Xnb имеют указанные выше значения (предпочтительно обозначают D-аминокислоты), где Xnb предпочтительно обозначает состоящий из смежных остатков фрагмент, полученный из SEQ ID NO:122 или SEQ ID NO:124. Кроме того, последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности, которая содержит JNK-связывающий домен (JBDs) IB1 TDQSRPVQPFLNLTTPRKPRYTD (D-IB1) (SEQ ID NO:130). Более предпочтительно последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности, NH2-DQSRPVQPFLNLTTPRKPR-COOH (D-IB1 (s)) (SEQ ID NO:122). Кроме того, последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности, которая содержит JNK-связывающий домен (JBDs) IB1 D-IB1 (s1) (NH2-QPFLNLTTPRKPR-COOH, SEQ ID NO:167); D-IB1 (s2) (NH2-VQPFLNLTTPRKP-COOH, SEQ ID NO:168); D-IB1 (s3) (NH2-PVQPFLNLTTPRK-COOH, SEQ ID NO:169); D-IB1 (s4) (NH2-RPVQPFLNLTTPR-COOH, SEQ ID NO:170); D-IB1 (s5) (NH2-SRPVQPFLNLTTP-COOH, SEQ ID NO:171); D-IB1 (s6) (NH2-QSRPVQPFLNLTT-COOH, SEQ ID NO:172); D-IB1 (s7) (NH2-DQSRPVQPFLNLT-COOH, SEQ ID NO:173); D-IB1 (s8) (NH2-PFLNLTTPRKPR-COOH, SEQ ID NO:174); D-IB1 (s9) (NH2-QPFLNLTTPRKP-COOH, SEQ ID NO:175); D-IB1 (s10) (NH2-VQPFLNLTTPRK-COOH, SEQ ID NO:176); D-IB1 (s11) (NH2-PVQPFLNLTTPR-COOH, SEQ ID NO:177); D-IB1 (s12) (NH2-RPVQPFLNLTTP-COOH, SEQ ID NO:178); D-IB1 (s13) (NH2-SRPVQPFLNLTT-COOH, SEQ ID NO:179); D-IB1 (s14) (NH2-QSRPVQPFLNLT-COOH, SEQ ID NO:180); D-IB1 (s15) (NH2-DQSRPVQPFLNL-COOH, SEQ ID NO:181); D-IB1 (s16) (NH2-FLNLTTPRKPR-COOH, SEQ ID NO:182); D-IB1 (s17) (NH2-PFLNLTTPRKP-COOH, SEQ ID NO:183); D-IB1 (s18) (NH2-QPFLNLTTPRK-COOH, SEQ ID NO:184); D-IB1 (s19) (NH2-VQPFLNLTTPR-COOH, SEQ ID NO:185); D-IB1 (s20) (NH2-PVQPFLNLTTP-COOH, SEQ ID NO:186); D-IB1 (s21) (NH2-RPVQPFLNLTT-COOH, SEQ ID NO:187); D-IB1 (s22) (NH2-SRPVQPFLNLT-COOH, SEQ ID NO:188); D-IB1 (s23) (NH2-QSRPVQPFLNL-COOH, SEQ ID NO:189); D-IB1 (s24) (NH2-DQSRPVQPFLN-COOH, SEQ ID NO:190); D-IB1 (s25) (NH2-DQSRPVQPFL-COOH, SEQ ID NO:191); D-IB1 (s26) (NH2-QSRPVQPFLN-COOH, SEQ ID NO:192); D-IB1 (s27) (NH2-SRPVQPFLNL-COOH, SEQ ID NO:193); D-IB1 (s28) (NH2-RPVQPFLNLT-COOH, SEQ ID NO:194); D-IB1 (s29) (NH2-PVQPFLNLTT-COOH, SEQ ID NO:195); D-IB1 (s30) (NH2-VQPFLNLTTP-COOH, SEQ ID NO:196); D-IB1 (s31) (NH2-QPFLNLTTPR-COOH, SEQ ID NO:197); D-IB1 (s32) (NH2-PFLNLTTPRK-COOH, SEQ ID NO:198); D-IB1 (s33) (NH2-FLNLTTPRKP-COOH, SEQ ID NO:199) и D-IB1 (s34) (NH2-LNLTTPRKPR-COOH, SEQ ID NO:200).

Примеры последовательности ингибитора JNK, которую можно применять в качестве компонента (Б), представлены в таблице 1 (SEQ ID NO:121-200). В таблице представлены обозначения предлагаемых в изобретении последовательностей ингибиторов JNK, а также идентификационный номер последовательности, их длина и аминокислотная последовательность. Кроме того, в таблице 3 представлены выведенные из IB1 последовательности, а также их общие формулы, например, для SEQ ID NO:121 и SEQ ID NO:122, и SEQ ID NO:123 и SEQ ID NO:124 соответственно. В таблице 3 приведены также последовательности L-IB1, представленные в SEQ ID NO:133-166, и последовательности D-IB1, представленные в SEQ ID NO:167-200.

Таблица 3
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
L-IB1 (s) 121 19 RPKRPTTLNLFPQVPRSQD (NH2-RPKRPTTLNLFPQVPRSQD-COOH)
D-IB1 (s) 122 19 DQSRPVQPFLNLTTPRKPR (NH2-DQSRPVQPFLNLTTPRKPR-COOH)
L-IB (генерик) (s) 123 19 NH2-Xnb-Xna-RPTTLXLXXXXXXXQD-Xnb-COOH
D-IB (генерик) (s) 124 19 NH2-DQXXXXXXXLXLTTPR-Xna-Xnb-СООН
IB1-длинный 125 29 PGTGCGDTYRPKRPTTLNLFPQVPRSQDT (NH2-PGTGCGDTYRPKRPTTLNLFPQVPRSQDT-COOH)
IB2-длинный 126 27 IPSPSVEEPHKHRPTTLRLTTLGAQDS (NH2-IPSPSVEEPHKHRPTTLRLTTLGAQDS-COOH)
c-Jun 127 29 GAYGYSNPKILKQSMTLNLADPVGNLKPH (NH2-GAYGYSNPKILKQSMTLNLADPVGNLKPH-COOH)
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
ATF2 128 29 TNEDHLAVHKHKHEMTLKFGPARNDSVIV (NH,-TNEDHLAVHKHKHEMTLKFGPARNDSVIV -COOH)
L-IB1 129 23 DTYRPKRPTTLNLFPQVPRSQDT (NH2-DTYRPKRPTTLNLFPQVPRSQDT-COOH)
D-IB1 130 23 TDQSRPVQPFLNLTTPRKPRYTD (NH2-TDQSRPVQPFLNLTTPRKPRYTD-COOH)
L-IB (генерик) 131 19 XRPTTLXLXXXXXXXQDS/TX (NH2-XRPTTLXLXXXXXXXQDS/TX-COOH)
D-IB (генерик) 132 19 XS/TDQXXXXXXXLXLTTPRX (NH2-XS/TDQXXXXXXXLXLTTPRX-COOH)
L-IB1 (s1) 133 13 TLNLFPQVPRSQD (NH2-TLNLFPQVPRSQD-COOH)
L-IB1 (s2) 134 13 TTLNLFPQVPRSQ (NH2-TTLNLFPQVPRSQ-COOH)
L-IB1 (s3) 135 13 PTTLNLFPQVPRS (NH2-PTTLNLFPQVPRS-COOH)
L-IB1 (s4) 136 13 RPTTLNLFPQVPR (NH2-RPTTLNLFPQVPR-COOH)
L-IB1 (s5) 137 13 KRPTTLNLFPQVP (NH2-KRPTTLNLFPQVP-COOH)
L-IB1 (s6) 138 13 PKRPTTLNLFPQV (NH2-PKRPTTLNLFPQV-COOH)
L-IB1 (s7) 139 13 RPKRPTTLNLFPQ (NH2-RPKRPTTLNLFPQ-COOH)
L-IB1 (s8) 140 12 LNLFPQVPRSQD (NH2-LNLFPQVPRSQD-COOH)
L-IB1 (s9) 141 12 TLNLFPQVPRSQ (NH2-TLNLFPQVPRSQ-COOH)
L-IB1 (s10) 142 12 TTLNLFPQVPRS (NH2-TTLNLFPQVPRS-COOH)
L-IB1 (s11) 143 12 PTTLNLFPQVPR (NH2-PTTLNLFPQVPR-COOH)
L-IB1 (s12) 144 12 RPTTLNLFPQVP (NH2-RPTTLNLFPQVP-COOH)
L-IB1 (s13) 145 12 KRPTTLNLFPQV (NH2-KRPTTLNLFPQV-COOH)
L-IB1 (s14) 146 12 PKRPTTLNLFPQ (NH2-PKRPTTLNLFPQ-COOH)
L-IB1 (s15) 147 12 RPKRPTTLNLFP (NH2-RPKRPTTLNLFP-COOH)
L-IB1 (s16) 148 11 NLFPQVPRSQD (NH2-NLFPQVPRSQD-COOH)
L-IB1 (s17) 149 11 LNLFPQVPRSQ (NH2-LNLFPQVPRSQ-COOH)
L-IB1 (s18) 150 11 TLNLFPQVPRS (NH2-TLNLFPQVPRS-COOH)
L-IB1 (s19) 151 11 TTLNLFPQVPR (NH2-TTLNLFPQVPR-COOH)
L-IB1 (s20) 152 11 PTTLNLFPQVP (NH2-PTTLNLFPQVP-COOH)
L-IB1 (s21) 153 11 RPTTLNLFPQV (NH2-RPTTLNLFPQV-COOH)
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
L-IB1 (s22) 154 11 KRPTTLNLFPQ (NH2-KRPTTLNLFPQ-COOH)
L-IB1 (s23) 155 11 PKRPTTLNLFP (NH2-PKRPTTLNLFP-COOH)
L-IB1 (s24) 156 11 RPKRPTTLNLF (NH2-RPKRPTTLNLF-COOH)
L-IB1 (s25) 157 10 LFPQVPRSQD (NH2-LFPQVPRSQD-COOH)
L-IB1 (s26) 158 10 NLFPQVPRSQ (NH2-NLFPQVPRSQ-COOH)
L-IB1 (s27) 159 10 LNLFPQVPRS (NH2-LNLFPQVPRS-COOH)
L-IB1 (s28) 160 10 TLNLFPQVPR (NH2-TLNLFPQVPR-COOH)
L-IB1 (s29) 161 10 TTLNLFPQVP (NH2-TTLNLFPQVP-COOH)
L-IB1 (s30) 162 10 PTTLNLFPQV (NH2-PTTLNLFPQV-COOH)
L-IB1 (s31) 163 10 RPTTLNLFPQ (NH2-RPTTLNLFPQ-COOH)
L-IB1 (s32) 164 10 KRPTTLNLFP (NH2-KRPTTLNLFP-COOH)
L-IB1 (s33) 165 10 PKRPTTLNLF (NH2-PKRPTTLNLF-COOH)
L-IB1 (s34) 166 10 RPKRPTTLNL (NH2-RPKRPTTLNL-COOH)
D-IB1 (s1) 167 13 QPFLNLTTPRKPR (NH2-QPFLNLTTPRKPR-COOH)
D-IB1 (s2) 168 13 VQPFLNLTTPRKP (NH2-VQPFLNLTTPRKP-COOH)
D-IB1 (s3) 169 13 PVQPFLNLTTPRK (NH2-PVQPFLNLTTPRK-COOH)
D-IB1 (s4) 170 13 RPVQPFLNLTTPR (NH2-RPVQPFLNLTTPR-COOH)
D-IB1 (s5) 171 13 SRPVQPFLNLTTP (NH2-SRPVQPFLNLTTP-COOH)
D-IB1 (s6) 172 13 QSRPVQPFLNLTT (NH2-QSRPVQPFLNLTT-COOH)
D-IB1 (s7) 173 13 DQSRPVQPFLNLT (NH2-DQSRPVQPFLNLT-COOH)
D-IB1 (s8) 174 12 PFLNLTTPRKPR (NH2-PFLNLTTPRKPR-COOH)
D-IB1 (s9) 175 12 QPFLNLTTPRKP (NH2-QPFLNLTTPRKP-COOH)
D-IB1 (s10) 176 12 VQPFLNLTTPRK (NH2-VQPFLNLTTPRK-COOH)
D-IB1 (s11) 177 12 PVQPFLNLTTPR (NH2-PVQPFLNLTTPR-COOH)
D-IB1 (s12) 178 12 RPVQPFLNLTTP (NH2-RPVQPFLNLTTP-COOH)
D-IB1 (s13) 179 12 SRPVQPFLNLTT (NH2-SRPVQPFLNLTT-COOH)
D-IB1 (s14) 180 12 QSRPVQPFLNLT (NH2-QSRPVQPFLNLT-COOH)
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
D-IB1 (s15) 181 12 DQSRPVQPFLNL (NH2-DQSRPVQPFLNL-COOH)
D-IB1 (s16) 182 11 FLNLTTPRKPR (NH2-FLNLTTPRKPR-COOH)
D-IB1 (s17) 183 11 PFLNLTTPRKP (NH2-PFLNLTTPRKP-COOH)
D-IB1 (s18) 184 11 QPFLNLTTPRK (NH2-QPFLNLTTPRK-COOH)
D-IB1 (s19) 185 11 VQPFLNLTTPR (NH2-VQPFLNLTTPR-COOH)
D-IB1 (s20) 186 11 PVQPFLNLTTP (NH2-PVQPFLNLTTP-COOH)
D-IB1 (s21) 187 11 RPVQPFLNLTT (NH2-RPVQPFLNLTT-COOH)
D-IB1 (s22) 188 11 SRPVQPFLNLT (NH2-SRPVQPFLNLT-COOH)
D-IB1 (s23) 189 11 QSRPVQPFLNL (NH2-QSRPVQPFLNL-COOH)
D-IB1 (s24) 190 11 DQSRPVQPFLN (NH2-DQSRPVQPFLN-COOH)
D-IB1 (s25) 191 10 DQSRPVQPFL (NH2-DQSRPVQPFL-COOH)
D-IB1 (s26) 192 10 QSRPVQPFLN (NH2-QSRPVQPFLN-COOH)
D-IB1 (s27) 193 10 SRPVQPFLNL (NH2-SRPVQPFLNL-COOH)
D-IB1 (s28) 194 10 RPVQPFLNLT (NH2-RPVQPFLNLT-COOH)
D-IB1 (s29) 195 10 PVQPFLNLTT (NH2-PVQPFLNLTT-COOH)
D-IB1 (s30) 196 10 VQPFLNLTTP (NH2-VQPFLNLTTP-COOH)
D-IB1 (s31) 197 10 QPFLNLTTPR (NH2-QPFLNLTTPR-COOH)
D-IB1 (s32) 198 10 PFLNLTTPRK (NH2-PFLNLTTPRK-COOH)
D-IB1 (s33) 199 10 FLNLTTPRKP (NH2-FLNLTTPRKP-COOH)
D-IB1 (s34) 200 10 LNLTTPRKPR (NH2-LNLTTPRKPR-COOH)

Последовательности ингибиторов JNK, которые можно применять в качестве компонента (Б), могут содержать также или состоять по меньшей мере из одного варианта, фрагмента и/или производного указанных выше предлагаемых в изобретении нативных или ненативных аминокислотных последовательностей, представленных в SEQ ID NO:121-200. Предпочтительно эти варианты, фрагменты и/или производные сохраняют биологическую функцию/активность описанных выше нативных или ненативных последовательностей ингибиторов JNK, которые можно применять согласно настоящему изобретению, прежде всего нативных или ненативных аминокислотных последовательностей, представленных в SEQ ID NO:121-200, т.е. способность связываться с JNK и/или ингибировать активацию по меньшей мере одного активируемого JNK фактора транскрипции, например, c-Jun, ATF2 или Elk1 (методы оценки функциональной способности/активности описаны выше).

Эффекторные молекулы, которые можно применять в качестве компонента (Б), можно выбирать также из антигенов или антигенных фрагментов, предпочтительно белковых и полипептидных антигенов, например, опухолевых антигенов или их антигенных фрагментов, вызывающих аллергию антигенов или их антигенных фрагментов, аутоантигенов или их антигенных фрагментов, патогенных антигенов или их антигенных фрагментов и антигенов или их антигенных фрагментов из вирусов, предпочтительно таких вирусов, как цитомегаловирус (CMV), ортопоксвирус оспы, ортопоксвирус белой оспы, овечий паратоксвирус, вирус контагиозного моллюска, вирус герпеса простого 1, вирус герпеса простого 2, вирус герпеса В, вирус ветряной оспы, вирус ложного бешенства, вирус человеческой цитомегалии, человеческий вирус герпеса 6, человеческий вирус герпеса 7, вирус Эпштейна-Барра, человеческий вирус герпеса 8, вирус гепатита В, вирус чикунгунья, вирус O'nyong'nyong, рубивирус, вирус гепатита С, GB-вирус С, вирус Западного Нила, вирус лихорадки Денге, вирус желтой лихорадки, вирус шотландского энцефаломиелита овец (louping-вирус), вирус энцефалита Сент-Луис, вирус японского энцефалита В, вирус Повассан, вирус FSME, вирус SARS (тяжелый острый респираторный синдром), SARS-ассоциированный коронавирус, человеческий коронавирус 229Е, человеческий коронавирус Ос43, торовирус, человеческий Т-клеточный лимфотропный вирус типа I, человеческий Т-клеточный лимфотропный вирус типа II, ВИЧ (СПИД), т.е. человеческий вирус иммунодефицита типа 1 или человеческий вирус иммунодефицита типа 2, вирус гриппа, вирус лихорадки Лаоса, вирус лимфоцитарного хориоменингита, вирус комплекса Такарибе, вирус Хурин, вирус Мачупо, вирус болезни Борна, вирус Буньямвера, вирус калифорнийского энцефалита, вирус лихорадки долины Рифт, вирус лихорадки песчаных мух, вирус лихорадки Тоскана, вирус геморрагической лихорадки Крым-Конго, вирус Хазара, вирус Казань, вирус Хантаан, вирус Сеул, вирус Проспект Хилл, вирус Пуумала, вирус Белград-Дубрава, вирус Тула (Tula-вирус), вирус Sin Nombre («вирус без имени»), вирус Марбург озера Виктория, вирус Эбола Заира, суданский вирус Эбола, вирус Эбола Берега Слоновой Кости, вирус гриппа А, вирус гриппа В, вирус гриппа С, вирус парагриппа, вирус малярии, вирус Марбург, вирус кори, вирус эпидемического паротита (свинки), респираторно-синцитиальный вирус, человеческий метапневмовирус, индийский вирус везикулярного стоматита, вирус бешенства, вирус Мокола, вирус Дувенхаге, европейский лиссавирус летучих мышей 1+2, австралийский вирус летучих мышей, аденовирус A-F, вирусы папилломы человека, вирус кондиломы 6, вирус кондиломы 11, вирусы полиомы, аденоассоциированный вирус 2, ротавирус, орбивирусы, вирусы оспы, включая вирус ветряной оспы и др., или антигены или антигенные фрагменты из лейшманий, трипаносом, амеб, бактерий и др., или их можно выбирать их эпитопов или из вариантов вышеуказанных антигенов или антигенных фрагментов. Предпочтительно фрагменты, а также варианты антигенов, указанных выше, отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одним из антигенов или последовательностей антигенов, которые описаны выше. В этом контексте к определению фрагментов и вариантов применимы указанные выше понятия. Кроме того, под объем изобретения подпадают эпитопы (которые обозначают также как «антигенные детерминанты») антигенов или антигенных фрагментов, указанных выше.

Кроме того, эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, являющихся транспортерами карго-молекулы, можно выбирать из антител. Согласно настоящему изобретению указанные антитела можно выбирать из антител, например, полученных рекомбинантным путем или встречающихся в естественных условиях антител, известных в данной области, в частности антител, пригодных для терапевтических, диагностических или научных целей, или антител, идентифицированных в качестве специфических для определенных раковых заболеваний. В контексте настоящего описания понятие «антитело» используется в его наиболее широком смысле и относится, в частности, к моноклинальным и поликлональным антителам (включая агонистические, антагонистические и блокирующие или нейтрализующие антитела) и видам антител с полиэпитопной специфичностью. Согласно изобретению «антитело», как правило, включает любые антитела, известные в данной области (например, антитела типа IgM, IgD, IgG, IgA и IgE), в том встречающиеся в естественных условиях антитела, антитела, полученные иммунизацией организма-хозяина, антитела, которые выделены и идентифицированы из встречающегося в естественных условиях источника, или антитела, полученные иммунизацией организма-хозяина и полученные рекомбинантным путем с помощью методов молекулярной биологии, известных в данной области, а также химерные антитела, человеческие антитела, гуманизированные антитела, биспецифические антитела, антитела к внутреннему фактору, т.е. антитела, экспрессирующиеся в клетках и необязательно локализованные в специфических клеточных компартментах, и фрагменты и варианты указанных выше антител. Как правило, антитело состоит из легкой цепи и тяжелой цепи, которые обе имеют вариабельные и константные области. Легкая цепь состоит из N-концевой вариабельной области, VL, и С-концевой константной области, CL. В отличие от этого, тяжелая цепь антитела типа IgG, например, состоит из N-концевой вариабельной области, VH, и трех константных областей, CH1, CH2 и CH3. В этом контексте антитела содержат также фрагменты и варианты описанных выше антител, например, Fab-фрагмент, Fc-фрагмент и т.д. Предпочтительно указанные фрагменты, а также варианты антител, указанных выше, отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одним из антител, описанных выше. В этом контексте к понятиям «фрагменты» и «варианты» применимы указанные выше определения.

Кроме того, компонент (Б) в предлагаемых в изобретении молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать из факторов, индуцирующих апоптоз, или связанных с апоптозом белков, таких как AIF, Apaf, например, Apaf-1, Apaf-2, Apaf-3, или АРО-2 (L), АРО-3 (L), апопаин, Bad, Bak, Bax, Bcl-2, Bcl-xL, Bcl-xS, bik, Bok, CAD, калпаин, каспаза, например, каспаза-1, каспаза-2, каспаза-3, каспаза-4, каспаза-5, каспаза-6, каспаза-7, каспаза-8, каспаза-9, каспаза-10, каспаза-11, ced-3, ced-9, c-Jun, c-Мус, crm А, цитохром С, CdR1, DcR1, DD, DED, DISC, ДНК-PKCS, DR3, DR4, DR5, FADD/MORT-1, FAK, Fas (Fas-лиганд CD95/fas (рецептор)), FLICE/MACH, FLIP, фодрин, fos, G-актин, Gas-2, гелсолин, гранзим А/В, ICAD, ICE, JNK, ламин А/В, MAP, Max, MCL-1, Mdm-2, MEKK-1, MORT-1, Myd88, NEDD, NF-каппаВ, NuMa, p38, p53, PAK-2, PARP, перфорин, PITSLRE, РKСдельта, pRb, презенилин, prICE, RAIDD, Ras, RIP, сфингомиелиназа, тимидинкиназа вируса герпеса простого, TRADD, TRAF2, TRAIL-R1, TRAIL-R2, TRAIL-R3, трансглутаминаза и т.д., или из их фрагментов или вариантов, или из компонентов пути передачи сигналов wnt, таких как β-катенин, или ICF-семейство, полоподобные киназы, CiP2A, PP2A и т.д., или из их фрагментов или вариантов. Предпочтительно указанные фрагменты, а также варианты отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одной из последовательностей, описанных выше. В этом контексте к определению фрагментов и вариантов применимы указанные выше понятия.

Эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать также по меньшей мере из одного или нескольких частичных или полноразмерных ВН3-доменов и/или по меньшей мере одного частичного или полноразмерного белка «ВН3-только». В этом контексте белки «ВН3-только» предпочтительно определяют как представители Bcl-2-семейства, включающего регуляторы апоптоза, которые взаимодействуют с другими представителями Bcl-2-семейства. В этом контексте предлагаемый в настоящем изобретении компонент (Б) молекулы-конъюгата, которая является транспортером карго-молекулы, можно выбирать из аминокислотной последовательности, которая содержит по меньшей мере одну или несколько частичную(ых) или полноразмерную(ых) последовательность(ей) ВН3-домена белка «ВН3-только», или частичный или полноразмерный белок «ВН3-только» (который относится к подклассу семейства белков Bcl-2), который(ые) обладает(ют) способностью индуцировать апоптоз либо путем взаимодействия по меньшей мере с одним белком Bcl-2-семейства, либо путем активации или сенсибилизации по меньшей мере одного проапоптозного представителя Bcl-2-семейства. Их функциональную активность можно тестировать с помощью пригодных методов анализа, например, с помощью анализов связывания или путем анализа проапоптозной активности с помощью анализа апоптоза. Предпочтительно аминокислотная последовательность, применяемая в качестве компонента (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может содержать или состоять по меньшей мере из одной частичной или полноразмерной последовательности ВН3-домена и/или по меньшей мере одной частичной или полноразмерной последовательности белка «ВН3-только», выбранной из группы, включающей Bid, Bad, Noxa, Puma, Bim, Bik, Bmf, DP5/Hrk и Bok. В другом варианте аминокислотная последовательность, применяемая в качестве компонента (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может содержать или состоять по меньшей мере из комбинации по меньшей мере одной частичной или полноразмерной последовательности белка «ВН3-только», выбранной из группы, включающей, например, Bid и Bad, Bim и Bad, Bik и Bad, Puma и Bad, Noxa и Bad, Bmf и Bad, DP5/Hrk и Bad, Bok и Bad, Bik и Bim, Bik и Bid, Bik и Puma, Bik и Noxa, Bik и Bmf, Bik и DP5/Hrk, Bik и Bok, Bid и Puma, Bid и Noxa, Bid и Bim, Bid и Bmf, Bid и DP5/Hrk, Bid и Bok, Bim и Noxa, Bim и Puma, Bim и Bmf, Bim и DP5/Hrk, Bim и Bok, Puma и Noxa, Puma и Bmf, Puma и DP5 / Hrk, Puma и Bok, Noxa и Bmf, Noxa и DP5/Hrk и Noxa и Bok. (Полноразмерные или частичные) ВН3-последовательности или последовательности белка «ВН3-только», указанные выше, можно выбирать, например, из любого белка «ВН3-только» млекопитающих, в частности, из человеческих изоформ. Таким образом, компонент (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может содержать или состоять по меньшей мере из одной частичной или полноразмерной последовательности ВН3-домена и/или по меньшей мере одной последовательности белка «ВН3-только», эти последовательности представлены в любой из SEQ ID NO:201-217 (см. таблицу ВН3-доменов). Предпочтительно аминокислотная последовательность, применяемая в качестве компонента (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может также содержать или состоять по меньшей мере из одного фрагмента или варианта по меньшей мере частичной или полноразмерной последовательности ВН3-домена и/или по меньшей мере одной последовательности белка «ВН3-только», представленной в одной из SEQ ID NO:201-217. Указанные фрагменты, а также варианты отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одной из последовательностей, описанных выше или представленных в одной из SEQ ID NO:201-217. В этом контексте к определению фрагментов и вариантов применимы указанные выше понятия. Кроме того, фрагменты или варианты нативных последовательностей, как правило, содержат последовательности ВН3-домена или содержат по меньшей мере часть последовательности ВН3-домена (по меньшей мере 7 аминокислот из последовательности ВН3-домена).

Таблица
ВН3-доменов
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
Bid (человеческий) (вариант транскрипта 1) 201 241 MCSGAGVMMA RWAARGRAGW RSTVRILSPL GHCEPGVSRS CRAAQAMDCE VNNGSSLRDE C1TNLLVFGF LQSCSDNSFR RELDALGHEL PVLAPQWEGY DELQTDGNRS SHSRLGRIEA DSESQEDIIRNIARHLAQVG DSMDRSIPPG LVNGLALQLR NTSRSEEDRN RDLATALEQL LQAYPRDMEK EKTMLVLALL LAKKVASHTP SLLRDVFHTT VNFINQNLRT YVRSLARNGM D
Bad (человеческий) 202 168 MFQIPEFEPS EQEDSSSAER GLGPSPAGDG PSGSGKHHRQ APGLLWDASH QQEQPTSSSH HGGAGAVEIR SRHSSYPAGT EDDEGMGEEP SPFRGRSRSA PPNLWAAQRY GRELRRMSDE FVDSFKKGLP RPKSAGTATQ MRQSSSWTRV FQSWWDRNLG RGSSAPSQ
Noxal (человеческий) 203 483 MASLGDLVRA WHLGAQAVDR GDWARALHLF SGVPAPPARL CFNAGCVHLL AGDPEAALRA FDQAVTKDTC MAVGFFQRGV ANFQLARFQE ALSDFWLALE QLRGHAAIDY TQLGLRFKLQ AWEVLHNVAS AQCQLGLWTE AASSLREAMS KWPEGSLNGL DSALDQVQRR GSLPPRQVPR GEVFRPHRWH LKHLEPVDFL GKAKVVASAI PDDQGWGVRP QQPQGPGANH DARSLIMDSP RAGTHQGPLD AETEVGADRC TSTAYQEQRP QVEQVGKQAP LSPGLPAMGG PGPGPCEDPA GAGGAGAGGS EPLVTVTVQC AFTVALRARR GADLSSLRAL LGQALPHQAQ LGQLSYLAPG EDGHWVPIPE EESLQRAWQD AAACPRGLQL
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
QCRGAGGRPV LYQVVAQHSY SAQGPEDLGF RQGDTVDVLC EEPDVPLAVD QAWLEGHCDG RIGIFPKCFV VPAGPRMSGA PGRLPRSQQG DQP
Puma (человеческий) 204 193 MARARQEGSS PEPVEGLARD GPRPFPLGRL VPSAVSCGLC EPGLAAAPAA PTLLPAAYLC APTAPPAVTA ALGGSRWPGG PRSRPRGPRP DGPQPSLSLA EQHLESPVPS APGALAGGPT QAAPGVRGEE EQWAREIGAQ LRRMADDLNA QYERRRQEEQ QRHRPSPWRV LYNLIMGLLP LPRGHRAPEM EPN
Bim (человеческий)(вариант транскрипта 1) 205 198 MAKQPSDVSS ECDREGRQLQ PAERPPQLRP GAPTSLQTEP QGNPEGNHGG EGDSCPHGSP QGPLAPPASP GPFATRSPLF IFMRRSSLLS RSSSGYFSFD TDRSPAPMSC DKSTQTPSPP CQAFNHYLSA MASMRQAEPA DMRPEIWIAQ ELRRIGDEFN AYYARRVFLN NYQAAEDHPR MVILRLLRYI VRLVWRMH
Bik (человеческий) 206 160 MSEVRPLSRD ILMETLLYEQ LLEPPTMEVL GMTDSEEDLD PMEDFDSLEC MEGSDALALR LACIGDEMDV SLRAPRLAQL SEVAMHSLGL AFIYDQTEDI RDVLRSFMDG FTTLKENIMR FWRSPNPGSW VSCEQVLLAL LLLLALLLPL LSGGLHLLLK
ВН3-домен Bik (BH3 Bik) 207 18 ALALRLACIG DEMDVSLR
ВН3-домен Bad (BH3 Bad) 208 18 RYGRELRRMS DEFVDSFK
ВН3-домен Bid (BH3 Bid) 209 18 NIARHLAQVG DSMDRSIP
ВН3-домен Bmf (BH3 BmQ 210 18 QIARKLQCIA DQFHRLHV
ВН3-домен DP5/Hrk (BH3 DP5Hrk) 211 18 LTAARLKAIG DELHQRTM
ВН3-домен Bim (BH3 Bim) 212 18 WIAQELRRIG DEFNAYYA
ВН3-домен Noxa (BH3 Noxa) 213 18 ECATQLRRFG DKLNFRQK
ВН3-домен PUMA (BH3 PUMA) 214 18 EIGAQLRRMA DDLNAQYE
ВН3-домен Bax (BH3 Bax) 215 18 KLSECLKRIG DELDSNME
ВН3-домен Bak (BH3 Bak) 216 18 QVGRQLAIIG DDINRRYD
ВН3-домен Bok (BH3 Bok) 217 18 EVCTVLLRLG DELEQIRP

Белковые или полипептидные последовательности, представленные в настоящем описании, например, терапевтически активные белки, антигены, антитела, проапоптозные факторы, протеазы, участвующие в патологических состояниях, предпочтительно ингибиторы пептидных протеаз, ВН3-домены и т.д., которые можно применять в качестве компонента (Б), могут представлять собой белковую или полипептидную последовательность либо в нативной форме, состоящую из L-аминокислот, либо в ретро-инвертированной D-форме (полностью), состоящую из D-аминокислот, это означает, что указанные последовательности могут быть инвертированы путем замены друг на друга концов: нативный С-конец представляет собой N-конец инвертированной формы, а нативный N-конец представляет собой С-конец инвертированной формы. В другом варианте эти белковые или полипептидные последовательности, описанные выше, могут иметь белковую или полипептидную последовательность, представляющую собой смесь L-аминокислот и D-аминокислот.

Компонент (Б) можно выбирать также из нуклеиновых кислот, предпочтительно из нуклеиновых кислот, кодирующих указанные выше белки или полипептиды, такие как терапевтически активные белки и полипептиды, антигены, антитела, проапоптозные факторы, протеазы, участвующие в патологических состояниях, предпочтительно ингибиторы пептидных протеаз, ВН3-домены или части или полноразмерные белки «BH3-только» или варианты их фрагментов. В этом контексте нуклеиновые кислоты предпочтительно содержат одноцепочечные, двухцепочечные или частично двухцепочечные нуклеиновые кислоты, предпочтительно выбранные из группы, включающей геномную ДНК, кДНК, РНК, siPHK, антисмысловую ДНК, антисмысловую РНК, микроРНК, рибозим, комплементарные последовательности РНК/ДНК с контролирующими экспрессию элементами или без них, миниген, фрагменты гена, регуляторные элементы, промоторы и их комбинации.

В другом конкретном примере компонент (Б) можно выбирать из различных siPHK. В этом контексте представляют интерес прежде всего siPHK в сочетании с явлением РНК-интерференции. Внимание к явлению РНК-интерференции возникло в процессе иммунологических исследований. В последние годы был открыт основанный на РНК защитный механизм, который встречается как в царстве грибов и растений, так и в царстве животных, и который действует в качестве «иммунной системы генома». Эта система впервые была описана независимо друг от друга в различных видах, сначала в С. elegans, до того, как стало возможным идентифицировать механизмы, лежащие в основе этих процессов, как идентичные: опосредуемая РНК устойчивость к вирусам растений, PTGS (пост-транскрипционное молчание генов) у растений и РНК-интерференция у эукариот фактически основаны на общем процессе. Метод in vitro РНК-интерференции (PHKi) основан на двухцепочечных молекулах РНК (dsPHK), которые «запускают» специфическую для последовательности супрессию генной экспрессии (Zamore, Nat. Struct. Biol. 9, 2001, сс.746-750; Sharp, Genes Dev. 5, 2001. сс.485-490: Hannon, Nature 41, 2002, сс.244-251). При трансфекции клеток млекопитающих длинной dsPHK активация протеинкиназы R и КНКазыЬ приводит к неспецифическим воздействиям, таким, например, как интерфероновая реакция (Stark и др., Annu. Rev. Biochem. 67, 1998, сс.227-264; Не и Katze, Viral Immunol. 15, 2002, сс.95-119). Эти неспецифические явления не происходят, когда используют более короткую, например, 21-23-мерную так называемую siPHK (малая интерферирующая РНК), поскольку неспецифические явления не «запускаются» siPHK, которая состоит менее чем из 30 пар оснований (Elbashir и др., Nature 411, 2001, сс.494-498). В настоящее время молекулы dsPHK применяют также in vivo (McCaffrey и др., Nature 418, 2002, сс.38-39; Xia и др., Nature Biotech. 20, 2002, сс.1006-1010; Brummelkamp и др., Cancer Cell 2, 2002, сс.243-247). Таким образом, siPHK, которые применяют в виде эффекторной молекулы, пригодной в качестве компонента (Б) в предлагаемых в изобретении молекулах-конъюгатах, которые являются транспортерами карго-молекулы, как правило, представляют собой одно- или двухцепочечную, предпочтительно двухцепочечную последовательность РНК, состоящую примерно из 8-30 нуклеотидов, предпочтительно из 17-25 нуклеотидов, еще более предпочтительно из 20-25 и наиболее предпочтительно из 21-23 нуклеотидов. В принципе все сегменты, состоящие из 17-29, предпочтительно 19-25, наиболее предпочтительно 21-23 пар оснований, которые присутствуют в кодирующей области белка (последовательность), указанные выше, могут служить в качестве последовательности-мишени для siPHK. Равным образом, siPHK могут быть направлены против описанных выше нуклеотидных последовательностей, кодирующих белок (последовательность), которые не находятся в кодирующей области, в частности, например, в 5'-некодирующей области РНК, таким образом, направлены против некодирующих областей РНК, которые обладают регуляторной функцией. Таким образом, последовательность-мишень для siPHK может лежать в транслируемой и/или нетранслируемой области РНК и/или в области контролирующих элементов. Последовательность-мишень для siPHK может лежать также в области, перекрывающей нетранслируемую и транслируемую последовательность; в частности, последовательность-мишень может содержать по меньшей мере один нуклеотид, расположенный против хода транскрипции относительно стартового триплета кодирующей области.

В другом конкретном примере компонент (Б) можно выбирать из числа антисмысловых РНК. В этом контексте антисмысловая РНК предпочтительно представляет собой (одноцепочечную) молекулу РНК, транскрибируемую на основе кодирующей, а не матричной цепи (геномной) ДНК, в результате чего она является комплементарной смысловой (матричной) РНК. Антисмысловая РНК, которую можно применять в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, как правило, входит в дуплекс между смысловой и антисмысловой молекулой РНК и поэтому обладает способностью блокировать трансляцию соответствующей мРНК. В контексте настоящего описания антисмысловая РНК может быть направлена против любой части последовательности мРНК, например, выведенной из геномной ДНК, и/или которая может кодировать любой белок, например, белок или полипептид, описанные выше, такие как терапевтически активные белки и полипептиды, антигены, антитела, проапоптозные факторы, протеазы, участвующие в патологических состояниях, предпочтительно ингибиторы пептидных протеаз, ВН3-домены или части или полноразмерные белки «ВН3-только» или варианты их фрагментов, которые описаны выше, если трансляция кодируемого белка или полипептида снижается/подавляется. Таким образом, последовательность-мишень антисмысловой РНК на являющейся мишенью мРНК (или на являющейся мишенью (геномной) ДНК) может быть локализована в транслируемой и/или нетранслируемой области мРНК (или на являющейся мишенью (геномной) ДНК), например, в области контролирующих элементов, в частности в 5'-некодирующей области мРНК (или на являющейся мишенью (геномной) ДНК), которая обладает регуляторной функцией. Последовательность-мишень антисмысловой РНК, направленную против мРНК (или против являющейся мишенью (геномной) ДНК), можно конструировать также таким образом, что антисмысловая РНК связывается с мРНК (или с являющейся мишенью (геномной) ДНК) путем перекрытия ее последовательности областью, которая частично комплементарна нетранслируемой и транслируемой (кодирующей) последовательности мРНК ((или являющейся мишенью (геномной) ДНК); в частности антисмысловая РНК может быть комплементарна последовательности-мишени мРНК (или являющейся мишенью (геномной) ДНК), по меньшей мере одному нуклеотиду, расположенному против хода транскрипции относительно стартового триплета кодирующей области. Предпочтительно антисмысловая РНК, применяемая согласно настоящему описанию, содержит от примерно 5 до примерно 5000, от примерно 500 до примерно 5000 и более предпочтительно от примерно 1000 до примерно 5000 нуклеотидов или в другом варианте от примерно 5 до примерно 1000, от примерно 5 до примерно 500, от примерно 5 до примерно 250, от примерно 5 до примерно 100, от примерно 5 до примерно 50 или от примерно 5 до примерно 30 нуклеотидов или в другом и еще более предпочтительном варианте от примерно 20 до примерно 100, от примерно 20 до примерно 80 или от примерно 20 до примерно 60 нуклеотидов.

В другом конкретном примере компонент (Б) может представлять собой также фармацевтическое лекарственное средство, например, выбранное из цитотоксических или противоопухолевых лекарственных средств, которые можно применять в качестве химиотерапевтических лекарственных средств. В целом, химиотерапевтические лекарственные средства, которые можно применять в качестве компонента (Б), можно разделять на три основные категории на основе их механизма действия. Они могут (а) прекращать синтез «элементов конструкции» молекулы преДНК: Эти агенты функционируют различным образом. «Элементами конструкции» ДНК являются фолиевая кислота, гетероциклические основания и нуклеотиды, которые в естественных условиях образуются в клетке. Все эти агенты блокируют определенную стадию образования нуклеотидов или дезоксирибонуклеотидов (необходимых для создания ДНК). Если эти стадии заблокированы, то нуклеотиды, представляющие собой «элементы конструкции» ДНК и РНК, не могут быть синтезированы. В результате клетки не могут реплицироваться, поскольку без нуклеотидов они не могут создавать ДНК. Примеры лекарственных средств из этого класса включают метотрексат (Abitrexate®), фторурацил (Adrucil®), гидроксимочевину (Hydrea®) и меркаптопурин (Purinethol®), тиогуанин, токоферол или, в более общем смысле, также любые нуклеотидные аналоги, например, аналоги 2'-дезоксицитидина. В другом варианте химиотерапевтические лекарственные средства могут (б) непосредственно повреждать ДНК в ядре клетки. Эти агенты повреждают ДНК и РНК химическим путем. Они нарушают репликацию ДНК и либо полностью останавливают репликацию, либо приводят к образованию нонсенс-ДНК или -РНК (т.е. новая ДНК или РНК не кодирует никакой нужный продукт). Примерами лекарственных средств из этого класса являются цисплатин (Platinol®) и антибиотики - даунорубицин (Cerubidine®), доксорубицин (Adriamycin®), относящиеся к классу антрациклиновых противоопухолевых средств (представителей которого можно применять в качестве компонента (Б), предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы), и этопосид (VePesid®) или любой интеркалятор. И, наконец, химиотерапевтические лекарственные средства могут (в) воздействовать на синтез митотических веретен или расщеплять их: Митотические веретена служат в качестве молекулярных рельсов, имеющих «северный и южный полюса», в клетке, когда клетка начинает делиться на две новые клетки. Эти веретена очень важны, поскольку они помогают расщеплять новые копии ДНК таким образом, чтобы копия попадала в каждую из двух новых клеток в процессе деления клетки. Указанные лекарственные средства нарушают образование этих веретен и тем самым прекращают деление клетки. Примерами лекарственных средств из этого класса соединений, нарушающих митоз, являются: винбластин (Velban®), винкристин (Oncovin®) и паклитаксел (Taxol®). Компонент (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может оказывать воздействие одним из указанных выше путей. Другими словами, в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, можно применять любой из классов противоопухолевых лекарственных средств, т.е. алкилирующие агенты, нитрозомочевины, антиметаболиты, растительные алкалоиды, противоопухолевые антибиотики и стероидные гормоны. Для того, чтобы более подробно описать эти классы лекарственных средств, следует особо подчеркнуть, что каждое противораковое лекарственное средство можно также классифицировать на основе его описанного выше воздействия на клеточный цикл и химию клетки. Алкилирующие агенты убивают клетки, непосредственно воздействуя на ДНК. Алкилирующие агенты можно применять для лечения хронических лейкозов, болезни (лимфомы) Ходжкина, лимфом и определенных типов карцином легкого, молочной железы, предстательной железы и яичника. Примером обычно применяемого алкилирующего агента является циклофосфамид. Действие нитрозомочевин аналогично действию алкилирующих агентов, и они ингибируют также изменения, необходимые для репарации ДНК. Эти агенты преодолевают гематоэнцефалический барьер и поэтому их применяют для лечения опухолей головного мозга, лимфом, множественной миеломы и злокачественной меланомы. Основными лекарственными средствами из этого класса являются кармустин и ломустин. Антиметаболиты представляют собой лекарственные средства, которые блокируют клеточный рост, воздействуя на определенные функции, как правило, на синтез ДНК. После включения в клетку они останавливают нормальное развитие и репродукцию. Все лекарственные средства из этого класса воздействуют на клетку в течение «S»-фазы клеточного цикла. Антиметаболиты можно применять для лечения острых и хронических лейкозов, хориокарциномы и некоторых типов опухолей желудочно-кишечного тракта, молочной железы и яичника. Примерами обычно применяемых антиметаболитов являются 6-меркаптопурин и 5-фторурацил (5FU). Противоопухолевые антибиотики представляют собой группу разнообразных соединений. В целом, их действие заключается в связывании с ДНК и предупреждении синтеза РНК. Эти агенты широко применяют при лечении разнообразных типов рака. Наиболее широко применяемыми лекарственными средствами из этой группы являются доксорубицин (адриамицин), митомицин-С и блеомицин. Растительные (винка) алкалоиды представляют собой противоопухолевые агенты, полученные из растений. Эти лекарственные средства действуют специфически, блокируя деление клеток в процессе митоза. Их обычно применяют при лечении острого лимфобластного лейкоза, лимфомы Ходжкина и не-ходжкинской лимфомы, нейробластом, опухоли Вильмса и рака легкого, молочной железы и яичек. Винкристин и винбластин представляют собой обычно применяемые агенты из этой группы. Стероидные гормоны применяют при лечении некоторых типов опухолей. Этот класс включает адренокортикостероиды, эстрогены, антиэстрогены, прогестероны и андрогены. Хотя конкретный механизм их действия не изучен, известно, что стероидные гормоны модифицируют рост некоторых гормонзависмых типов рака. Примером является тамоксифен, который применяют при лечении эстрогензависимого рака молочной железы. Все указанные выше типы рака можно лечить с помощью предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекулы, которые содержат в качестве компонента (Б) любое из перечисленных выше противоопухолевых средств.

Одну из групп цитотоксических или противоопухолевых лекарственных средств, которые можно применять в виде эффекторной молекулы, пригодной в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, предпочтительно выбирают из группы, включающей алкилирующие лекарственные средства, антиметаболики, цитостатики или лекарственные средства, применяемые при гормональном лечении. В этом контексте в качестве цитотоксических или противоопухолевых лекарственных средств предпочтительно выбирают соединения из классов металлсодержащих, прежде всего содержащих платину (производные) соединений, и таксола. В частности, фрагмент, представляющий собой лекарственное средство, выбирают из группы лекарственных средств, включающей, например, цисплатин, трансплатин, сатраплатин, оксалиплатин, карбоплатин, недаплатин, хлорамбуцил, циклофосфамид, мефалан, азатиоприн, фторурацил, (6)-меркаптопурин, меторексат, нандролон, аминоглутемид, медроксипрогестерон, мегестролацетат, прокарбазин, доцетаксел, паклитаксел, иринотекан, эпиподофиллотоксин, подофиллотоксин, винкристин, винбластин, доцетаксел, дауномицин, даунорубицин, доксорубицин, митоксантрон, топотекан, блеомицин, гемцитабин, флударабин, навелбин и 5-FUDR. Наиболее предпочтительным является класс металлсодержащих противоопухолевых лекарственных средств, например, класс содержащих платину соединений.

Другими цитотоксическими или противоопухолевыми лекарственными средствами, которые можно применять в качестве компонента (Б) в предлагаемых в изобретении, являются (обозначены их родовыми названиями) алитретиноин, алтретамин, азатиоприн, бикалутамид, бусулфан, капецитабин, циклофосфамид, экземестан, летрозол, финастерид, мегестрола ацетат, трипторелин, темозоломид, мифепристон, третиноин, орал, тамоксифен, тенипосид, иматиниб (Gleevec®), гефитиниб (IRESSA®), пептомицина сульфат или соединения из класса камптотецинов.

Другой группой цитотоксических или противоопухолевых лекарственных средств, которые можно применять в качестве компонента (Б), являются производные индокарбазола, например, стауроспорин (и его аналоги) и ребеккамицин. Следует отметить, что в качестве компонента (Б) особенно предпочтительными являются также соединения, относящиеся к классу анилинохиназолинов (например, гефитиниб).

Другую группу цитотоксических или противоопухолевых лекарственных средств, которые можно применять в виде эффекторной молекулы, пригодной в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать также из ингибиторов топоизомераз, таких как иринотекан, или митотических кинезинов или дигидрофолатредуктазы (DHFR).

Кроме того, цитотоксические или противоопухолевые лекарственные средств, которые можно применять в виде эффекторной молекулы, пригодной в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать из группы, включающей факторы, ингибирующие или стимулирующие клеточную пролиферацию, такие как тромбоцитарный фактор роста (PDGF), внутриклеточные пути, например, пути передачи сигнала RAS/RAF, такие, например, как представитель пути передачи сигнала RAF/MEK/ERK (например, RAF-1), или пути активируемой митогеном протеинкиназы, семейство CMGC-киназ (включая CDK (зависящие от циклина киназы), МАРК., GSK3, CLK), Ser/Thr-киназы, относящиеся к семейству AGC-киназ, включая семейства киназ РКА, PKG, РКС, тирозинкиназные рецепторы, участвующие в неоваскуляризации и развитии опухоли, включая рецептор сосудистого эндотелиального фактора роста (VEGFR)-2, VEGFR-3, рецептор тромбоцитарного фактора роста β, Flt-3, систему эндотелина (ЕТ), которая включает ЕТ-1, ЕТ-2, ЕТ-3, и рецептор ETA (ETAR) и ETBR, и с-KIT, в этом случае мишенью является, например, ингибирование их функции, и представителей IGF-семейства, например, IGF-1, IGF-2, IGF-1R, IGF2R и т.д.

Другую группу цитотоксических или противоопухолевых лекарственных средств, которые можно применять в виде эффекторной молекулы, пригодной в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортерам карго-молекулы, можно выбирать из ингибиторов, мишенью которых является пролиферация опухолевых клеток и ангиогенез опухоли. Наиболее предпочтительными являются низкомолекулярные противоопухолевые ингибиторы киназ, мишенью которых являются злокачественные клетки и/или сосудистые клетки, обладающие антиангиогенной активностью. Ингибиторы киназ, такие как ингибиторы, мишенью которых являются EGFR, Her2/neu, BCR-ABL, c-KIT, PKC, Rafn PI3, обладают антиангиогенными свойствами благодаря тому, что они блокируют секрецию ангиогенных факторов злокачественными клетками, на которые они воздействуют. Ингибиторы киназ, такие как VEGFR2, VEGFR1, PDGFR, PKC, Raf и PI3, обладают антиангиогенным действием в отношении сосудистых клеток. Примерами синтетических ингибиторов циклинзависимых киназ (CDKI) являются, например, оломоуцин, флавопиридол, бутиролактон и их производные, которые ограничивают клеточную пролиферацию. С другой стороны, противоопухолевые соединения, пригодные в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать из активаторов программ апоптоза в раковых клетках (таких, например, как стауроспорин) или соединений, осуществляющих понижающую регуляцию антиапоптозных белков, например, Bcl-2.

Общей особенностью всех указанных соединений является то, что они должны проникнуть через клеточную мембрану для того, чтобы оказывать свое действие в качестве противораковых лекарственных средств. В результате сочетания соединений, относящихся к любому из указанных классов (соединения, непосредственно повреждающие ДНК в ядре клетки, воздействующие на синтез или расщепление митотических веретен или прекращающие синтез «блоков конструкции» молекулы пре-ДНК), которые применяют в качестве компонента (Б), с компонентом (А) с образованием предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, повышается способность противораковых соединений проникать в клетку и/или повышается их растворимость, что приводит к увеличению эффективности этих терапевтических соединений. В свою очередь, усиление включения клеткой и предпочтительно более высокая растворимость этих соединений в водном окружении (например, в цитозоле) позволяют уменьшать дозу терапевтического противоракового соединения.

Кроме того, компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может содержать также низкомолекулярные органические соединения или молекулы лекарственного средства, такие как ингибиторы протеаз, которые ингибируют протеазы, прежде всего протеазы, участвующие в инфекционном цикле инфекционных агентов, например, вирусные, бактериальные или протозойные протеазы. В предпочтительном варианте осуществления изобретения эти ингибиторы протеаз (органические соединения или молекулы лекарственного средства), используемые в качестве компонента молекулы-конъюгата, предлагаемой в изобретении, можно применять для лечения вирусных, бактериальных или протозойных инфекций, например, малярии. В частности, с помощью ингибиторов протеаз можно лечить вирусные инфекции, например, заболевания, вызываемые ретровирусами. Очень предпочтительным является применение молекул-конъюгатов, содержащих ингибиторы протеаз, для лечения вызываемых ВИЧ инфекций. Ингибиторы протеаз, которые следует применять для сочетания с указанной в настоящем описании последовательностью-носителем, можно выбирать из группы, включающей 640385, абакавира сульфат, AG1776, ампренавир (141W94 или VX-478), атазанавир (BMS-232632), ингибитор катепсин S-протеазы, D1927, D9120, эфавиренц, эмтрицитабин, энфувиртид (Т-20), фосампренавир (GW-433908 или VX-175), GS 9005, GW640385 (VX-385), ингибитор протеазы HCV, индинавир (МК-639), L-756, 423, левоприн-ZG, лопинавир (АВТ-378), лопинавир/ритонавир (LPV АВТ-378/r), MK-944A, мозенавир (DMP450). нелфинавир (AG-1343), невирапин, Р-1946, PL-100, приномастат, ритонавир (АВТ-538), RO033-4649, ТМС114, саквинавир (Ro-31-8959), тенофовир дисопроксила фумарат, типранавир (PNU-140690), TLK 19781, ТМС-114, Vertex 385, VX-950.

И, наконец, эффекторные молекулы, пригодные в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать в качестве отдельного компонента из указанных выше меток для предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Указанная предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, является наиболее предпочтительной для применения в анализах in vitro или in vivo. В этом контексте метки могут представлять собой радиоактивные метки, т.е. радиоактивное фосфорилирование, или радиоактивную метку, включающую серу, водород, углерод, азот и т.д.; окрашивающие агенты (например, дигоксигенин и т.д.); флуоресцентные группы (например, флуоресцеин, родамин, указанные ниже флуорохромные белки и т.д.); хемолюминесцентные группы; или комбинацию указанных меток. Предпочтительно флуорохромные белки представляют собой любой флуорохромный белок, которые можно активировать таким образом, что он испускает флуоресцентный сигнал. Более предпочтительно флуорохромный белок выбирают из числа любых флуоресцентных белков, например, из группы, включающей зеленый флуоресцентный белок (GFP), производные зеленого флуоресцентного белка (GFP), такие как EGFP, AcGFP, TurboGFP, Эмеральд (Emerald), зеленый Азами (Azami Green), фотоактивируемый-GFP (РА-GFP), или синий флуоресцентный белок (BFP), включая EBFP, Сапфир (Sapphire), Т-Сапфир (T-Sapphire), или циановые флуоресцентные белки (CFP), включая усиленный циановый флуоресцентный белок (ECFP), mCFP, церулан, CyPet, или желтые флуоресцентные белки (YFP), включая Топаз (Topaz), Венус (Venus), мЦитрин (mCitrine), Ypet, PhiYFP, mBanana, желтый флуоресцентный белок, спектр флуоресценции которого сдвинут в сторону зеленого флуоресцентного белка (Yellow GFP), усиленный желтый флуоресцентный белок (EYFP) или оранжевый и красный флуоресцентный белок (RFP), включая Kusibara Orange, mOrange, dTomato-Tandem, DsRed-Monomer, mTangerine, mStrawberry, мономерный красный флуоресцентный белок (mRFPl) (который обозначают также как mRFP), mCherry, mRaspberry, HcRed-Tandem, mPlum, а также оптические хайлайтеры (маркеры), выбранные из PA-GFP, CoralHue Dronpa (G), PS-CFP (С), PS-CFP (G), mEosFP (G), mEosFP (G), или другие мономерные флуоресцентные белки, такие как «зажигающий» флуоресцентный белок, (KFP1), экворин, автофлуоресцентные белки (AFP) или флуоресцентные белки JRed, TurboGFP, PhiYFP и PhiYFP-m, tHc-Red (HcRed-Tandem), PS-CFP2 и KFP-Red (доступны от фирмы EVRΩGEN, см. также www.evrogen.com), или другие пригодные флуоресцентные белки.

Предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, содержащая компоненты (А) и (Б), может включать также по меньшей мере один необязательный дополнительный компонент и т.д., предпочтительно отличный от компонента (Б). Этот по меньшей мере один необязательный дополнительный фрагмент может придавать дополнительные функции предлагаемому в изобретении слитому белку. По меньшей мере один необязательный дополнительный компонент может представлять собой фрагмент (например, НА, HSV-Tag, His6-Tag, FLAG-Tag), который делает предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, более пригодной для очистки и/или выделения. При необходимости необходимый для очистки компонент можно затем отделять от других компонентов предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы (например, протеолитическим расщеплением или другими методами, известными в данной области) в конце процесса получения.

Кроме того, необязательный по меньшей мере один дополнительный компонент предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может представлять собой, например, сигнальную последовательность или локализующую последовательность, которая обеспечивает эффективную направленность предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, в конкретную внутриклеточную целевую область локализации или в конкретный тип клеток, предпочтительно без снижения повышенной способности поникать в клетку предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Как правило, сигнальная последовательность или локализующая последовательность обеспечивают направленный перенос предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, в определенные клеточные компартменты, например, эндоплазматический ретикулум, митохондрии, аппарат с неясной функцией (gloom), лизосомальные пузырьки и т.д. Примерами сигнальных последовательностей или локализующих последовательностей являются (но, не ограничиваясь только ими) локализующие последовательности для эндоплазматического ретикулума, такие как KDEL (SEQ ID NO:218), DDEL (SEQ ID NO:219), DEEL (SEQ ID NO:220), QEDL (SEQ ID NO:221), RDEL (SEQ ID NO:222), последовательности, предназначенные для ядерной локализации, такие как PKKKRKV (SEQ ID NO:223), PQKKIKS (SEQ ID NO:224), QPKKP (SEQ ID NO:225), RKKR (SEQ ID NO:226), последовательности, предназначенные для локализации в ядерной области, такие как RKKRRQRRRAHQ (SEQ ID NO:227), RQARRNRRRRWRERQR (SEQ ID NO:228), MPLTRRRPAASQALAPPTP (SEQ ID NO:229), последовательности, предназначенные для локализации в эндосомальном компартменте MDDQRDLISNNEQLP (SEQ ID NO:230), и т.д.

Предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, может содержать также по меньшей мере одну модификацию, предпочтительно на ее концах, либо на С-, либо на N-конце, либо на обоих концах. С-конец предпочтительно можно модифицировать с помощью амидной модификации, а N-конец можно модифицировать с помощью любой приемлемой NH2-защитной группы, например, путем ацилирования, или любой другой модификации, уже описанной выше для L-аминокислот.

Компоненты (А), (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, и, если они присутствуют, то и другие дополнительные компоненты (В), (Г) и/или (Д) и т.д., как правило, связывают друг с другом ковалентными связями или электростатической связью (например, полилизин), предпочтительно ковалентными связями. В этом контексте понятие «ковалентная связь» относится к стабильной химической связи между двумя атомами, образующейся в результате объединения одной или большего количества пар электронов. Предпочтительно все компоненты (А) и (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, и, если они присутствуют, то и другие дополнительные компоненты (В), (Г) и/или (Д) и т.д., можно сшивать с получением линейной молекулы или нелинейной (разветвленной) молекулы, предпочтительно линейной молекулы. В линейной молекуле все вышеуказанные компоненты (А) и (Б) и, если они присутствуют, то и другие дополнительные компоненты (В), (Г) и/или (Д) и т.д., связывают друг с другом через их концы в линейной форме, что не приводит к разветвлению молекулы-конъюгата, которая является транспортером карго-молекулы. В нелинейной молекуле все вышеуказанные компоненты (А) и (Б) и, если они присутствуют, то и другие дополнительные компоненты (В), (Г) и/или (Д) и т.д., связывают друг с другом через их концы в форме, которая приводит к получению разветвленной молекулы-конъюгата, которая является транспортером карго-молекулы, например, к получению Y-образной формы и т.д.

Поскольку компонент (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, по определению представляет собой полипептидную последовательность, то (ковалентное) присоединение других компонентов (Б), и, если они присутствуют, необязательных компонентов (В), (Г) и/или (Д), может, естественно зависеть от типа и природы подлежащих присоединению компонентов, т.е. от того, представляют ли собой индивидуальные компоненты белки или полипептиды, нуклеиновые кислоты, (небольшие) органические соединения и т.д.

Порядок, в котором компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, и, если они присутствуют, то и другие необязательные компоненты (В), (Г) и/или (Д), связывают с компонентом (А) и друг с другом с получением предпочтительно линейной молекулы, как правило, может быть любым. Таким образом, любой из компонентов (А), (Б), и, если они присутствуют, то (В), (Г), (Д) и т.д., можно связывать друг с другом. Однако предпочтительно компонент (А) присоединяют к концам предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Если компоненты (Б), и, если они присутствуют, то и компоненты (В), (Г), (Д) и т.д., представляют собой белковую или полипептидную последовательность, то компонент (А), если он присутствует в виде полипептида или белка, предпочтительно находится на С-конце предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, например, на С-конце компонента (Б), как указано выше, или, если они присутствуют, то компонентов (В), (Г), (Д) и т.д.. Указанное положение компонента (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предупреждает расщепление полипептидной или белковой последовательности компонентов (Б), (В), (Г), (Д) и т.д. до его/их транспортировки к требуемому сайту-мишени, например, к клетке, ядру и т.д., пептидазой, прежде всего карбоксипептидазой, такой карбоксиконцевая пептидаза N. В альтернативном варианте, если в применяемых клеточных системах присутствуют аминоконцевые пептидазы, то компонент (А) может быть локализован на аминоконце предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

Если компонент (Б) и/или, если он присутствует, то и любой другой необязательный компонент, представляет собой полипептидную или белковую последовательность, то связь между белковыми или полипептидными компонентами (А) и (Б) и/или любым другим полипептидным компонентом предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предпочтительно представляет собой полипептидную связь. Указанную полипептидную связь можно формировать с помощью химического синтеза с участием обоих компонентов (N-конец одного компонента и С-конец другого компонента), которые требуется связывать, или ее можно непосредственно получать путем белкового синтеза полной полипептидной последовательности обоих компонентов, где оба (белковых или полипептидных) компонента предпочтительно синтезируют на одной стадии. Указанные методы синтеза белков включают, например (но, не ограничиваясь только ими), методы жидкофазного синтеза полипептидов или методы твердофазного синтеза полипептидов, например, методы твердофазного синтеза полипептидов согласно подходу Меррифельда, твердофазный синтез полипептидов с использованием трет-Boc, твердофазный синтез полипептидов с использованием Fmoc, твердофазный синтез полипептидов с использованием ВОР (гексафторфосфат бензотриазол-1-илокси-трис(диметиламино)фосфония) и т.д.

Кроме того, компоненты (А) и компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, можно сшивать через линкер или непосредственно (без линкера) с помощью, например, амидного мостика, если подлежащие связыванию компоненты имеют реакционно-способные аминогруппы или карбоксигруппы. В другом варианте предпочтительными являются связи с помощью сложного или простого эфира.

Указанные выше дополнительные компоненты (В), (Г) и/или (Д) и т.д., если они присутствуют, можно сшивать путем, аналогичным для компонента (А) и/или компонента (Б), или необязательно сшивать друг с другом, причем они могут быть связаны в виде одного отдельного фрагмента либо с компонентом (А), либо с компонентом (Б). Можно использовать также линкерные последовательности для слияния компонентов предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, по меньшей мере с одним другим компонентом (см. ниже). Форма сочетания другого(их) компонента(ов) либо с компонентом (А), либо с компонентом (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, должна зависеть от их химической природы. Если дополнительные компоненты (В), (Г), (Д) и т.д. относятся к классу пептидных последовательностей, их предпочтительно связывают с предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, либо на конце компонента (А), либо в альтернативном варианте через боковые цепи D-аминокислот компонента (А), например, с помощью дисульфидного мостика. Аналогичным образом можно присоединять дополнительные компоненты другой химической природы к компоненту (А) (концевые группы или химически активные группы боковых цепей) или компоненту (Б). Связь через боковые цепи предпочтительно осуществляют с помощью аминогрупп, тиольных или гидроксильных групп боковых цепей, например, посредством амидной связи или связи с помощью сложного или простого эфира. Следует отметить, что согласно изобретению, все аминокислоты (любого из компонентов (А), и компонентов (В), (Г), (Д) и т.д., если они состоят из аминокислот) предпочтительно представляют собой D-энантиомерные аминокислоты, которые соответствуют своим встречающимся в естественных условиях аналогам, связанным в ретро-инвертированном порядке. Тем не менее, компоненты (В), (Г), (Д) и т.д., если они состоят из аминокислот, могут содержать также L-аминокислоты (в их встречающемся в естественных условиях порядке расположения последовательностей) или содержать комбинацию D- и L-аминокислот.

Если используют линкерные последовательности, то линкерные последовательности предпочтительно представляют собой гибкую последовательность, состоящую из 2-10 остатков, более предпочтительно из 1-5 остатков. В предпочтительном варианте осуществления изобретения линкерная последовательность содержит по меньшей мере 20%, более предпочтительно по меньшей мере 40% и еще более предпочтительно по меньшей мере 50% остатков Gly или β-аланина, например, представляет собой GlyGlyGlyGlyGly, GlyGlyGlyGly, GlyGlyGly, CysGlyGly или GlyGlyCys и т.д. Специалист в данной области легко может отбирать и получать соответствующие линкерные последовательности. Они могут состоять из D- и/или L-аминокислот.

Пептидные линкерные последовательности можно интродуцировать также между компонентом (А) и компонентом (Б) и/или дополнительным(и) необязательным(и) компонентом(ами), т.е. (В), (Г), (Д) и т.д., предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, при этом аминоконцевой метионин добавляют к компоненту (А) и/или перед белковой или полипептидной последовательностью компонента (Б), (В), (Г), (Д) и т.д.

Предпочтительно, компонент (А) и компонент (Б) связывают путем химического сочетания любым пригодным методом, известным в данной области, таким как методы перекрестного сшивания. Однако следует обращать внимание на то, что многие известные методы химического перекрестного сшивания являются неспецифическими, т.е. они не направляют точку сшивания в конкретный сайт фрагмента-носителя или карго-фрагмента. Так, неспецифические перекрестносшивающие агенты в случае их использования могут «атаковать» функциональные сайты или стерически блокировать активные сайты, приводя к тому, что слитые компоненты предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, становятся биологически неактивными. Компетенция специалиста в данной области позволяет блокировать потенциальные реакционно-способные группы с помощью соответствующих защитных групп. В альтернативном варианте можно применять эффективные и разнообразные методы лигирования с использованием оксима и гидразона, представляющих собой обладающие химической избирательностью элементы, которые можно применять для перекрестного сшивания компонента (А) с компонентом (Б). Этот метод связывания описан, например, у Rose и др., JACS 116, 1994, с.30. Указанные выше дополнительные компоненты (В), (Г), (Д) и т.д., если они присутствуют, можно подвергать аналогичным методом химическому сочетанию друг с другом или с компонентом (А) и/или (Б).

Специфичность сочетания можно повышать путем непосредственного химического сочетания с функциональной группой, встречающейся только один раз или лишь небольшое количество раз в компоненте (А), функциональная группа которого должна быть перекрестно сшита с органической молекулой компонента (Б). Например, можно использовать тиольную группу цистеина, если только один остаток цистеина присутствует в компоненте (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Также, например, если компонент (А) молекулы-конъюгата не содержит остатков лизина, то перекрестносшивающий реагент, обладающий специфичностью в отношении первичных аминов, будет обладать избирательным действием в отношении аминоконца компонента (А). В альтернативном варианте перекрестное сшивание можно осуществлять также через боковую цепь остатка глутаминовой кислоты, находящегося на N-конце полипептида, в результате чего амидная связь может быть образована через его боковую цепь. Поэтому может оказаться целесообразным связывать остаток глутаминовой кислоты с N-концом компонента (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Однако, если в компонент (А) необходимо встраивать остаток цистеина, то предпочтительно встраивание осуществляют на его N- или С-конце или вблизи него. Можно применять методы, общепринятые для таких изменений аминокислотных последовательностей, основанные на модификациях компонента (А), которые осуществляют либо путем добавления одной или большего количества дополнительных аминокислот, например, среди прочего, остатка цистеина, к обеспечивающей транслокацию (транслоцирующей) последовательности, либо путем замены по меньшей мере одного остатка транслоцирующей(их) последовательности(ей), присутствующего(их) в компоненте (А). В том случае, когда для целей сочетания используют боковую цепь цистеина, компонент (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предпочтительно содержит один остаток цистеина. Предпочтительно следует избегать присутствия какого-либо второго остатка цистеина и, в конце концов, их можно заменять, если они присутствуют в компоненте (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Если остаток цистеина заменяют в исходной транслоцирующей последовательности, предназначенной для использования в качестве компонента (А) или его части, то, как правило, желательно минимизировать образующиеся изменения складчатости полипептида компонента (А). Изменения складчатости компонента (А) являются минимальными, когда замена является химически и стерически близкой цистеину. Таким образом, в качестве замены цистеина предпочтительно использовать серии.

Сочетание двух составных частей предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, можно осуществлять посредством связующего или конъюгирующего агента с использованием стандартных для синтеза полипептидов связующих реагентов, таких как ГОВ1, ГБТУ, ДИКДИ, ТБТУ. Существует несколько агентов для межмолекулярного перекрестного сшивания, которые можно использовать, см., например, Means и Feeney, Chemical Modification of Proteins, изд-во Holden-Day, 1974, сс.39-43. К этим реагентам относятся, например, N-сукцинимидил-3-(2-пиридилдитио)пропионат (СПДП) или N,N'-(1,3-фенилен)бисмалеимид; N,N'-этиленбис(йодацетамид) или другой аналогичный реагент, имеющий 6-11 углеродных метиленовых мостиков; и 1,5-дифтор-2,4-динитробензол. К другим перекрестно сшивающим реагентам, пригодным для этой цели, относятся: n,n'-дифтор-м,м'-динитрофенилсульфон; диметиладипимидат; фенол-1,4-дисульфонилхлорид; гексаметилендиизоцианат или диизотиоцианат, или азофенил-пара-диизоцианат; глутаровый альдегид или дисдиазобензидин. Перекрестносшивающие реагенты могут быть гомобифункциональными, т.е., могут иметь две функциональные группы, участвующие в одной и той же реакции. Предпочтительным гомобифункциональным перекрестносшивающим реагентом является бисмалеимидогексан (БМГ). БМГ содержит две малеимидные функциональные группы, которые специфически взаимодействуют с содержащими сульфгидрил соединениями в мягких условиях (рН 6,5-7,7). Две малеимидные группы соединены углеводородной цепью. Таким образом, БМГ можно применять для необратимого перекрестного сшивания белков (или полипептидов), которые содержат остатки цистеина. Перекрестносшивающие реагенты могут быть также гетеробифункциональными. Гетробифункциональные Перекрестносшивающие реагенты имеют две различные функциональные группы, например, реактивную аминогруппу и реактивную тиольную группу, которые перекрестно сшивают два белка, имеющие свободные амины и тиолы соответственно. Примерами гетеробифункциональных перекрестносшивающих агентов являются сукцинимидил-4-(Т-малеимидометил)циклогексан-1 -карбоксилат (СМЦК), сложный мета-малеимидобензоил-N-гидроксисукцинимидиловый эфир (МБС) и сукцинимид-4-(пара-малеимидофенил)бутират (СМФБ), представляющий собой аналог МБС с удлиненной цепью. Сукцинимидильная группа этих перекрестносшивающих линкеров взаимодействует с первичным амином, и реактивная тиольная группа малеимида образует ковалентную связь с тиольной группой остатка цистеина. Поскольку Перекрестносшивающие реагенты часто обладают слабой растворимостью в воде, к перекрестносшивающему реагенту можно добавлять гидрофильный фрагмент, такой как сульфонатная группа, для повышения растворимости в воде. Сульфо-МБС и сульфо-СМЦК являются примерами перекрестносшивающих реагентов, модифицированных с целью повышения растворимости в воде. Многие Перекрестносшивающие реагенты приводят к образованию конъюгата, который практически не расщепляется в условиях клеточного окружения. Поэтому некоторые Перекрестносшивающие реагенты содержат ковалентную связь, такую как дисульфид, которая расщепляется в условиях клеточного окружения. Например, реагент Траута, дитиобис(сукцинимидилпропионат) (ДСП) и N'-сукцинимидил-3-(2-пиридилдитио)пропионат (СПДП) представляют собой широко известные расщепляемые Перекрестносшивающие линкеры. Использование расщепляемого перекрестносшивающего реагента позволяет транспортируемому карго-фрагменту компонента (Б), (В), (Г), (Д) и т.д. отделяться от компонента А новой транспортирующей конструкции после введения в клетку-мишень. Для этой цели можно применять также прямую дисульфидную связь. Химическое перекрестное сшивание можно осуществлять также с использованием спейсерных плечей. Спейсерные плечи обеспечивают внутримолекулярную гибкость или регулируют внутримолекулярные расстояния между конъюгированными молекулами и тем самым могут помогать сохранять биологическую активность. Спейсерное плечо может представлять собой фрагмент белка (или полипептида), который содержит спейсерные аминокислоты, например, пролин. В альтернативном варианте спейсерное плечо может представлять собой часть перекрестносшивающего реагента, такого как «СПДП с длинной цепью» (фирма Pierce Chem. Co., Рокфорд, шт.Иллинойс, каталожный номер 21651 Н). В продаже имеются многочисленные перекрестносшивающие реагенты, включая перечисленные выше. Подробные инструкции по их применению легко можно получить от коммерческих поставщиков. Общие сведения о перекрестном сшивании белков и получении конъюгатов приведены у Wong, Chemistry of Protein Conjugation and Cross-Linking, изд-во CRC Press (1991).

Специалисту в данной области должно быть очевидно, что различные компоненты молекулы-конъюгата, которая является транспортером карго-молекулы, можно сшивать таким образом, чтобы различные компоненты могли еще придавать по меньшей мере часть из их индивидуальной специфической активности и/или свойств полной молекуле-конъюгату, которая является транспортером карго-молекулы. Например, сшивание компонентов предпочтительно не должно приводить к полной утрате способности обеспечивать направленный перенос в лейкоцит.

Следующим объектом настоящего изобретения является также фармацевтическая композиция, где фармацевтическая композиция предпочтительно содержит описанную выше предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, и необязательно фармацевтически приемлемый носитель и/или наполнитель или любой эксципиент, буфер, стабилизатор или другие материалы, хорошо известные специалистам в данной области.

Предлагаемая в изобретении фармацевтическая композиция содержит предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, описанную выше. Предпочтительно указанная фармацевтическая композиция содержит в качестве компонента (А) по меньшей мере один обеспечивающий направленный перенос в WBC полипептид, предлагаемый в настоящем изобретении, и в качестве компонента (Б) дополнительную субстанцию (карго-молекулу). Компонент (Б) может представлять собой любую фармацевтически активную субстанцию. Конкретными примерами таких фармацевтически активных субстанций являются описанные выше соединения. В частности, компонент (Б) может представлять собой терапевтически активную эффекторную молекулу, выбранную из белков или полипептидов, ингибиторов протеинкиназ, прежде всего ингибиторов протеинкиназ, таких как аминоконцевая киназа c-Jun, антигенов, антител, проапоптозных факторов, протеинов, участвующих в патологических состояниях, предпочтительно ингибиторов пептидных протеаз, ВН3-доменов белков «ВН3-только», или молекулу, выбранную их нуклеиновых кислот, siPHK, или из цитотоксических агентов, небольших органических соединений и т.д. Как отмечалось выше, предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, может содержать необязательные дополнительные компоненты (В), (Г) и/или (Д) и т.д.

В качестве дополнительного ингредиента предлагаемая в изобретении фармацевтическая композиция может содержать фармацевтически приемлемый носитель и/или наполнитель или может не содержать их. В контексте настоящего изобретения фармацевтически приемлемый носитель, как правило, представляет собой жидкую или нежидкую основу предлагаемой в изобретении фармацевтической композиции. Если предлагаемая в изобретении фармацевтическая композиция находится в жидкой форме, то носитель, как правило, представляет собой свободную от пирогенов воду; изотонический соляной раствор или забуференные (водные) растворы, например, растворы, забуференные фосфатом, цитратом и т.д. Предпочтительно для инъекции предлагаемой в изобретении фармацевтической композиции можно использовать воду или предпочтительно буфер, более предпочтительно водный буфер, содержащий натриевую соль, предпочтительно по меньшей мере 50 мМ натриевую соль, кальциевую соль, предпочтительно по меньшей мере 0,01 мМ кальциевую соль, и необязательно калиевую соль, предпочтительно по меньшей мере 3 мМ калиевую соль. Согласно предпочтительному варианту осуществления изобретения натриевая, кальциевая и необязательно калиевая соль могут применяться в форме галогенидов, например, хлоридов, йодидов или бромидов, или в форме их гидроксидов, карбонатов, гидрокарбонатов или сульфатов и т.д. Примерами натриевых солей являются (но, не ограничиваясь только ими), например, NaCl, NaI, NaBr, Na2CO3, NaHCO3, Na2SO4, примерами необязательных калиевых солей являются, например, KCl, KI, KBr, К2СО3, КНСО3, K2SO4, и примерами кальциевых солей являются, например, CaCl2, CaI2, CaBr2, СаСО3, CaSO4, Ca(OH)2. Кроме того, в буфер могут входить органические анионы вышеуказанных катионов. Согласно более предпочтительному варианту осуществления изобретения, буфер, пригодный для инъекций, как указано выше, может содержать соли, выбранные из хлорида натрия (NaCl), хлорида кальция (CaCl2) и необязательно хлорида калия (KCl), где помимо хлоридов могут присутствовать дополнительные анионы. CaCl2 можно заменять также на другую соль, например, на KCl. Как правило, соли в предназначенном для инъекции буфере присутствуют в следующей концентрации: по меньшей мере 50 мМ хлорид натрия (NaCl), по меньшей мере 3 мМ хлорид калия (KCl) и по меньшей мере 0,01 мМ хлорид кальция (CaCl2). Предназначенный для инъекции буфер может быть гипертоническим, изотоническим или гипотоническим относительно конкретной референс-среды, т.е. содержание в буфере солей может быть выше, идентичным или ниже их содержания в конкретной референс-среде, при этом предпочтительно можно применять такие концентрации вышеуказанных солей, которые не приводят к повреждению клеток в результате осмоса или других связанных с концентрацией воздействий. Референс-среды могут представлять собой, например, жидкости, применяемые в методах «in vivo», такие как кровь, лимфа, цитозольные жидкости или другие жидкости организма, или, например, жидкости, которые можно использовать в качестве референс-сред в методах «in vitro», такие как обычные буферы или жидкости. Указанные обычные буферы или жидкости известны специалисту в данной области. Наиболее предпочтительной жидкой основой является актированный раствор Рингера.

Однако в предлагаемой в изобретении фармацевтической композиции можно использовать также один или несколько совместимых твердых или жидких наполнителей или разбавителей или капсулирующих соединений, которые можно применять для введения пациенту, подлежащему лечению. Понятие «совместимые» в контексте настоящего описания означает, что составляющие предлагаемой в изобретении фармацевтической композиции можно смешивать с предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, как определено выше, таким образом, чтобы не происходило взаимодействия, которое могло бы существенно снижать фармацевтическую эффективность предлагаемой в изобретении фармацевтической композиции в обычных условиях применения. Фармацевтически приемлемые носители, наполнители и разбавители, естественно, должны иметь достаточно высокую чистоту и достаточно низкую токсичность, чтобы их можно было применять для введения индивидууму, подлежащему лечению. Некоторыми примерами соединений, которые можно применять в качестве фармацевтически приемлемых носителей, наполнителей или составляющих, являются сахара, такие, например, как лактоза, глюкоза и сахароза; крахмалы, такие, например, как кукурузный крахмал или картофельный крахмал; целлюлоза и ее производные, такие, например, как натриевая соль карбоксиметилцеллюлозы, этилцеллюлоза, ацетат целлюлозы; порошкообразный трагакант; солод; желатин; твердый жир; твердые вещества, усиливающие скольжение, такие, например, как стеариновая кислота, стеарат магния; сульфат кальция; растительные масла, такие, например, как арахисовое масло, хлопковое масло, кунжутное масло, оливковое масло, кукурузное масло и какао-масло; полиолы, такие, например, как полипропиленгликоль, глицерин, сорбит, маннит и полиэтиленгликоль; альгиновая кислота

Предлагаемую в изобретении фармацевтическую композицию можно вводить орально, парентерально, с помощью спрея для ингаляции, местно, ректально, назально, трансбуккально, вагинально или с помощью имплантируемого резервуара или с помощью любого другого приемлемого пути введения, известного специалисту в данной области. Понятие «парентеральный» в контексте настоящего описания включает подкожную, внутривенную, внутримышечную, внутрисуставную, интрасиновиальную, надчревную, внутриоболочечную, внутрипеченочную, в пораженный участок, внутричерепную, трансдермальную, внутрикожную, внутрилегочную, внутрибрюшинную, внутрисердечную, внутриартериальную и подъязычную инъекцию или инфузию.

Предпочтительно предлагаемую в изобретении фармацевтическую композицию можно вводить путем парентеральной инъекции, более предпочтительно с помощью подкожной, внутривенной, внутримышечной, внутрисуставной, интрасиновиальной, надчревной, внутриоболочечной, внутрипеченочной, в пораженный участок, внутричерепной, трансдермальной, внутрикожной, внутрилегочной, внутрибрюшинной, внутрисердечной, внутриартериальной и подъязычной инъекции или инфузии. Стерильные инъецируемые формы предлагаемых в изобретении фармацевтических композиций могут представлять собой водные или маслянистые суспензии. Эти суспензии можно приготавливать согласно методам, известным в данной области, с использованием пригодных диспергирующих или смачивающих агентов и суспендирующих агентов. Стерильный инъецируемый препарат может представлять собой также стерильный инъецируемый раствор или суспензию в нетоксичном пригодном для парентерального введения разбавителе или растворителе, например, раствор в 1,3-бутандиоле. В число приемлемых наполнителей и растворителей, которые можно применять, входят вода, раствор Рингера и изотонический раствор хлорида натрия. Кроме того, в качестве растворителя или суспендирующей среды обычно применяют стерильные нелетучие масла. Для этой цели можно применять любое успокаивающее нелетучее масло, включая синтетические моно- или диглицериды. Для приготовления инъецируемых лекарственных средств можно применять жирные кислоты, такие как олеиновая кислота и ее глицериды, а также природные фармацевтически приемлемые масла, такие как оливковое масло или касторовое масло, прежде всего в виде их полиоксиэтилированных производных. Эти масляные растворы или суспензии могут содержать также разбавитель, представляющий собой спирт с длинной цепью, или диспергирующий агент, такой как карбоксиметилцеллюлоза, или аналогичные диспергирующие агенты, обычно применяемые при приготовлении фармацевтически приемлемых форм лекарственного средства, включая эмульсии и суспензии. Для целей приготовления предлагаемой в изобретении фармацевтической композиции можно использовать также другие обычно применяемые поверхностно-активные вещества, такие как агенты типа Твин, Спан, или другие эмульгаторы или вещества, повышающие биологическую доступность, которые обычно применяют при приготовлении фармацевтически приемлемых твердых, жидких или иных форм лекарственного средства.

Для внутривенной, кожной или подкожной инъекции или инъекции в область поражения действующее вещество предпочтительно должно находиться в форме приемлемого для парентерального введения водного раствора, который не содержит пирогены и имеет приемлемые значение рН, изотоничность и стабильность. Специалисты в данной области легко могут приготавливать приемлемые растворы с использованием, например, изотонических наполнителей, таких как хлорид натрия для инъекций, раствор Рингера для инъекций, актированный раствор Рингера для инъекций. При необходимости можно включать консерванты, стабилизаторы, буферы, антиоксиданты и/или другие добавки.

Предлагаемую в изобретении фармацевтическую композицию, как она определена выше, можно вводить также орально в любой приемлемой для орального введения форме лекарственного средства, включая (но, не ограничиваясь ими) капсулы, таблетки, водные суспензии или растворы. В случае таблеток, предназначенных для орального применения, обычно используемые носители представляют собой лактозу и кукурузный крахмал. Как правило, добавляют также замасливатели, такие как стеарат магния. Для орального введения в форме капсул пригодными разбавителями являются лактоза и сухой кукурузный крахмал. Если для орального применения требуются водные суспензии, то действующее вещество, т.е. указанную выше предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, объединяют с эмульгаторами и суспендирующими агентами. При необходимости можно добавлять также определенные подслащивающие вещества, корригенты или красители.

Предлагаемую в изобретении фармацевтическую композицию можно применять также местно, особенно в том случае, когда мишень для лечения включает области или органы, легко доступные для местной обработки, включая лечение заболеваний кожи или любых других доступных эпителиальных тканей. Для каждой из этих областей или органов можно легко приготавливать пригодные препаративные формы для местного применения. Для местных применений можно приготавливать предлагаемую в изобретении фармацевтическую композицию в виде пригодных мазей, содержащих предлагаемую в изобретении иммуностимулирующую композицию, прежде всего ее описанные выше компоненты, суспендированные или растворенные в одном или нескольких носителях. Носители для местного применения включают (но, не ограничиваясь только ими) минеральное масло, вазелиновое масло, белый вазелин, пропиленгликоль, полиоксиэтилен, производное полиоксипропилена, эмульгирующий воск и воду. В альтернативном варианте предлагаемую в изобретении фармацевтическую композицию можно приготавливать в виде пригодного лосьона или крема. В контексте настоящего изобретения пригодные носители включают (но, не ограничиваясь ими) минеральное масло, сорбитанмоностеарат, полисорбат 60, воск на основе сложных цетиловых эфиров, цетеариловый спирт, 2-октилдодеканол, бензиловый спирт и воду.

Вне зависимости от того, применяют ли полипептид, молекулу нуклеиновой кислоты или любое другое фармацевтически приемлемое соединение, предлагаемое в настоящем изобретении, которое вводят индивидууму в качестве компонента (Б), введение предпочтительно осуществляют в «профилактически эффективном количестве» или в «терапевтически эффективном количестве» (в качестве одного из возможных вариантов), которое является достаточным для оказания благоприятного действия на индивидуума. Фактическое вводимое количество, скорость и временные особенности введения должны зависеть от природы и серьезности состояния, подлежащего лечению.

Из-за значительного поглощения WBC обеспечивающих направленный перенос в клетки, прежде всего в WBC, полипептидов, применяемых согласно настоящему изобретению, количество молекулы-конъюгата, которая является транспортером карго-молекулы (действующее вещество) в фармацевтической композиции, подлежащей введению индивидууму, может представлять собой (но, не ограничиваясь только ей) очень низкую дозу. Так, доза может быть значительно более низкой, чем доза пептидных лекарственных средств, известных в данной области, таких как DTS-108 (Florence Meyer-Losic и др., Clin Cancer Res., 2008, сс.2145-2153). Это является одним из нескольких важных аспектов изобретения, например, позволяет снижать потенциальные побочные действия и уменьшать стоимость.

Предпочтительно доза (на кг веса тела) составляет вплоть до 10 ммолей/кг, предпочтительно вплоть до 1 ммоля/кг, более предпочтительно вплоть до 100 мкмолей/кг, еще более предпочтительно вплоть до 10 мкмолей /кг, еще более предпочтительно вплоть до 1 мкмоля/кг, еще более предпочтительно вплоть до 100 нмолей/кг, наиболее предпочтительно вплоть до 50 нмолей/кг.

Таким образом, дозы могут предпочтительно составлять от примерно 1 пмоля/кг до примерно 1 ммоля/кг, от примерно 10 пмолей/кг до примерно 0,1 ммоля/кг, от примерно 10 пмолей/кг до примерно 0,01 ммоля/кг, от примерно 50 пмолей/кг до примерно 1 мкмоля/кг, от примерно 100 пмолей/кг до примерно 500 нмолей/кг, от примерно 200 пмолей/кг до примерно 300 нмолей/кг, от примерно 300 пмолей/кг до примерно 100 нмолей/кг, от примерно 500 пмолей/кг до примерно 50 нмолей/кг, от примерно 750 пмолей/кг до примерно 30 нмолей/кг, от примерно 250 пмолей/кг до примерно 5 нмолей/кг, от примерно 1 нмоля/кг до примерно 10 нмолей/кг или находиться в пределах, представляющих собой комбинацию любых двух из указанных значений.

Специалисту в данной области должно быть очевидно, что на эффективное количество молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в настоящем изобретении, положительно влияет соответствующие свойства обеспечивающего направленный перенос в WBC полипептида, предлагаемого в настоящем изобретении, но оно зависит также от эффективности компонента (Б), т.е. лекарственного средства или эффекторной молекулы, конъюгированной с обеспечивающим направленный перенос в WBC полипептидом. Таким образом, фактическая предпочтительная доза может варьироваться от одной молекулы-конъюгата, которая является транспортером карго-молекулы, к другой.

В этом контексте решение о схеме лечения, например, касательно доз и т.д., находится в компетенции обычных практикующих врачей и других лечащих врачей и, как правило, учитывает нарушение, подлежащее лечению, состояние каждого пациента, место введения и метод введения и другие факторы, известные практикующим специалистам в данной области. Примеры методов и упомянутых протоколов приведены в справочнике Remington's Pharmaceutical Sciences, 16-oe изд., под ред. Osol A., 1980.

Таким образом, предлагаемая в изобретении фармацевтическая композиция, как правило, содержит «безопасное и эффективное количество» компонентов предлагаемой в изобретении фармацевтической композиции, в частности, предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. В контексте настоящего описания «безопасное и эффективное количество» означает количество описанной выше предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, которое является достаточным для значительной индукции положительного изменения заболевания или нарушения, представленного в настоящем описании. Однако в то же время «безопасное и эффективное количество» является в достаточно небольшим, чтобы избегать серьезных побочных действий, другими словами, обеспечивать разумную зависимость между преимуществом и риском. Определение этих пределов, как правило, регулируется соответствующими медицинскими правилами. «Безопасное и эффективное количество» компонентов предлагаемой в изобретении фармацевтической композиции, прежде всего предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, описанной выше, должно, таким образом, варьироваться в зависимости от конкретного состояния, подлежащего лечению, а также возраста и физического состояния пациента, подлежащего лечению, веса тела, общего состояния здоровья, пола, диеты, времени введения, скорости экскреции, комбинации лекарственных средств, активности конкретных компонентов (А), (Б), (В), (Г) и/или (Д) и т.д. описанной выше предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, серьезности состояния, продолжительности лечения, особенностей сопутствующей терапии, конкретного применяемого фармацевтически приемлемого носителя и аналогичных факторов, которые известны и находятся в компетенции осуществляющего лечение врача. Предлагаемую в изобретении фармацевтическую композицию можно применять для человека, а также в ветеринарных медицинских целях, предпочтительно в медицинских целях для человека, в качестве фармацевтической композиции в целом или более конкретно в качестве вакцины.

Согласно конкретному варианту осуществления изобретения предлагаемую в изобретении фармацевтическую композицию можно применять в качестве вакцины, например, если компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, представляет собой терапевтически активный белок, такой как (белковый или полипептидный) антиген или антигенный фрагмент или любую молекулу, описанную выше, которая обладает способностью вызывать иммунный ответ. Указанная предлагаемая в изобретении вакцина, как правило, по составу напоминает предлагаемую в изобретении фармацевтическую композицию, и она предпочтительно поддерживает врожденный и/или адаптивный иммунный ответ иммунной системы пациента, подлежащего лечению, в зависимости от природы компонентов (Б), (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, описанной выше. Например, если любые эти компоненты представляют собой или кодируют (полипептидный) антиген или антигенный фрагмент, то вакцина, как правило, должна вызывать адаптивный иммунный ответ у пациента, подлежащего лечению. Аналогично этому, любой из других компонентов (Б), (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может вызывать врожденный и/или адаптивный иммунный ответ.

Предлагаемая в изобретении вакцина может содержать также фармацевтически приемлемый носитель, адъювант и/или наполнитель, как они определены выше для предлагаемой в изобретении фармацевтической композиции. В конкретном варианте предлагаемой в изобретении вакцины выбор фармацевтически приемлемого носителя определяют в основном в зависимости от пути введения предлагаемой в изобретении вакцины. Предлагаемую в изобретении вакцину можно применять, например, системно или локально. Пути системного введения в целом включают, например, трансдермальный, оральный, парентеральный пути, включая подкожные, внутривенные, внутримышечные, внутриартериальные, внутрикожные и внутрибрюшинные инъекции и/или внутриносовые пути введения. Пути локального применения в целом включают, например, местные пути нанесения, но также и внутрикожные, трансдермальные, подкожные или внутримышечные инъекции или инъекции в область повреждения, внутричерепную, внутрилегочную, внутрисердечную и подъязычную инъекцию. Более предпочтительно вакцины можно применять внутрикожным, подкожным или внутримышечным путем. Таким образом, предлагаемые в изобретении вакцины предпочтительно приготавливать в форме жидкости (или иногда в твердой форме). Пригодное для введения количество предлагаемой в изобретении вакцины можно определять с помощью обычных экспериментов с использованием животных моделей. Такие модели включают (но, не ограничиваясь только ими) модели, созданные с использованием кроликов, овец, мышей, крыс, собак и приматов кроме человека. Предпочтительные формы для инъекций в виде стандартных доз включают стерильные растворы в воде, физиологическом растворе или их смесях. Значение рН указанных растворов следует доводить примерно до 7,4. Приемлемыми носителями для инъекций являются гидрогели, устройства для контролируемого или замедленного высвобождения, полимолочная кислота и коллагеновые матрицы. Пригодными фармацевтически приемлемыми носителями для местного применения являются носители, которые можно применять в виде лосьонов, кремов гелей и т.п. Если предлагаемая в изобретении вакцина предназначена для орального введения, то предпочтительными стандартными формами лекарственного средства являются таблетки, капсулы и т.п. Фармацевтически приемлемые носители, которые можно применять для приготовления стандартных дозируемых форм, предназначенных для орального введения, хорошо известны из существующего уровня техники. При этом выбор должен зависеть от вторичных характеристик, таких как вкус, цена и способность к хранению, которые не имеют решающего значения для целей настоящего изобретения, и его может без труда осуществить специалист в данной области.

Предлагаемая в изобретении вакцина может содержать также одну или несколько вспомогательных субстанций с целью дополнительного повышения ее иммуногенности. При этом предпочтительно достигается синергетическое действие между предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, описанной выше, и вспомогательной субстанцией, которая необязательно может входить в состав предлагаемой в изобретении вакцины, описанной выше. В этом плане в зависимости от различных типов вспомогательных субстанций они могут обладать различными механизмами действия. Например, соединения, которые обеспечивают созревание дендритных клеток (DC), например, липополисахариды, TNF-альфа или CD40-лиганд, образуют первый класс пригодных вспомогательных субстанций. В целом, в качестве вспомогательной субстанции можно применять любой агент, который оказывает воздействие на иммунную систему в виде «сигнала опасности» (LPS, GP96 и т.д.), или цитокины, такие как GM-CFS, которые приводят к тому, что иммунный ответ, продуцируемый стимулирующим иммунную систему адъювантом, предлагаемым в изобретении, повышается, и/или которые оказывают направленное воздействие на иммунный ответ. Особенно предпочтительными вспомогательными субстанциями являются цитокины, такие как монокины, лимфокины, интерлейкины или хемокины, которые также усиливают врожденный иммунный ответ, такие как IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, INF-альфа, IFN-бета, INF-гамма, GM-CSF, G-CSF, М-CSF, LT-бета или TNF-альфа, факторы роста, такие как hGH.

Другими добавками, которые можно включать в фармацевтическую композицию или в предлагаемую в изобретении вакцину, являются эмульгаторы, такие, например, как Tween®; смачивающие вещества, такие, например, как лаурилсульфат натрия; красители; улучшающие вкус вещества, фармацевтические носители; формирующие таблетки агенты; стабилизаторы; антиоксиданты; консерванты.

Предлагаемая в изобретении вакцина может содержать также любое дополнительное соединение, для которого известно, что оно стимулирует иммунную систему благодаря его аффинности к связыванию (в качестве лигандов) с человеческими Toll-подобными рецепторами TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, или в результате его аффинности к связыванию (в качестве лигандов) с мышиными Toll-подобными рецепторами в TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 или TLR13.

В этом контексте другим классом соединений, которые можно добавлять в предлагаемую в изобретении вакцину, могут являться CpG-нуклеиновые кислоты, в частности CpG-PHK или CpG-ДНК. CpG-PHK или CpG-ДНК могут представлять собой одноцепочечную CpG-ДНК (ss CpG-ДНК), двухцепочечную CpG-ДНК (ВзДНК), одноцепочечную CpG-PHK (ss CpG-PHK) или двухцепочечную CpG-PHK (ds CpG-PHK). CpG-нуклеиновая кислота предпочтительно имеет форму CpG-PHK, более предпочтительно форму одноцепочечной CpG-PHK (ss CpG-PHK). CpG-нуклеиновая кислота предпочтительно содержит по меньшей мере одну или несколько (митогенные) динуклеотидную(ые) цитозин/гуаниновую(ые) последовательность(и) (CpG-мотив(ы)). Согласно первому предпочтительному альтернативному варианту по меньшей мере один CpG-мотив, входящий в эти последовательности, т.е. С (цитозин) и G (гуанин) CpG-мотива, является неметилированным. Все другие цитозины или гуанины, необязательно входящие в эти последовательности, могут быть либо метилированными, либо неметилированными. Однако согласно другому предпочтительному альтернативному варианту С (цитозин) и G (гуанин) CpG-мотива могут присутствовать также в метилированной форме.

Согласно следующему объекту настоящего изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления фармацевтической композиции или вакцины, предпочтительно обеих, как они определены выше) для профилактики, лечения, ослабления и/или уменьшения интенсивности любых заболеваний и нарушений, представленных в настоящем описании.

В частности, молекулы-конъюгаты, которые являются транспортерами карго-молекул, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, которые представлены в настоящем описании, можно применять для эффективного направленного переноса представляющей интерес субстанции (карго-молекула), такой как лекарственные средства и эффекторные молекулы, в лейкоциты. Таким образом, согласно настоящему изобретению можно осуществлять транспорт в лейкоциты, например, in vivo, in vitro и/или ex vivo.

Таким образом, молекулы-конъюгаты, которые являются транспортерами карго-молекул, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, которые представлены в настоящем описании, можно применять для лечения, профилактики, ослабления и/или уменьшения интенсивности заболеваний и/или нарушений, в которых принимают участие лейкоциты.

Понятие «заболевания и/или нарушения, в которых принимают участие лейкоциты» в контексте настоящего описания относится к:

а) заболеваниям и/или нарушениям, которые связаны с дефектом самих лейкоцитов (дефект в WBC является основной причиной заболеваний),

б) заболеваниям и/или нарушениям, при которых дефекты WBC не являются основной причиной заболевания, но при которых WBC принимают участие в статусе заболевания и его симптомах (WBC являются вторичной причиной заболевания), и/или

в) заболеваниям и/или нарушениям (и симптомам), ни первичной, ни вторичной причиной которых не являются или на которые не оказывают отрицательного воздействия WBC, но которые можно лечить, предупреждать, ослаблять и/или уменьшать их интенсивность путем воздействия на лейкоциты (например, можно осуществлять стимуляцию с помощью молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в настоящем изобретении).

Примерами, приведенными только с целью иллюстрации, болезней, указанных в подпункте а), являются (но, не ограничиваясь только ими) генетические дефекты лейкоцитов и типы рака из WBC, такие как лейкозы и лимфомы. Примерами, приведенными только с целью иллюстрации, болезней, указанных в подпункте б), являются (но, не ограничиваясь только ими) многие типы воспалительных заболеваний. Примерами, приведенными только с целью иллюстрации, болезней, указанных в подпункте в), являются (но, не ограничиваясь только ими) большинство инфекционных болезней.

Понятие «лейкоциты» (WBC) в контексте настоящего описания относится к любому типу лейкоцитов. Лейкоциты могут представлять собой первичные клетки, иммортализованные клетки и/или трансгенные клетки. Из можно выбирать, например, из гранулоцитов, лимфоцитов, моноцитов, макрофагов, дендритных клеток, тучных клеток и/или клеток микроглии. Гранулоциты можно выбирать из группы, включающей нейтрофилы, эозинофилы и базофилы. Лимфоциты можно выбирать, например, из NK-клеток, Т-клеток-хелперов, цитотоксических Т-клеток, γδ-Т-клеток и В-клеток. Под понятие подпадают также клетки-предшественники и/или различные стадии развития лейкоцитов.

Известно несколько возможных путей применения молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой изобретении фармацевтической композиции или предлагаемой в изобретении вакцины, как они определены выше в настоящем изобретении, в способе лечения. Например, молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в настоящем изобретении, можно применять для лечения, профилактики, ослабления и/или уменьшение интенсивности заболевания и/или нарушения, в котором принимают участие лейкоциты, выбранного из вирусных инфекций, в частности из вирусных инфекций лейкоцитов.

Примерами указанных вирусных инфекций, в частности вирусных инфекций лейкоцитов, и примеры применяемых для лечения агентов (некоторые из которых могут функционировать в качестве компонента (Б) в настоящем изобретении), представлены в таблице 4.

Таблица 4
Вирус Болезнь(и) WBC-мишень Примеры лечения
ВИЧ СПИД CD4
Вирус Эпштейна-Барра Мононуклеоз В-клетки Преднизон, ацикловир, внутривенно иммуноглобулин (гаммагард S/D, гаммар-Р, полигам)
Морбилливирус (вирус кори) Корь Моноциты
Парамиксовирус Свинка Современные статьи в Virology, 2002; Flodstro, 2003; Samarkos, 2005.
Рубивирус Краснуха (коревая) Flodstro, 2003; Samarkos, 2005.
Вирус герпеса типа 6 Розеола детская CD4 Неотложное лечение является поддерживающим
Вирус герпеса Цитомегаловирус Снижение экспрессии на поверхности молекул ГКС класса I-предупреждение презентации антигена CD8+-T-клеткам
Вирус Болезнь(и) WBC-мишень Примеры лечения
Вирус лихорадки Денге Лихорадка Денге Turuel-Leupez, 1991; Kyle, 2007; Liu, 2002; Kubelka, 2001; Kurane, 1991
Вирус герпеса простого 1 Герпес оральный Снижение экспрессии на поверхности молекул ГКС класса I-предупреждение презентации антигена CD8+-T-клеткам Орально: ацикловир (зовиракс), валацикловир (валтрекс) и фамцикловир (фамвир), местно: пенцикловир (денавир), ацикловир, крем, докозанол, крем (абрева)
Вирус герпеса простого 2 Герпес генитальный Снижение экспрессии на поверхности молекул ГКС класса I-предупреждение презентации антигена CD8+-T-клеткам Ацикловир (зовиракс), валацикловир (валтрекс) и фамцикловир(фамвир)
Парвовирус Парвовирус В19 Иногда вирус заражает нейтрофилы IVIG (внутривенно иммуноглобулин)
Респираторно-синцитиальный вирус Бронхиолит, RSV Moore, 2006; McNamara, 2002; Zhang, 2006
Вирус оспы человека Натуральная оспа, Stanford, 2007
Вирус ветряной оспы куриная оспа, опоясывающий герпес Arvin, 2006; Quinlivan, 2006 Ацикловир (зовиракс), валацикловир (валтрекс) и фамцикловир (фамвир)
Флавивирус Желтая лихорадка Tomori, 2004; Meulen, 2004
Человеческий Т-лимфотропный вирус типа 1 Вирус Т-клеточного лейкоза взрослых, HTLV-ассоциированный увеит, HTLV-ассоциированный инфекционный дерматит, HTLV-1-ассоциированная миелопатия Albrecht, 2002; Bangham, 2003
Человеческий Т-лимфотропный вирус типа 2
Человеческий Т-лимфотропный вирус типа 3 Ассоциированная со СПИДом
Человеческий Т-лимфотропный вирус типа 4 Сходная с вызываемой ВИЧ
Вирус Болезнь(и) WBC-мишень Примеры лечения
Вирус гепатита А Гепатит А Vallbracht, 1992; Hashimoti, 1996
Вирус гепатита В Гепатит В Снижение экспрессии на поверхности молекул ГКС класса I-предупреждение презентации антигена CD8+-T-клеткам Интерферон, ламивудин, адефовир дипивоксил
Вирус гепатита С Гепатит С Hashimoti, 1996 Комбинированная терапия: пэгилированный интерферон и рибавирин (см. обзор по совместному применению)
Вирус гепатита D Гепатит D Casey, 1998; Nisini, 1997 Неотложный уход: поддерживающий; постоянный уход: интерферон альфа
Вирус гепатита Е Гепатит Е Zhao,2001; Srivastava, 2007 Только поддерживающее лечение
Вирус Ласса Лихорадка Ласса Sbrana, 2006 Рибавирин
Вирус гриппа А (включая подтипы H1N1 и H3N2) Грипп Sloadkovoa, 2006; Trushinskaia, 1988 Оселтамивир, занамивир
Вирус гриппа В Грипп Schultz-Cherry, 1998; Zambon, 2001 Оселтамивир, занамивир
Вирус гриппа С Грипп Matsuzaki, 1997 Оселтамивир, занамивир

Дополнительные примеры заболеваний и/или нарушений, в которые вовлечения лейкоциты, представлены в таблице 5.

Таблица 5
Название болезни Краткое описание Мишень Причина
Нейтрофилия Повышение количества нейтрофилов Нейтрофилы Стресс; роды; инфекция; воспаление; некроз ткани; лекарственные средства/химикалии; изменения метаболизма
Нейтропения Снижение количества нейтрофилов Нейтрофилы Рак; некоторые медикаментозные средства; облучение; наследственные нарушения
Лейкопения Снижение количества лейкоцитов Лейкоциты Химиотерапия; лучевая терапия; лейкоз; миелофиброз; апластическая анемия; инфекции
Базопения Снижение количества базофилов Базофилы Ответ на тиреотоксикоз; острая реакция гиперчувствительности; инфекции
Базофилия Повышение количества базофилов Базофилы Гипотериоидизм; миелопролиферативные нарушения (например, истинная полицитемия; миелофиброз); реакции гиперчувствительности
Название болезни Краткое описание Мишень Причина
Эозинопения Снижение количества эозинофилов Эозинофилы Синдром Кушинга; стрессовые реакции; стероиды
Эозинофилия Повышение количества эозинофилов Эозинофилы Аллергические реакции; неоплазия; болезнь Аддисона; коллагеновая сосудистая болезнь; паразиты
Идиопатический гиперэозинофильный синдром Повышение количества эозинофилов (1500 клеток/мкл крови) Эозинофилы Причина эозинофилии не известна
Лимфоцитарный лейкоцитоз; лимфоцитоз Аномально высокое количество лимфоцитов Лимфоциты Вирусные инфекции; бактериальные инфекции, такие как туберкулез; рак, такой как лимфома, острый или хронический лимфоцитарный лейкоз; болезнь Грейвса; болезнь Крона; чувствительность к лекарственным средствам
Лимфоцитопения Аномально низкое количество лимфоцитов Лимфоциты СПИД; рак, такой как лейкоз, лимфома, болезнь Ходжкина; хронические инфекции, такие как малярия, туберкулез; наследственные нарушения, такие как определенные агаммаглобулинемии; аномалия Ди Георге, синдром Вискотта-Олдрича, синдром тяжелого комбинированного иммунодефицита и атаксия-телеангиэктазия; ревматоидный артрит; системная красная волчанка; некоторые вирусные инфекции
Моноцитоз Повышенное количество моноцитов Моноциты Хронические инфекции; аутоиммунное заболевание; нарушения крови; рак; желудочно-кишечные нарушения
Моноцитопения Пониженное количество моноцитов Моноциты Высвобождение бактериями токсинов в кровь; химиотерапия; кортикостероиды
Аномалия Мая-Хеглина Присутствие телец Деле в лейкоцитах Лейкоциты Вероятно, ассоциирована с человеческим геном MYH9
Аномалия Пельгера-Хюэта Нейтрофилы не могут сегментироваться; <75% нейтрофилов Нейтрофилы Наследственный дефект, вторичное проявление мутаций в рецепторе ламина В (LBR); лекарственная терапия, рак и определенные инфекции
Аномалия Альдера-Рейли Накопление частично расщепленного мукополисахарида в лизосомах Лейкоциты Мукополисахаридоз, такой как синдром Гурлера, синдром Гунтера
Название болезни Краткое описание Мишень Причина
Синдром Чедиака-Хигаси Гигантские лизосомальные включения в результате слияния лизозимов Гранулоциты; лейкоциты; моноциты Наследственные функциональные нарушения
Синдром Джобса; гипер-IgE Нарушена направленность движения; рекуррентные фурункулы и абсцессы Гранулоциты Наследственные функциональные нарушения
Синдром ««ленивых» лейкоцитов Нарушено случайное и направленное движение, клетки не могут отвечать на воспалительные стимулы Гранулоциты Наследственные функциональные нарушения
Врожденный дефицит С3 Неспособность поглощать микроорганизмы, повторные серьезные инфекции Гранулоциты Наследственные функциональные нарушения
Хроническое грануломатозное заболевание Нарушена способность нейтрофилов подвергаться окислительному импульсу; не могут уничтожать бактерии Гранулоциты Ассоциировано с дистрофией желтого пятна
Лейкоцитарный дефицит глюкозо-6-фосфатдегидрогеназы Неспособность уничтожать бактерии; рекуррентная биогенная инфекция Гранулоциты Наследственные функциональные нарушения
Дефицит миелопероксидазы - доброкачественный Замедленная, но полная способность уничтожать бактерии Гранулоциты Наследственные функциональные нарушения
Тяжелый комбинированный иммунодефицит Нарушение гуморального и клеточного иммунитета Лимфоциты Наследственные функциональные нарушения
Синдром Ди Георге Частичное или полное нарушение развития тимуса и паращитовидных желез Лимфоциты-Т-клетки Наследственные функциональные нарушения
Синдром Незелоф Нарушенная функция тимуса Лимфоциты-Т-клетки Наследственные функциональные нарушения
Связанная с полом агаммаглобулинемия детей Рекуррентные бактериальные инфекции Лимфоциты-В-клетки Наследственные функциональные нарушения
Общая вариабельная гипогаммаглобулинемия Отсутствие одного или комбинации иммуноглобулинов; неспособность В-клеток созревать/функционировать в качестве плазматических клеток Лимфоциты-В-клетки Наследственные функциональные нарушения
Мукополисахаридоз Дефицит специфических ферментов, расщепляющих мукополисахариды Моноциты-макрофаги Наследственные функциональные нарушения
Липодоз Связанная с накоплением липидов болезнь - макрофаги оказываются перегруженными липидами. Моноциты-макрофаги Наследственные функциональные нарушения
Болезнь Гоше Дефицит фермента глюкоцереброзидазы.
Название болезни Краткое описание Мишень Причина
Болезнь Ниманна-Пика Накопление жира и холестерина в клетках печени, селезенки, костного мозга, легких, головного мозга.
Болезнь Фабри Дефицит α-галактозидазы-; накопление жирового материла в вегетативной нервной системе, глазах, почках и сердечнососудистой системе.
Болезнь Фарбера Дефицит церамидазы; накопление жирового материала в суставах, тканях и центральной нервной системе.
Ганглиозидоз; болезнь Тея-Сакса; болезнь Сандхоффа Накопление ганглиозидов.
Болезнь Краббе Дефицит галактозилцерамидазы.
Метохроматическая лейкодистрофия Образования в белом веществе центральной нервной системы и в периферической нервной системе.
Болезнь Вольмана Дефицит липазы.
Лейкоз Рак Лейкоциты Аномальный и неконтролируемый рост клеток
Острый лимфоцитарный лейкоз (L1, L2. L3) Пролиферация лимфобластов В-клетки или Т-клетки Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Хронический лимфоцитарный лейкоз Пролиферация малых зрелых В-лимфоцитов. В-клетки Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Острый миелогенный лейкоз (AML) Пролиферация миелобластов. Властные клетки костного мозга Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Недифференцированный AML (М0) У клеток костного мозга отсутствуют заметные признаки дифференциации. Властные клетки костного мозга Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Миелобластный лейкоз (M1) У клеток костного мозга видны признаки гранулоцитарной дифференциации. Властные клетки костного мозга Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Миелобластный лейкоз (М2) Созревание клеток костного мозга происходит на и после промиелоцитной (ранний гранулоцит)стадии. Властные клетки костного мозга Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Название болезни Краткое описание Мишень Причина
Промиелоцитарный лейкоз (М3) Большинство клеток представляют собой аномально ранние гранулоциты, которые по их стадии развития находятся между миелобластами и миелоцитами. Ранние гранулоциты Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Миеломоноцитарный лейкоз (М4) В костном мозге и циркулирующей крови вариабельные количества дифференцированных гранулоцитов и моноцитов; может присутствовать также некоторое количество аномальных эозинофилов. Гранулоциты; моноциты Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Моноцитарный лейкоз (М5) Плохо дифференцированные монобласты; большая доля монобластов, промоноцитов и моноцитов. Монобласты; промоноциты; моноциты Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Эритолейкоз (М6) Аномальные формирующие эритроциты клетки. Эритроциты Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Мегакариобластный лейкоз (М7) Увеличенное отложение фиброзной ткани (фиброз) в костном мозге. Властные клетки костного мозга Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Хронический миелогенный лейкоз Пролиферация более зрелых гранулоцитов Властные клетки костного мозга Облучение; лекарственные средства и химикалии; вирусы; генетические факторы
Лимфома Злокачественная пролиферация лимфоидных клеток-болезнь Ходжкина, не-ходжкинская болезнь В-клетки; Т-клетки Инфекции; ВИЧ; аутоиммунное заболевание; химикалии; генетические факторы; возраст

Предпочтительно, молекулы-конъюгаты, которые являются транспортерами карго-молекул, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, применяют для лечения, профилактики, ослабления и/или уменьшения интенсивности заболевания и/или нарушения, выбранного из рака и опухолевых заболеваний, включая болезни, вызываемые нарушенным апоптозом, воспалительные заболевания, инфекционные болезни, включая бактериальные и вирусные (инфекционные) болезни, болезни в значительной степени связанные с передачей сигналов JNK, аутоиммунные нарушения или заболевания, сердечнососудистые заболевания, нейронные или нейродегенеративные заболевания, болезни печени, болезни позвоночника, болезни матки, большие депрессивные нарушения, нехронические или хронические заболевания пищеварительной системы, диабет, потерю волос, потерю слуха или болезни внутреннего уха. Предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, можно применять также (для приготовления фармацевтической композиции) при трансплантации ткани либо путем обработки органов/ткани/клеток, подлежащих трансплантации, либо путем обработки реципиента органа/ткани/клеток, например, с целью предупреждения инициации лейкоцитами отторжения трансплантата.

Профилактика, лечение, ослабление и/или уменьшение интенсивности заболевания, указанного в настоящем описании, как правило, включает введение фармацевтической композиции, указанной выше. Понятие «профилактика», как правило, относится к предупреждению заболевания, указанного в настоящем описании, у пациента, предпочтительно до проявления заболевания у пациента.

Понятие «лечение» относится, в целом, к любому лечению заболевания, указанного в настоящем описании, у пациента, при этом заболевание может быть уже диагностировано или должно быть предупреждено, т.е. до, параллельно и после проявления заболевания у пациента. Понятие «лечение», используемое, например, в понятии «лечение состояния», кроме того, предпочтительно означает введение по меньшей мере терапевтически эффективного количества терапевтического соединения для получения терапевтического действия. При этом не обязательно подразумевается «исцеление», а скорее подразумевается, что при введении оказывается предпочтительно по меньшей мере некоторое минимальное физиологическое действие на состояние живого организма, имеющего указанное состояние. Например, лечение должно предусматривать введение агента, и присутствие этого агента приводит к изменению физиологии животного-реципиента. Понятие «ослабление» в контексте настоящего описания относится к воздействию, при котором развитие прогрессирующего в противном случае заболевания замедляется или останавливается, например, на определенной стадии. И, наконец, понятие «уменьшение интенсивности» предпочтительно включает любую модификацию заболевания, указанного в настоящем описании, предпочтительно положительную модификацию заболевания, указанного в настоящем описании. Конкретная модификация зависит от болезни, подлежащей лечению.

Предлагаемую в изобретении фармацевтическую композицию, вакцину или предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как они определены выше, можно вводить непосредственно пациенту с использованием путей введения, описанных выше для фармацевтических композиций. В альтернативном варианте фармацевтическую композицию, вакцину или предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как они определены выше, можно вводить пациенту, используя подход ex vivo, например, путем интродукции фармацевтической композиции, вакцины или предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, как они определены выше, в клетки, предпочтительно аутологичные клетки, т.е. клетки, полученные из организма пациента, подлежащего лечению, и трансплантации этих клеток в определенную область пациента, подлежащего лечению, необязательно после хранения и/или культивирования этих клеток перед лечением.

Согласно одному из предпочтительных вариантов осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности рака или опухолевых заболеваний, включая заболевания, вызываемые нарушением апоптоза, предпочтительно выбранные из группы, включающей невриному слухового нерва, анальную карциному, астроцитому, базалиому, болезнь Бехчета, рак мочевого пузыря, бластомы, рак кости, метастазы в головной мозг, опухоли головного мозга, рак головного мозга (глиобластомы), рак молочной железы (карцинома молочной железы), лимфому Беркитта, карциноиды, рак шейки матки, карциному ободочной кишки, колоректальный рак, карциному тела, краниофарингеомы, CUP-синдром (синдром рака с невыявленным первичным очагом), карциному эндометрия, рак желчного пузыря, опухоли гениталий, включая рак мочеполовой системы, глиобластому, глиомы, опухоли головы/шеи, гепатомы, гистоцитарную лимфому, синдромы или лимфомы Ходжкина и не-ходжкинские лимфомы, опухоль гипофиза, рак кишечника, включая опухоли тонкого кишечника и желудочно-кишечные опухоли, саркому Капоши, рак почки, карциномы почки, рак желудочка гортани или рак гортани, лейкоз, включая острый миелолейкоз (AML), эритролейкоз, острый лимфолейкоз (ALL), хронический миелолейкоз (CML), хронический лимфолейкоз (CLL), опухоль века, рак печени, метастазы в печень, карциномы легкого (= рак легкого = бронхиальная карцинома), мелкоклеточные карциномы легкого и немелкоклеточные карциномы легкого и аденокарциномы легкого, лимфомы, рак лимфатической системы, злокачественные меланомы, относящиеся к молочной железе карциномы (= рак молочной железы), медуллобластомы, меланомы, менингиомы, грибовидный микоз, неопластические заболевания типа невриномы, эзофагеальный рак, эзофагеальную карциному (= эзофагеальный рак), олигодендроглиому, рак яичника (= карцинома яичника), карциному яичника, карциному поджелудочной железы (= рак поджелудочной железы), относящийся к половому члену рак, рак полового члена, фарингеальный рак, опухоль гипофиза, плазмоцитому, рак предстательной железы (= опухоли предстательной железы), ректальную карциному, ректальные опухоли, рак почки, карциномы почки, ретинобластому, саркомы, болезнь Шнеебергера, рак кожи, например, меланомный или не-меланомный рак кожи, включая базальноклеточные и плоскоклеточные карциномы, а также псориаз, пузырчатку обыкновенную, опухоли мягких тканей, спиналому, рак желудка, рак яичек, рак гортани, тимому, карциному щитовидной железы, рак языка, уретральный рак, рак матки, вагинальный рак, различные индуцируемые вирусами опухоли, такие, например, как карцинома, вызываемая вирусом папилломы (например, карцинома шейки матки = рак шейки матки), аденокарциномы, опухоли, вызываемые вирусом герпеса (например, лимфома Беркитта, В-клеточная лимфома, индуцируемая вирусом Эпштейна-Барра (EBV) лимфома), опухоли, индуцируемые вирусом гепатита В (печеночно-клеточная карцинома), лимфомы, вызываемые HTLV-1 и HTLV-2, рак вульвы, связанные с бородавками состояния или патологический процесс и т.д. В контексте настоящего описания понятия «терапия» и «терапевтический» предпочтительно означают по меньшей мере некоторое минимальное физиологическое действие после введения на состояние живого организм, подлежащего лечению. Например, физиологическое действие при введении «терапевтического» противоопухолевого соединения может представлять собой ингибирование роста опухоли или снижение размера опухоли, или предупреждение повторного появления опухоли. Предпочтительно при лечении рака или неопластического заболевания соединение, которое ингибирует рост опухоли или снижает размер опухоли, или предупреждает повторное появление опухоли, должно рассматриваться как терапевтически эффективное. Таким образом, понятие «противоопухолевое лекарственное средство» предпочтительно относится к любому терапевтическому агенту, который обладает терапевтическим действием в отношении опухоли, неопластического заболевания или рака.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности воспалительных болезней, таких как воспалительные заболевания легкого или болезни легкого, включая острый респираторный дистресс-синдром (ARDS) или легочный фиброз, воспаление ткани, включая (но, не ограничиваясь только ими) формирование фиброзной ткани, в том числе муковисцидоз, менингит, и реакции отторжения трансплантата, хронические заболевания дыхательных путей, включая астму, хроническое обструктивное заболевание легких (COPD), пневмонию и легочный фиброз.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности, например, инфекционных болезней, предпочтительно вирусных, ретровирусных, бактериальных или протозойных инфекционных заболеваний. Такие инфекционные болезни, как правило, выбирают из группы, включающей СПИД, сибирскую язву, японский энцефалит, бактериальные инфекционные болезни, такие как выкидыш (воспаление предстательной железы), сибирская язва, аппендицит, боррелиоз, ботулизм, заболевание, вызываемое микроорганизмами Camphylobacter, хламидийная трахома (воспаление уретры, конъюнктивит), холера, дифтерия, донованоз, эпиглоттит, сыпной тиф, газовая гангрена, гонорея, туляремия, заболевание, вызываемое Heliobacter pylori, коклюш, паховый лимфогранулематоз, остеомиелит, болезнь легионеров, ветрянка, остроконечная кондилома, заболевание, вызываемое цитомегаловирусом (CMV), лихорадка Денге, весенне-летний менингоэнцефалит (FSME), заболевание, вызываемое вирусом Эбола, простуды, инфекционная эритема (пятая болезнь), ящур, заболевание, вызываемое вирусом герпеса простого типа I, вирусом герпеса простого типа II, опоясывающий лишай, HSV, инфекционные болезни, вызываемые паразитами, простейшими или грибами, такие как амеобиоз, шистамоз, болезнь Шагаса, болезни, вызываемые Echinococcus, дифиллоботриоз, пищевое отравление рыбами (сигуатера), болезни, вызываемые птичьим цепнем, эпидермофия стопы, болезнь, вызываемая собачим солитером (эхинококк), кандидоз, пятнистость, вызываемая дрожжевыми грибками, чесотка, кожный лейшманиоз, лямблиоз (протозойная инфекция, вызываемая Lamblia intestinalis}, педикулез, малярия (определяемая по методу микроскопии толстой капли), онхоцеркоз (речная слепота), болезни, вызываемые грибами, бычьим цепнем, шистоматоз, болезнь, вызываемая свиным цепнем, токсоплазмоз, трихомониаз, трипаносомоз (сонная болезнь), индийский висцеральный лейшманиоз, «подгузниковый»/«пеленочный» дерматит, болезнь, вызываемая карликовым цепнем, такие болезни, как инфекционная эритема, грипп, саркома Капоши, лихорадка Ласса, лейшманиоз, проказа, листериоз, боррелиоз Лайма, малярия, инфекция, вызываемая вирусом Марбург, корь, менингит, включая бактериальный менингит, инфекция, вызываемая вирусом контагиозного моллюска, мононуклеоз, свинка, заболевание, вызываемое Mycoplasma hominis, сепсис новорожденных (хориоамнионит), влажная гангрена, инфекция, вызываемая вирусом Норвалк, паратиф, воспаление среднего уха, железистая лихорадка Пфейффера, натуральная оспа, пневмония, полиомиелит (детская хромота), ложный круп, бешенство, синдром Рейтера, пятнистая лихорадка Скалистых гор, паратиф, вызываемый Salmonella, тиф, вызываемый Salmonella, SARS, скарлатина, опоясывающий герпес, гепатит, натуральная оспа, мягкий шанкр, сифилис, столбняк, трехдневная лихорадка, триппер, японская речная лихорадка, туберкулез, тиф, вагинит (кольпит), вирусные болезни, вызываемые такими вирусами, как цитомегаловирус (CMV), ортопоксвирус оспы, ортопоксвирус белой оспы, овечий паратоксвирус, вирус контагиозного моллюска, вирус герпеса простого 1, вирус герпеса простого 2, вирус герпеса В, вирус ветряной оспы, вирус ложного бешенства, вирус человеческой цитомегалии, человеческий вирус герпеса 6, человеческий вирус герпеса 7, вирус Эпштейна-Барра, человеческий вирус герпеса 8, вирус гепатита В, вирус чикунгунья, вирус O'nyong'nyong, рубивирус, вирус гепатита С, GB-вирус С, вирус Западного Нила, вирус лихорадки Денге, вирус желтой лихорадки, вирус шотландского энцефаломиелита овец (louping-вирус), вирус энцефалита Сент-Луис, вирус японского энцефалита В, вирус Повассан, вирус FSME, SARS, SARS-ассоциированный коронавирус, человеческий коронавирус 229Е, человеческий коронавирус Ос43, торовирус, человеческий Т-клеточный лимфотропный вирус типа I, человеческий Т-клеточный лимфотропный вирус типа II, ВИЧ (СПИД), т.е. человеческий вирус иммунодефицита типа 1 или человеческий вирус иммунодефицита типа 2, вирус гриппа, вирус лихорадки Лаоса, вирус лимфоцитарного лимфоцитарного хориоменингита, вирус комплекса Такарибе, вирус Хурин, вирус Мачупо, вирус болезни Борна, вирус Буньямвера, вирус калифорнийского энцефалита, вирус лихорадки долины Рифт, вирус лихорадки песчаных мух, вирус лихорадки Тоскана, вирус геморрагической лихорадки Крым-Конго, вирус Хазара, вирус Казань, вирус Хантаан, вирус Сеул, вирус Проспект Хилл, вирус Пуумала, вирус Белград-Дубрава, вирус Тула (Tula-вирус), вирус Sin Nombre (вирус без имени), вирус Марбург озера Виктория, вирус Эбола Заира, суданский вирус Эбола, вирус Эбола Берега Слоновой Кости, вирус гриппа А, вирус гриппа В, вирус гриппа С, вирус парагриппа, вирус малярии, вирус Марбург, вирус кори, вирус эпидемического паротита, респираторно-синцитиальный вирус, человеческий метапневмовирус, индийский вирус везикулярного стоматита, вирус бешенства, вирус Мокола, вирус Дувенхаге, европейский лиссавирус летучих мышей 1+2, австралийский вирус летучих мышей, аденовирус A-F, вирусы папилломы человека, вирус кондиломы 6, вирус кондиломы 11, вирусы полиомы, аденоассоциированный вирус 2, ротавирусы или орбивирусы, вирусы оспы, включая вирус ветряной оспы, и вирус малярии, вирусные инфекционные болезни, такие как СПИД, инфекционные болезни, вызываемые Condyloma acuminata, пустотелые бородавки, лихорадка Денге, трехдневная лихорадка, болезнь, вызываемая вирусом Эбола, простуда, весенне-летний менингоэнцефалит (FSME), лихорадка, опоясывающий герпес, гепатит, заболевание, вызываемое вирусом герпеса простого типа I, вирусом герпеса простого типа II, опоясывающий лишай, грипп, японский энцефалит, лихорадка Лаоса, болезнь, вызываемая вирусом Марбург, бородавки, лихорадка Западного Нила, желтая лихорадка и т.д.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней, в значительной степени связанных с передачей сигналов JNK у индивидуума. Такие болезни или нарушения, которые у индивидуума в значительной степени связаны с передачей сигналов JNK, предпочтительно выбирают (но, не ограничиваясь только ими) из аутоиммунных нарушений, сердечно-сосудистых болезней, рака или опухолевых заболеваний, указанных выше, диабета, включая диабет типа 1 или типа 2, воспалительных заболеваний, как они определены выше, потери волос, включая гнездную алопецию, болезней легкого, неврологических или нейродегенеративных болезней, болезней печени, болезней позвоночника, болезней матки, (вирусных) инфекционных болезней и депрессивных нарушений. В случае болезней или нарушений, в значительной степени связанных с передачей сигналов JNK, понятие «уменьшение интенсивности» может включать подавление экспрессии JNK при ее сверхэкпрессии, и/или подавление фосфорилирования c-jun, ATF2 или NFAT4 при любом из вышеуказанных заболеваний, например, с помощью по меньшей мере одной ингибирующей JNK последовательности, представленной в настоящем описании, в сочетании с предлагаемой в изобретении новой молекулой-транспортером, как она определена выше, в качестве конкурентного ингибитора встречающегося в естественных условиях сайта связывания c-jun, ATF2 и FAT4 в клетке. В этом конкретном контексте понятие «модулировать» относится также к подавлению гетеро-и гомомерных комплексов факторов транскрипции, таких как (но, не ограничиваясь только ими) c-jun, ATF2 или NFAT4 и родственных партнеров, таких, например, как АР-1-комплекс, включающий c-jun, AFT2 и c-fos. Когда указанное выше заболевание или нарушение, в значительной степени связанное с передачей сигналов JNK, ассоциировано со сверхэкспрессией JNK, такие супрессорные последовательности, ингибирующие JNK, можно интродуцировать в клетку. В некоторых случаях понятие «модулировать» в контексте заболевания или нарушения, в значительной степени связанного с передачей сигналов JNK, может включать также повышение уровня экспрессии JNK, например, при использовании специфического для IB-полипептида антитела, которое блокирует связывание IB-пептида с JNK, предупреждая тем самым ингибирование JNK родственным IB пептидом.

Предупреждение и/или лечение индивидуума с помощью предлагаемой в изобретении фармацевтической композиции, как она описана выше, можно, как правило, осуществлять путем введения (in vivo) индивидууму фармацевтической композиции в определенном («терапевтически эффективном») количестве, где индивидуум может представлять собой, например, любое млекопитающее, например, человека, примата, мышь, крысу, собаку, кошку, корову, лошадь или свинью. Понятие «терапевтически эффективный» означает, что количество активного компонента фармацевтической композиции является достаточным для облегчения заболевания или нарушения, как они определены выше, которые в значительной степени связаны с передачей сигналов JNK. Для других упомянутых в настоящем описании заболеваний можно привести дополнительные примеры.

Таким образом, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности аутоиммунных нарушений или заболеваний. Аутоиммунные нарушения или заболевания можно в широком смысле подразделять на системные и специфические для органа или локализованные аутоиммунные нарушения в зависимости от принципиальных клинико-патологических особенностей каждого заболевания. Аутоиммунные заболевания можно подразделять на следующие группы в зависимости от категорий системных синдромов, такие как системная красная волчанка (SLE), синдром Шегрена, склеродерма, ревматоидный артрит и полимиозит, или локальные синдромы, которые могут включать эндокринологические заболевания (диабет типа I (сахарный диабет типа 1), тиреоидит Хашимото, болезнь Аддисона и т.д.), дерматологические заболевания (пузырчатка обыкновенная), гематологические заболевания (аутоиммунная гемолитическая анемия), невральные заболевания (рассеянный склероз), или они могут затрагивать фактически любую ограниченную часть ткани организма. Подлежащие лечению аутоиммунные заболевания можно выбирать из группы, включающей аутоиммунные заболевания типа I, аутоиммунные заболевания типа II, аутоиммунные заболевания типа III и аутоиммунные заболевания типа IV, такие, например, как рассеянный склероз (MS), ревматоидный артрит, диабет, диабет типа I (сахарный диабет типа 1), хронический полиартрит, базедова болезнь, аутоиммунные формы хронического гепатита, неспецифический язвенный колит, аллергические болезни типа I, аллергические болезни типа II, аллергические болезни типа III, аллергические болезни типа IV, фибромиалгию, потерю волос, болезнь Бехтерева, болезнь Крона, тяжелую перемежающуюся хромоту, нейродермит, полимиалгию ревматическую, прогрессирующий системный склероз (PSS), синдром Рейтера, ревматоидный артрит, псориаз, васкулит и т.д., или диабет типа II. Хотя до настоящего времени остается нерасшифрованным точный механизм, посредством которого иммунная система индуцирует иммунную реакцию на аутоантигены, известен ряд данных, касающихся их этиологии. Так, аутореакция может являться результатом отказа от потребности в Т-клетках («пренебрежение»). В здоровой иммунной системе требуется активация В-клеток Т-клетками перед тем как первые приобретают способность продуцировать антитела в больших количествах. Это требование, касающееся Т-клеток, может «пренебрегаться» в редких случаях, таких как заражение организмами, продуцирующими супер-антигены, которые могут инициировать поликлональную активацию В-клеток или даже Т-клеток, путем непосредственного связывания с β-субъединицей Т-клеточных рецепторов неспецифическим образом. Другим предполагаемым объяснением механизма аутоиммунных заболеваний является молекулярная мимикрия. Экзогенный антиген может обладать структурными сходствами с определенными антигенами хозяина; в результате любое антитело, образующееся к этому антигену (который имитирует аутоантигены), может теоретически связываться также с антигенами хозяина и усиливать иммунный ответ. Наиболее сильная форма молекулярной мимикрии обнаружена в группе А бета-гемолитических стрептококков, антигены которых соответствуют человеческому миокарду и которые ответственны за воздействие на сердце ревматической атаки.

Предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности сердечно-сосудистых заболеваний, предпочтительно выбранных из болезней сердца и коронарных болезней сердца, артериосклероза, апоплексии, дилатации брюшной аорты, таких как связанная с гипертензией аневризма инфраренального отдела аорты, и инфаркта миокарда.

Так, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности неврологических или нейродегенеративных заболеваний, выбранных из группы, включающей (но, не ограничиваясь только ими) болезнь Альцгеймера, болезнь Паркинсона, амиотрофический боковой склероз (ALS), дистонию, эпилепсию, заболевание зрительного нерва, включая глаукому, глазную инфекцию, рассеянный склероз, менингит, неврологические болезни, связанные с нарушениями или заболеваниями, или представляющие собой заболевания или нарушения нервной системы, включая «отрезание» или нарушение аксонов, такие как аксотомия, боль, прежде всего нейропатическая боль, «удар», включая ишемический «удар», и вирусную энцефалопатию.

Предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней печени, выбранных из группы, включающей (но, не ограничиваясь только ими) гепатит и гепатотоксичность.

Кроме того, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней позвоночника, выбранных из группы, включающей (но, не ограничиваясь только ею) грыжу диска.

Согласно одному из предпочтительных вариантов осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней матки, выбранных из группы, включающей (но, не ограничиваясь только им) эндометриоз.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности депрессивных нарушений, выбранных из группы, включающей (но, не ограничиваясь только ими) большие депрессивные нарушения, известные также как большая депрессия, униполярную депрессию, клиническую депрессию, или простую депрессию, биполярные нарушения, манию и маниакальную депрессию.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности нехронических или хронических воспалительных болезней пищеварительной системы у индивидуума. Понятие «нехронические или хронические воспалительные болезни пищеварительной системы» в контексте настоящего описания применяют, как правило, для обозначения нехронических или хронических воспалительных болезней желудочно-кишечного тракта. Они включают болезни пищевода, желудка, первого, второго, третьего и четвертого отдела двенадцатиперстной кишки, тощей кишки, подвздошной кишки, илеоцекального комплекса, толстой кишки (восходящая, поперечная и нисходящая ободочная кишка), сигмовидной ободочной кишки и прямой кишки. Предпочтительными в этом плане являются хронические воспалительные заболевания пищеварительной системы, которые отличаются воспалением ободочной кишки, такие как колит, включая, например, неспецифический язвенный колит (язвенный колит), болезнь Крона, колит отключенной толстой кишки, ишемический колит, инфекционный колит, молниеносный колит, химический колит, микроскопический колит, лимфоцитарный колит, коллагенозный колит, недетерминированный колит и атипический колит и т.д.

В вышеуказанном контексте изобретение относится также к применению предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в изобретении фармацевтической композиции или предлагаемой в изобретении вакцины для профилактики, лечения и/или уменьшение интенсивности заболеваний или нарушений, упомянутых в настоящем описании. Изобретение относится также, в частности, к применению предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в изобретении фармацевтической композиции или предлагаемой в изобретении вакцины для инокуляции или к применению этих компонентов в качестве инокулята. Согласно одному из наиболее предпочтительных вариантов осуществления настоящего изобретения указанный способ профилактики, лечения и/или уменьшения интенсивности вышеуказанных заболеваний или нарушений или способ инокуляции для предупреждения вышеуказанных заболеваний, как правило, заключается в том, что вводят описанную выше предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, фармацевтическую композицию или вакцину пациенту, который нуждается в этом (например, страдающему любыми указанными выше болезнями или имеющему их симптомы), в частности, человеку, предпочтительно в «безопасном и эффективном» количестве и в виде одной из указанных выше препаративных форм. Путь введения также может представлять собой путь, описанный выше для предлагаемых в изобретении фармацевтических композиций или вакцин.

Согласно пятому объекту настоящего изобретения, предлагаемую в изобретении фармацевтическую композицию, предлагаемую в изобретении вакцину, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как они определены выше, обеспечивающий направленный перенос в WBC полипептид, как он определен выше, или его варианты или фрагменты, как они определены выше, можно применять в качестве лекарственного препарата. Такой лекарственный препарат может представлять собой фармацевтическую композицию или вакцину, как они описаны выше. Его можно использовать для медицинских целях вообще, предпочтительно для любой из таких целей, как профилактика, лечение и/или уменьшение интенсивности заболеваний или нарушений, упомянутых в настоящем описании.

Согласно еще одному объекту настоящего изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, можно применять для переноса любой карго-молекулы (предпочтительно указанной в настоящем описании) в лейкоциты пациента, подлежащего лечению. В этом контексте карго-молекула может быть пригодна для терапии, упомянутой в настоящем описании, прежде всего для профилактики, лечения, ослабления и/или уменьшения интенсивности заболеваний или нарушений, упомянутых в настоящем описании, и ее можно выбирать из любой пригодной для этого карго-молекулы, более предпочтительно из любой карго-молекулы, описанной выше для любого из компонентов (Б), (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

В одном из вариантов осуществления настоящего изобретения молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, не применяют для лечения, профилактики, ослабления и/или уменьшения интенсивности одного, двух или большего количества заболеваний и/или нарушений, выбранных из группы, включающей: рак и опухолевые заболевания, включая болезни, вызываемые нарушенным апоптозом; воспалительные заболевания, вирусные (инфекционные) болезни, болезни в значительной степени связанные с передачей сигналов JNK, аутоиммунные нарушения или заболевания, сердечно-сосудистые заболевания, нейронные или нейродегенеративные заболевания, болезни печени, болезни позвоночника, болезни матки, большие депрессивные нарушения, нехронические или хронические воспалительные заболевания пищеварительной системы, диабет и/или потерю волос. Вместо этого, их выбирают из остальных болезней и/или нарушений, представленных в настоящем описании. Аналогично этому в одном из вариантов осуществления настоящего изобретения молекула-конъюгат, которая является транспортером карго-молекулы, не содержит ингибитор JNK, но содержит другие альтернативные представленные в настоящем описании компоненты. В другом варианте осуществления настоящего изобретения представленная в настоящем описании молекула-конъюгат, которая является транспортером карго-молекулы, не содержит SEQ ID NO:1 в качестве компонента (А), но содержит другой компонент (А), например, один из компонентов, приведенных в качестве примера в настоящем описании.

Согласно другому варианту осуществления настоящего изобретения обеспечивающий направленный перенос в WBC полипептид, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, описанные выше, или их варианты или фрагменты, как они определены в настоящем описании, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину можно применять для диагностирования в качестве инструмента диагностики, например, в анализах (in vivo или in vitro), например, в иммуноанализах, для выявления, прогнозирования, диагностирования или мониторинга указанных выше различных состояний, заболеваний и/или нарушений.

Например, иммуноанализ можно осуществлять с помощью метода, предусматривающего приведение в контакт образца, полученного из организма пациента, с предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, как она определена выше, где компонент (Б) и/или любые из компонентов (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, могут обладать направленным воздействием на компонент или соединение, например специфический (для клетки) компонент или соединение, которые находятся в образце. Указанный компонент (Б) или любые из компонентов (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, могут представлять собой, например, антитело к специфическому (для клетки) компоненту или соединению, которые находятся в образце, например, к соединению или компоненту, описанному выше для любого из компонентов (Б), (В), (Г) и/или (Д) и т.д., представленных в настоящем описании. Приведение в контакт образца, как правило, осуществляют в условиях, при которых может происходить иммуноспецифическое связывание, с последующим выявлением или оценкой количества любого характеризующегося иммуноспецифическим связыванием антитела. В конкретном варианте осуществления изобретения антитело, специфическое для конкретного (клеточного) компонента или соединения в образце, например, компонента (Б), (В), (Г) и/или (Д) и т.д., представленного в настоящем описании, можно применять для анализа образца ткани или сыворотки из организма пациента в отношении присутствия указанного компонента (Б), (В), (Г) и/или (Д), представленного выше, или ассоциированного с ним заболевания. Такие болезни могут включать заболевания или нарушения, представленные в настоящем описании. Иммуноанализы, которые можно использовать, включают (но, не ограничиваясь ими) конкурентные или неконкурентные системы анализов, основанные на применении таких методик, как вестерн-блоттинг, радиоиммуноанализы (РИА), твердофазный иммуноферментный анализ (ELISA), «сэндвич»-иммуноанализы, анализы на основе иммунопреципитации, реакции с использованием преципитина, реакции, основанные на диффузии преципитина в геле, анализы иммунодиффузиии, анализы агглютинации, флуоресцентные иммуноанализы, анализы фиксации комплемента, иммунорадиометрические анализы и иммуноанализы на белке А и т.д.

В альтернативном варианте можно осуществлять (in vitro) анализы путем введения предлагаемой в изобретении фармацевтической композиции, вакцины или предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, как они описаны выше, или их вариантов или фрагментов, как они определены в настоящем описании, в клетки-мишени, которые, как правило, выбирают, например, из культивируемых клеток животных, человеческих клеток или микроорганизмов, и оценивая ответ клетки с помощью биофизических методов, как правило, известных специалистам в данной области. Клетки-мишени, которые обычно применяют для этой цели, могут представлять собой культивируемые клетки (in vitro) или клетки in vivo, т.е. клетки, из которых состоят органы или ткани живых животных или людей, или микроорганизмов, присутствующих в живых животных или людях. В этом контексте особенно предпочтительными являются так называемые маркеры или метки, которые могут входить в качестве компонента (Б) или любого из компонентов (В), (Г) и/или (Д) и т.д. в предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, где такие метки могут представлять собой метки, описанные в целом выше для предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

Следующим объектом настоящего изобретения является применение обеспечивающего направленный перенос в WBC полипептида, предлагаемого в настоящем изобретении, для получения молекулы-конъюгата, которая является транспортером представляющей интерес субстанции (карго-молекула), в лейкоциты.

Следующим вариантом осуществления настоящего изобретения является также способ транспортировки представляющей интерес субстанции (карго-молекулы) в лейкоциты, заключающийся в том, что осуществляют следующую стадию:

I) приводят в контакт молекулу-конъюгат, которая является транспортером карго-молекулы, содержащую:

а) в качестве компонента (А): полипептид, содержащий фрагмент аминокислотной последовательности, вариант или вариант такого фрагмента белка ТАТ ВИЧ (SEQ ID NO:1),

б) в качестве компонента (Б): карго-молекулу и

в) необязательно один или несколько дополнительных компонентов, с лейкоцитом.

Указанный способ может представлять собой способ лечения, т.е. при котором осуществляют контакт с организмом пациента, подлежащего лечению. В другом варианте способ может представлять собой способ ex vivo или in vitro. Таким образом, настоящее изобретение согласно дополнительному варианту его осуществления относится также к (выделенному) лейкоциту, содержащему молекулу-конъюгат, которая является транспортером карго-молекулы, где молекула-конъюгат, которая является транспортером карго-молекулы, содержит:

а) в качестве компонента (А): полипептид, содержащий фрагмент аминокислотной последовательности, вариант или вариант такого фрагмента белка ТАТ ВИЧ (SEQ ID NO:1),

б) в качестве компонента (Б): карго-молекулу и

в) необязательно один или несколько дополнительных компонентов.

Настоящее изобретение относится также к лейкоциту, содержащему фрагменты молекулы-конъюгата, которая является транспортером карго-молекулы. Это может иметь место в случае, когда молекула-конъюгат, которая является транспортером карго-молекулы, содержит, например, сайт расщепления протеазами, что приводит к расщеплению исходной молекулы-конъюгата, которая является транспортером карго-молекулы.

И, наконец, последним объектом настоящего изобретения являются также наборы, в частности, состоящие из частей наборы, содержащие в качестве компонентов, индивидуально или в сочетании, обеспечивающий направленный перенос в WBC полипептид или его фрагменты или варианты, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию и/или предлагаемую в изобретении вакцину и необязательно технические инструкции с информацией об особенностях введении и дозах этих компонентов. Указанные наборы, предпочтительно состоящие из частей наборы, можно применять для многих или любой из вышеуказанных целей или вариантов применения. В настоящем изобретении предложено также применение наборов для диагностических или терапевтических целей, в частности для лечения, предупреждения или мониторинга описанных заболеваний или нарушений.

Объем настоящего изобретения не ограничен приведенными конкретными вариантами его осуществления. Так, различные модификации изобретения помимо представленных в настоящем описании, должны стать очевидными специалистам в данной области после ознакомления с приведенным выше описанием и прилагаемыми чертежами. Такие модификации подпадают под объем прилагаемой формулы изобретения.

Различные публикации, процитированные в настоящем описании, включены в него в качестве ссылки по всей их полноте.

Если не указано иное, то все технические и научные понятия, использованные в настоящем описании, имеют обычные значения, известные обычному специалисту в области, к которой относится настоящее изобретение. Хотя для воплощения на практике или оценки настоящего изобретения можно применять методы и материалы, аналогичные или эквивалентные представленным в настоящем описании, ниже дано описание приемлемых методов и материалов. Все публикации, заявки на патент, патенты и другие упомянутые в настоящем описании документы полностью включены в него в качестве ссылок. В случае расхождения следует опираться на настоящее описание, включая определения. Кроме того, материалы, методы и примеры приведены только с целью иллюстрации и не направлены на ограничение объема изобретения. Другие особенности и преимущества изобретения станут очевидными после ознакомления с приведенным подробным описанием и формулой изобретения.

Описание чертежей

На чертежах показано:

на фиг.1 - проиллюстрировано поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (0; 100 нм или 500 нМ) с использованием клеток гепатокарциномы HepG2, клеток рака ободочной кишки линии НСТ-116 и клеток лимфомы линии U937. Применяемая конструкция представляла собой меченный с помощью ФИТЦ D-ТАТ (SEQ ID NO:4). Интернализация меченного с помощью ФИТЦ D-TAT оказалась более высокой в WBC-линии (U937; лимфома), чем в линиях, не относящихся к WBC (HepG2: клетки гепатокарциномы; НСТ-116: клетки рака ободочной кишки);

на фиг.2 - проиллюстрировано поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ транспортеров (1 мкМ) in vitro в течение времени. Использовали три различные клеточные линии (клетки гепатокарциномы HepG2, клетки карциномы легкого линии А549 и клетки-макрофаги линии J77). Применяемая конструкция представляла собой меченный с помощью ФИТЦ D-TAT (SEQ ID NO:4). Интернализация меченного с помощью ФИТЦ D-TAT оказалась более высокой в WBC-линии (клетки-макрофаги J77), чем в линиях, не относящиеся к WBC (HepG2; А549);

на фиг.3 - результаты, полученные при оценке в зависимости от времени интернализации (поглощения) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров в клетки линии HL-60. Применяемая молекула-конъюгат, которая является транспортером карго-молекулы, представляла собой меченный с помощью ФИТЦ DAK (SEQ ID NO:232), меченный с помощью ФИТЦ L-TAT (SEQ ID NO:2), меченный с помощью ФИТЦ r3-L-TAT (SEQ ID NO:15), меченный с помощью ФИТЦ r3-L-TATi (SEQ ID NO:16) и меченный с помощью ФИТЦ D-TAT (SEQ ID NO:4). Клетки линии HL-60 инкубировали в течение 30 мин, 1, 6 или 24 ч с 10 мкМ полученными из ТАТ транспортерами. Затем клетки отмывали дважды в кислом буфере (0,2М глицин, 0.15М NaCl, pH 3,0) и дважды в ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем определяли относительное количество интернализованного пептида путем считывания интенсивности флуоресценции (планшет-ридер типа Fusion Alpha; фирма PerkinElmer) каждого экстракта с последующим вычитанием фонового уровня и стандартизации содержания белка. Установлено, что конструкция транспортера r3-L-TAT обладала столь же высокой способностью к интернализации, что и конструкция транспортера D-TAT;

на фиг.4 - проиллюстрировано поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (10 мкМ, U937, лимфома, 24 ч). Применяемые конструкции представляли собой четыре различные полученные из ТАТ конструкции транспортеров (обозначенные как L-TAT (SEQ ID NO:2), r3-ТАТ (обозначена также как r3-L-Tat) (SEQ ID NO:15), r3-TATi (обозначена также как r3-L-TATi) (SEQ ID NO:16), и D-TAT) (SEQ ID NO:4), каждая из которых состояла из 9 аминокислот, но различалась D-/L-схемой. Кроме того, конструкцию DAK (SEQ ID NO:232) применяли для сравнения и в качестве контрольного образца, содержащего только аминокислоты D, А и K. Как установлено, поглощение конструкций транспортеров r3-ТАТ (SEQ ID NO:15), r3-TATi (SEQ ID NO:16) и D-TAT (SEQ ID NO:4) клетками оказалось наиболее эффективным, в то время как для L-TAT (SEQ ID NO:2) выявлено меньшее поглощение клетками;

На фиг.5 - (А): первичные культуры макрофагов инкубировали с XG-102 (SEQ ID NO:233) и интенсивно промывали. Присутствие XG-102 (SEQ ID NO:233) подтверждали, используя специфическое антитело к XG-102. XG-102 включался в первичные макрофаги в значительных количествах. (Б): Мышам инъецировали i.v. 0,1 мг/кг ФИТЦ-D-TAT (SEQ ID NO:4 плюс ФИТЦ) и животных умерщвляли через 24 ч путем перфузиии PAF через сердце. Готовили срезы после криопротекции с помощью криостата. Иммуноокрашивание с помощью антител к рецептору CD-14 (который присутствует на клеточной поверхности макрофагов и гранулоцитов) продемонстрировало колокализацию меченных с помощью ФИТЦ-D-TAT-клеток и CD-14-позитивных клеток (резидентные макрофаги печени, которые называют клетками Купфера);

на фиг.6 - проиллюстрировано поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ транспортеров (SEQ ID NO:4) 11 различными WBC-линиями (10 мкМ). Во всех протестированных WBC-линиях происходила интернализация D-TAT-ФИТЦ в зависимости от времени;

на фиг.7 - данные о воздействии ТАТ на распределение в ткани. Мышей обрабатывали с использование трех различных путей введения (s.c., i.v., i.p.) радиоактивномеченными с помощью С14 пептидами (1 мг/кг). Животных умерщвляли через 72 ч после инъекции и обрабатывали для осуществления иммунорадиографии. Сагиттальные срезы экспонировали, и было подтверждено, что накопление трех различных меченых D-TAT-пептидов происходит главным образом в печени, селезенке и костном мозге (D-TAT: SEQ ID NO:4; XG-102: SEQ ID NO:233; XG-414: D-TAT, сшитый с ВН3-доменом Bok). Эти данные свидетельствуют о том, что транспортер D-TAT ответствен за распределение в ткани;

на фиг.8 - данные, свидетельствующие о том, что ФИТЦ-D-TAT (SEQ ID NO:4) характеризуется выраженной способность к поглощению клетками Купфера. Мышам инъецировали i.v. 0,1 мг/кг ФИТЦ-D-TAT (SEQ ID NO:4), и через 24 ч их умерщвляли путем перфузии. Изымали печень, подвергали криопротекции и делали срезы с использованием криостата. D-TAT визуализировали непосредственно на основе флуоресценции ФИТЦ и клеточные ядра метили красителем фирмы Hoechst. Гепатоциты представляют собой крупные клетки (89% клеток печени), которые отличаются большим ядром, а нам долю клеток Купфера (резидентные макрофаги печени) приходится примерно 10% клеток, и они представляют собой небольшие и тонкие, удлиненные клетки с маленькими ядрами. На основе морфологических особенностей сделано заключение о том, что ФИТЦ-D-TAT (SEQ ID NO:4) накапливается в основном в клетках Купфера;

на фиг.9 - результаты иммуноокрашивания с использованием антител к XG-102 (SEQ ID NO:233) срезов печени крыс, которым инъецировали 1 мг/кг XG-102 i.v. Животных умерщвляли через 24 ч после инъекции. Обнаружение осуществляли с помощью субстрата DAB. На этом чертеже продемонстрировано также выраженное накопление XG-102 в печени и прежде всего в клетках Купфера;

на фиг.10 - клинические баллы, полученные при обработке с использованием XG-102 (SEQ ID NO:233) IBD (IBD: воспалительное заболевание кишечника) в опытах, в которых для обработки применяли XG-102 в концентрации 1 и 100 мкг/кг SC, ежедневно;

на фиг.11 - дозовая кривая, полученная при обработке с использованием XG-102 (SEQ ID NO:233) IBD, в опытах, в которых для обработки применяли XG-102 в концентрации 0,01, 0,1, 1, 10, 100 и 1000 мкг/кг SC, ежедневно;

на фиг.12 - клинические баллы, полученные при обработке с использованием XG-102 (SEQ ID NO:233) IBD в опытах, в которых для обработки применяли XG-102 (однократная SC-доза) в концентрации 1 и 100 мкг/кг SC в виде однократной дозы в день 0;

на фиг.13 - клинические баллы, полученные при обработке с использованием XG-102 (SEQ ID NO:233) IBD в опытах, в которых для обработки применяли XG-102 (ежедневно, РО) в концентрации 1 и 100 мкг/кг РО в качестве повторной дозы;

на фиг.14 - клинические баллы, полученные при лечении с помощью XG-102 (SEQ ID NO:233) IBD в опытах, в которых для обработки применяли XG-102 (однократная доза, РО) в концентрации 1 и 100 мкг/кг РО в качестве однократной дозы в день 0;

на фиг.15 - результаты, полученные с использованием флуоресцентных полученных из ТАТ транспортеров D-TAT (SEQ ID NO:4)-ФИТЦ или r3-L-TAT (SEQ ID NO:15)-ФИТЦ, при использовании в качестве мишеней различных популяций человеческих лейкоцитов;

A: D-TAT (SEQ ID NO:4)-ФИТЦ. Процентное содержание клеток в соответствующих квадрантах (по ходу часовой клетки, начиная с верхнего левого квадранта):

моноциты (CD14) 9,24; 19,37; 31,71; 39,68;
нейтрофилы (CD15) 17,03; 13,87; 21,53; 47,57;
лимфоциты Т (CD3) 22,7; 11,82; 18,01; 47,46;
лимфоциты В (CD19) 32,40; 2,12; 8,26; 57,22.

Б: r3-L-TAT (SEQ ID NO:15)-ФИТЦ. Процентное содержание клеток в соответствующих квадрантах (по ходу часовой клетки, начиная с верхнего левого квадранта):

моноциты (CD14) 6,34; 16,65; 36,24; 40,77;
нейтрофилы (CD15) 11,74; 13,75; 24,76; 49,75;
лимфоциты Т (CD3) 20,64; 8,96; 20,04; 50,36;
лимфоциты В (CD19) 27,83; 1,76; 8,48; 61,92;

на фиг.16: - таблица, в которой приведены средние значения интенсивности флуоресценции для флуоресцентных полученных из ТАТ транспортеров D-TAT (SEQ ID NO:4)-ФИТЦ или r3-L-TAT (SEQ ID NO:15)-ФИТЦ в каждом типе клеток, представленных на фиг.15 (ФИТЦ-канал);

на фиг.17 - данные о поглощении выбранных конструкций транспортеров, предлагаемых в настоящем изобретении, различными типами клеток. Поглощение стандартизовали относительно D-TAT (SEQ ID NO:4). Raw: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); J77: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); BMDM: макрофаги из костного мозга (мышиные; очищенные первичные лейкоциты). *n=2 независимых эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); **n=2 эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); ***n=1 эксперимент (с дублированием);

на фиг.18 - данные о поглощении выбранных конструкций транспортеров, предлагаемых в настоящем изобретении, различными типами клеток. Поглощение стандартизовали относительно r3-L-TAT (SEQ ID NO:15). Raw: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); J77: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); BMDM: макрофаги из костного мозга (мышиные; очищенные первичные лейкоциты). *n=2 независимых эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); **n=2 эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); ***n=1 эксперимент (с дублированием);

на фиг.19 - результаты иммуногистохимического окрашивания лапы, воспаление которой индуцировали с помощью CFA (4 ч). На верхних панелях представлены результаты, полученные с помощью окрашивания задних лап гематоксилином и эозином (Н&Е). Слева направо: обработанное физиологическим раствором животное, которому не вводили CFA (полный адъювант Фрейнда), обработанное физиологическим раствором животное, которому вводили CFA, и обработанное XG-102 - (SEQ ID NO:233) животное, получавшее также инъекции CFA. После обработки CFA слизистые и эпителиальные слои выглядели из-за отека менее организованными. Присутствие XG-102 - (SEQ ID NO:233)-позитивных клеток выявлено только у животных, обработанных XG-102 (верхняя правая панель). Окрашивание HRP (пероксидаза из хрена) (нижняя панель) продемонстрировало присутствие XG-102 в лейкоцитах, о чем свидетельствовало окрашивание клеток в коричневый цвет, который обнаружен только у обработанных CFA-XG-102 животных (нижняя правая панель). 19А: увеличение: ×20; 19Б: увеличением 40; 19В: увеличение: ×100;

на фиг.20 - данные о локализации XG-102 (SEQ ID NO:233) и определенной популяции лейкоцитов у обработанного CFA (полный адъювант Фрейнда) животного в процессе воспаления. На фиг.20А представлен срез задней лапы обработанного CFA животного, окрашенный тремя различными красителями. На четырех верхних панелях представлен один и тот же отдел при высоком увеличении дистальной области. Показано распределение маркера лейкоцитов (основные гранулоциты, макрофаги и моноциты) cd11b (первый слева) и XG-102 (SEQ ID NO:233, второй слева), а также окраска ядер флуорохромом Dapi (третий слева). На верхней правой панели представлено наложение изображений cd11b- и XG-102-позитивного окрашивания. На нижних панелях (большее увеличение) представлена другая область задней лапы с отеком, и изображение сфокусировано на некоторых отобранных воспалительных клетках (стрелки), в которых инфильтрация лейкоцитов (cd11b-позитивные клетки) хорошо видна (см. левую нижнюю панель). На нижней правой панели представлено наложение изображений cd11b- и XG-102-позитивного окрашивания. На 20Б показано увеличенное изображение нижней правой панели, представленной на фиг.20А;

на фиг.21 - результаты изучения лимфатических узлов - обнаружение XG-102 (SEQ ID NO:233) с использованием обработки пероксидазой. Представлено композитное изображение нескольких областей лимфатического узла (верхние чертежи: увеличение ×10), иллюстрирующее различные структуры и типы клеток. Слева направо: ворота лимфатических эфферентных сосудов, медулярный слой и корковый слой. На двух нижних панелях представлен медуллярный слой (слева) и корковый слой (справа) (увеличение: ×40, полоска соответствует 20 мкм). Срезы, полученные из животных, которым за 24 ч до этого инъецировали физиологический раствор, применяли для определения фонового уровня в присутствии антитела к XG-102 (SEQ ID NO:233). Иммуноокрашивание лимфатических узлов, полученных из крысы, которой предварительно инъецировали XG-102 (SEQ ID NO:233), продемонстрировало присутствие XG-102 (SEQ ID NO:233) в лейкоцитах (резидентные и циркулирующие макрофаги, главным образом, как показано с помощью XG-102, содержащие вакуоли), начиная с 30 мин после инъекции и вплоть до 28 дней. 21А: данные, полученные через 24 ч после инъекции животным физиологического раствора: ×10; полоска соответствует 50 мкм; нижняя панель: ×40; полоска соответствует 20 мкм; 21Б: данные, полученные через 30 мин после инъекции животным XG-102, верхняя панель: ×10; полоска соответствует 50 мкм; нижняя панель: ×40; полоска соответствует 20 мкм; 21В: данные, полученные через 24 ч после инъекции животным XG-102, верхняя панель: ×10; полоска соответствует 50 мкм; нижняя панель: ×40; полоска соответствует 20 мкм; 21Г: данные, полученные через 3 дня после инъекции животным XG-102, верхняя панель: ×10; полоска соответствует 50 мкм; нижняя панель: ×40; полоска соответствует 20 мкм; 21Д: данные, полученные через 7 дней после инъекции животным XG-102, верхняя панель: ×10; полоска соответствует 50 мкм; нижняя панель: ×40; полоска соответствует 20 мкм 21Е: данные, полученные через 14 дней после инъекции животным XG-102, верхняя панель: ×10; полоска соответствует 50 мкм; нижняя панель: ×40; полоска соответствует 20 мкм; 21Ж: данные, полученные через 27 дней после инъекции животным XG-102, верхняя панель: ×10; полоска соответствует 50 мкм; нижняя панель: ×40; полоска соответствует 20 мкм;

на фиг.22: - 22А: данные, свидетельствующие о том, что ФИТЦ-XG-102 (SEQ ID NO:233) локализуется в печени. Представлены три клеточных поля меченных с помощью ФИТЦ-XG-102 клеток, выделенных из печени. Слева направо: меченные с помощью ФИТЦ XG-102, соответствующие окрашиванию ядер с помощью DAPI и наложение обоих изображений. Окрашивание ФИТЦ и распределение в клетках позволяет эффективно отличать клетки Купфера от гепатоцитов, окрашивание которых соответствует лишь фоновому уровню. Как правило, по форме и ядру клетки Купфера можно отличить от гепатоцитов. Мелкие и треугольные клетки Купфера отличаются от больших гексагональных хорошо организованных гепатоцитов, ×63; полоска соответствует 20 мкм;

22Б: - данные, свидетельствующие о том, что ФИТЦ-D-TAT (SEQ ID NO:4) локализуется в печени. Представлены два клеточных поля меченных с помощью ФИТЦ-D-TAT клеток, выделенных из печени. Слева направо: меченные с помощью ФИТЦ XG-102, соответствующие окрашиванию ядер с помощью DAPI и наложение обоих изображений. Окрашивание ФИТЦ и распределение в клетках позволяет эффективно отличать клетки Купфера от гепатоцитов, окрашивание которых соответствует лишь фоновому уровню. Как правило, по форме и ядру клетки Купфера можно отличить от гепатоцитов. Мелкие и треугольные клетки Купфера отличаются от больших гексагональных хорошо организованных гепатоцитов, ×63; полоска соответствует 20 мкм;

на фиг.23: 23А - данные, свидетельствующие о том, что ФИТЦ-XG-102 (SEQ ID NO:233) локализуется в лимфатических узлах. Представлено клеточное поле меченных с помощью ФИТЦ-XG-102 клеток, выделенных из лимфатических узлов. Верхняя панель слева направо: композитное изображение на основе одного клеточного поля, окрашенного ФИТЦ-XG-102 (слева), окрашенного Dapi для ядер (в середине) и соответствующее наложение изображений (справа). На нижних панелях проиллюстрирован увеличенный клеточный кластер каждого изображения. Флуоресценция ФИТЦ хорошо выделяет цитоплазму ФИТЦ-позитивных клеток, которые анатомически выявлены как макрофаги подкапсульного синуса и конститутивно мигрирующие альвеолярные макрофаги. Отсутствие окрашивания ФИТЦ в лимфоидных фолликулах позволяет отличать медуллярный слой и область коркового слоя. Медуллярная зона, в которую, вероятно, включен ФИТЦ-XG-102, состоит в основном из макрофагов. ×10; полоска соответствует 50 мкм;

23Б: - данные, свидетельствующие о том, что ФИТЦ-D-TAT (SEQ ID NO:4) локализуется в лимфатических узлах. Представлено клеточное поле меченных с помощью ФИТЦ-D-TAT клеток, выделенных из лимфатических узлов. Верхняя панель слева направо: композитное изображение на основе одного клеточного поля, окрашенного ФИТЦ-D-TAT (слева), окрашенного Dapi для ядер (в середине) и соответствующее наложение изображений (справа). На нижних панелях проиллюстрирован увеличенный клеточный кластер каждого изображения. Флуоресценция ФИТЦ хорошо выделяет цитоплазму ФИТЦ-позитивных клеток, которые анатомически выявлены как макрофаги подкапсульного синуса и конститутивно мигрирующие альвеолярные макрофаги. Отсутствие окрашивания ФИТЦ в лимфоидных фолликулах позволяет отличать медуллярный слой и область коркового слоя. Медуллярная зона, в которую, вероятно, включен ФИТЦ-D-TAT, состоит в основном из макрофагов, ×10; полоска соответствует 50 мкм.

Примеры

Пример 1: Получение слитых белков, содержащих ингибитор JNK.

Слитые белки, содержащие ингибитор JNK, последовательность которых представлена в SEQ ID NO:234 (L-TAT-IB1 (s), синтезировали путем ковалентного связывания С-конца SEQ ID NO:121 с N-концом состоящего из 10 аминокислот пептида-носителя, выведенного из HIV-TAT4g 57 (Vives и др., J Biol. Chem. 272, 1997, с.16010), последовательность которого представлена в SEQ ID NO:3, через линкер, состоящий из двух остатков пролина. Этот линкер применяли в связи с тем, что он обеспечивает максимальную гибкость и предупреждает нежелательные изменения вторичной структуры. Получали также основные конструкции, которые обозначали как L-IB1 (s) (SEQ ID NO:121) и L-TAT (SEQ ID NO:3) соответственно.

Полностью-D-ретро-инвертированные пептиды, представленные в SEQ ID NO:233, синтезировали аналогичным образом. Получали также основные конструкции, которые обозначали как D-IB1 (s) (SEQ ID NO:122) и D-ТАТ (SEQ ID NO:5) соответственно.

Соответственно все D- и L-слитые пептиды получали путем классического Fmock-синтеза и дополнительно анализировали с помощью масс-спектрометрии. Их окончательно очищали с помощью ЖХВР. Для выяснения действия пролинового линкера получали два типа ТАТ-пептидов, один, дополненный двумя остатками пролина, а второй без них. Добавление двух остатков пролина не приводило к заметной модификации проникновения или локализации ТАТ-пептида внутри клеток.

Пример 2: Синтез полностью-D-ретро-инвертированных пептидов IB (s) и их вариантов

Пептиды, предлагаемые в изобретении, могут представлять собой пептиды, состоящие полностью из D-аминокислот, которые подвергали обращенному синтезу для предупреждения естественного протеолиза (т.е. полностью-D-ретро-инвертированные пептиды). Полностью-D-ретро-инвертированный пептид, предлагаемый в изобретении, представляет собой пептид с аналогичными нативному пептиду функциями, в котором боковые группы входящих в его состав аминокислот должны соответствовать по линеаризованной структуре нативному пептиду, но сохранять устойчивый к протеазам каркас.

Ретро-инвертированные пептиды, предлагаемые в изобретении, синтезировали аналогично с помощью D-аминокислот путем присоединения аминокислот в пептидной цепи таким образом, чтобы последовательность аминокислот в ретро-инвертированном пептидном аналоге была точно противоположна последовательности выбранного пептида, который служил в качестве модели. Например, если встречающийся в естественных условиях белок ТАТ (состоящий из L-аминокислот) имеет последовательность GRKKRRQRRR (SEQ ID NO:3), то ретро-инвертированный пепидный аналог этого пептида (состоящий из D-аминокислот) должен иметь последовательность RRRQRRKKRG (SEQ ID NO:5). Процедуры синтеза цепи D-аминокислот для получения ретро-инвертированных пептидов известны в данной области (см., например, Jameson и др., Nature, 368, 1994, cc.744-746; Brady и др., Nature, 368, 1994, cc.692-693; Guichard и др., J. Med. Chem. 39, 1996, cc.2030-2039). В частности, ретро-пептиды получали с помощью классического F-mock-синтеза и затем анализировали с помощью масс-спектрометриии. Их окончательно очищали с помощью ЖХВР.

Поскольку особенностью нативных пептидов является их чувствительность к расщеплению встречающимися в естественных условиях протеазами и им свойственна иммуногенность, то гетеробивалентые или гетеромультивалентые соединения, предлагаемые в настоящем изобретении, следует получать таким образом, чтобы они представляли собой «ретро-инвертированный изомер» требуемого пептида. Таким образом, защита пептида от естественного протеолиза должна повышать эффективность конкретного гетеробивалентного или гетеромультивалентного соединения как в результате удлинения времени полужизни, так и снижения уровня иммунного ответа, направленного на активное разрушение пептидов.

Пример 3: Продолжительная биологическая активность полностью-D-ретро-инвертированных пептидов IB (s) и их вариантов

Для D-TAT-IB1 (s) (XG-102; dqsrpvqpflnlttprkprpprrrqrrkkrg; SEQ ID NO:233), содержащего ретро-инвертированный пептид гетероконъюгата (см. выше химерную последовательность) предсказана продолжительная биологическая активность по сравнению с нативным L-аминокислотным аналогом, что обусловлено защитой пептида D-TAT-IB (s) от расщепления нативными протеазами.

Анализировали ингибирование пептидом D-TAT-IB1 (s) индуцируемой IL-1β гибели панкреатических бета-клеток. Клетки линии ТС-3 инкубировали в течение 30 мин с однократным добавлением указанного пептида (1 мкМ), после чего добавляли IL-1 (10 нг/мл).

Затем после инкубации в течение 2 дней с IL-1β подсчитывали количество клеток, находящихся на стадии апоптоза, с помощью окрашивания ядер йодидом пропидия и красителем Hoechst 33342. В каждом эксперименте осуществляли подсчет как минимум 1000 клеток. Установлено, что пептид D-TAT-IB1 снижал индуцированный IL-1 апоптоз в такой же степени, что и пептиды L-TAT-IB.

Анализировали также продолжительность ингибирования индуцируемой IL-1β гибели клеток с помощью пептида D-TAT-IB1. Клетки линии ТС-3 инкубировали в течение 30 мин с однократным добавлением указанных пептидов (1 мкМ), после чего добавляли IL-1β (10 нг/мл), а затем добавляли цитокин через каждые два дня. Затем после инкубации в течение 15 дней с IL-1 подсчитывали количество клеток, находящихся на стадии апоптоза, с помощью окрашивания ядер йодидом пропидия и красителем Hoechst 33342. Следует отметить, что однократное добавление пептида TAT-IB1 не обеспечивало продолжительную защиту. В каждом эксперименте осуществляли подсчет как минимум 1000 клеток. В результате установлено, что D-TAT-IB1 (s), в отличие от L-TAT-IB1 (s), обладал способностью обеспечивать продолжительную защиту (в течение 15 дней).

Пример 4: Оценка терапевтической активности пептидов D- и L-TAT-IB1 (s), применяемых согласно настоящему изобретению

а) Тест-система:

(I) Вид/штамм: Мыши/BALB/c.

(II) Источник: фирма Harlan Israel, Ltd.

(III) Пол: Самки.

(IV) Общее количество животных: n=150.

(V) Возраст: Молодые взрослые животные, имевшие возраст 7 недель в начале опыта

(VI) Вес тела: Вариации веса тела животных в момент обработки начальными дозами не превышали ±20% от среднего веса.

(VII) Состояние здоровья животных: Состояние здоровья животных, которых применяли в этом опыте, оценивали по прибытии; только животных, которые имели хорошее состояние здоровья, акклиматизировали в лабораторных условиях (по меньшей мере 7 дней) и применяли в опыте.

(VIII) Рандомизация: Животных произвольно разделяли на экспериментальные группы согласно таблице произвольно данных номеров.

(IX) Окончание опыта: В конце опыта выживших животных умерщвляли путем цервикальной дислокации. б) Состав подопытных групп и уровни доз Ниже в таблице представлены экспериментальные группы, на которых проводили опыт.

Группа № Размер группы Тестируемая субстанция Путь Доза Объем (мл/кг) Схема введения
1F N=10 Наполнитель РО 0 5 Один раз в день в течение 7 дней
2F N=10 Сульфасалазин РО 10 мг/кг 5 Один раз в день в течение 7 дней
3F N=10 Ремикейд IP 5 мг/кг 5 Один раз в день в течение 7 дней
4F N=10 XG-102 SC 0,01 мкг/кг 5 Один раз в день в течение 7 дней
5F N=10 XG-102 SC 0,1 мкг/кг 5 Один раз в день в течение 7 дней
6F N=10 XG-102 SC 1 мкг/кг 5 Один раз в день в течение 7 дней
7F N=10 XG-102 SC 10 мкг/кг 5 Один раз в день в течение 7 дней
8F N=10 XG-102 SC 100 мкг/кг 5 Один раз в день в течение 7 дней
9F N=10 XG-102 SC 1000 мкг/кг 5 Один раз в день в течение 7 дней
10F N=10 XG-102 SC 1 мкг/кг 5 Однократная доза
11F N=10 XG-102 SC 100 мкг/кг 5 Однократная доза
12F N=10 XG-102 РО 1 мкг/кг 5 Один раз в день в течение 7 дней
13F N=10 XG-102 РО 100 мкг/кг 5 Один раз в день в течение 7 дней
14F N=10 XG-102 РО 1 мкг/кг 5 Однократная доза
15F N=10 XG-102 РО 100 мкг/кг 5 Однократная доза
XG-102=SEQ ID NO:233
IP = внутрибрюшинное введение
РО = пероральное введение
SC = подкожное введение

в) Процедуры тестирования

Колит индуцировали путем введения TNBS (тринитробензолсульфоновая кислота), растворенной в 50% этанола.

Затем всех животных обрабатывали дозами XG-102, составляющими от 0,1 до 1000 мкг/кг, либо внутрибрюшино, либо подкожно в виде однократных или повторных доз (см. выше).

г) Обследование и оценка

I) Клинические признаки

В течение описанного выше эксперимента осуществляли тщательные клинические оценки и регистрировали их. Обследование включало определение изменения внешних признаков, например, состояния кожи, шерсти, глаз, слизистых мембран, появление секреции и экскреции (например, диареи) и вегетативной активности. Отмечали также изменения походки, позы и ответ на уход, а также наличие аномального поведения, тремора, конвульсий, состояния сна и комы.

II) Вес тела

Определение веса тела индивидуальных животных осуществляли ежедневно.

III) Клиническая оценка колита

Все параметры, такие как вес тела, консистенция экскрементов и кровотечение из прямой кишки регистрировали ежедневно, и они служили в качестве параметров для балльной оценки серьезности болезни:

Балл Потеря веса (%) Консистенция экскрементов Наличие кровотечения из прямой кишки
0 нет нормальная нет
1 1-5 покраснение, отек ануса нет
2 5-10 неоформленные экскременты нет
3 10-15 диарея нет
4 >15 диарея кровотечение
5 смерть

IV) Макроскопическая патология ободочной кишки

В последний день эксперимента животных умерщвляли и изымали ободочную кишку для оценки макроскопической патологии согласно следующей балльной системе:

Степень Показатели
0 отсутствие выявляемых аномалий
1 отек и покраснение в одной области
2 отек и покраснение в более чем одной области или очень сильный отек и покраснение, захватывающие более 50% ободочной кишки
3 одна язва
4 более одной язвы или очень длинная серьезная язва

д) Результаты

I) Клинические признаки

Не обнаружено аномалий при оценке клинических симптомов после обработки с помощью XG-102 (SEQ ID NO:233).

II) Коэффициент смертности Не обнаружено смертности.

III) Вес тела

TNBS индуцировала существенное снижение веса в день 1. Введение XG-102 (SEQ ID NO:233) либо предупреждало снижение веса, либо облегчало симптомы и способствовало восстановлению.

IV) Клинический балл

У обработанных наполнителем животных, которым вводили путем инъекции TNBS, максимальный балл достигался в день 1 опыта и полное восстановление происходило только в день 5 или позднее. Обработка сульфасалазином приводила к уменьшению клинического балла. XG-102 (SEQ ID NO:233) при использовании в любой дозе, с помощью любого пути введения или временной схемы, как указано выше (однократная доза или суточные дозы) обладал действием, эквивалентным или превышающим действие общепринятого применяемого в качестве эталона лекарственного средства сульфасалазина.

V) Балл макроскопической патологии

Макроскопический анализ, проведенный в конце опыта продемонстрировал наличие у обработанных наполнителем животных, которым инъецировали TNBS, повреждений, сопровождающихся отеком и язвами вдоль ободочной кишки. Сульфасалазин обладал эффективностью, полностью снижая макроскопическую патологию.

VI) Длина ободочной кишки

Не обнаружено воздействия болезни или обработки на длину ободочной кишки.

VII) Масса ободочной кишки

Не обнаружено воздействия болезни или обработки на массу ободочной кишки.

е) Заключение

В свете указанных выше результатов, полученных в условиях вышеописанного эксперимента, и в сочетании с данными о прижизненных показателях, очевидно, что приведенная в качестве примера последовательность XG-102, представленная в SEQ ID NO:233, при ее введении либо SC, либо РО, обладала активностью в отношении ускорения выздоровления.

Пример 5: Определение активности полностью-D ретро-инвертированных пептидов IB (s) и их вариантов в отношении лечения хронического обструктивного заболевания легких (COPD)

Для оценки активности использованного в качестве примера полностью-D ретро-инвертированного пептида IB (s) XG-102 (SEQ ID NO:233) в отношении лечения хронического обструктивного заболевания легких (COPD) применяли XG-102 (SEQ ID NO:233) на животной модели индуцированного блеомицином острого воспаления легких и фиброза. Протокол индуцированного блеомицином воспаления и фиброза ранее был описан в литературе. Задача эксперимента заключалась в изучении воздействия XG-102 (SEQ ID NO:233) при подкожном пути (s.c.) введения на рекрутмент нейтрофилов в бронхоальвеолярном лаваже (BAL) и легком при индуцированном блеомицином воспалении и фиброзе:

- в день 1 после однократного введения блеомицина (10 мг/кг);

- и в день 10 при развитом фиброзе.

1) Метод и экспериментальный подход

Тестируемое соединение XG-102 (SEQ ID NO:233) в двух дозах и наполнитель в качестве контроля вводили s.c. в сочетании с однократным интраназальным введением блеомицина и осуществляли анализ мышей через 1 и 10 дней. Применяемые для создания модели животные представляли собой мышей линии C57BL/6 (8-недельного возраста), по 10 особей на группу. Экспериментальные группы представляли собой группы, которые обрабатывали наполнителем, 0,001 мг/кг XG-102 (SEQ ID NO:233) и 0,1 мг/кг XG-102 (SEQ ID NO:233), обработка заключалась в повторном подкожном введении XG-102 (SEQ ID NO:233) до введения блеомицина и затем каждые 3 дня. Через 24 ч осуществляли мониторинг острого воспаления легких с помощью BAL-лаважа, цитологического обследования, определения количества клеток и определения активности легочной миелопероксидазы. Воздействие соединения сравнивали с воздействием применяемого в качестве контроля наполнителя. Фиброз легкого оценивали гистологически с использованием окрашивания гематоксилином и эозином в день 10 после введения однократной дозы блеомицина.

1.1) Введение блеомицина

Блеомицина сульфат в физиологическом растворе (10 мг/кг веса тела) фирмы Bellon Laboratories (Монруж, Франция) или физиологический раствор вводили в дыхательные пути путем назальной инстилляции в объеме 40 мкл под слабой анестезией кетамином-ксилазином. Группы, обработанные блеомицином с целью индукции блеомицином как воспаления, так и фиброза, включали: группы, которые обрабатывали наполнителем, 0,001 мг/кг XG-102 (SEQ ID NO:233) и 0,1 мг/кг XG-102 (SEQ ID NO:233). Для индукции блеомицином воспаления использовали подкожный (s.c.) путь, и введение предусматривало применение однократной дозы. Для индукции блеомицином фиброза использовали подкожный (s.c.) путь, и введение предусматривало трехкратную обработку в течение 10 дней.

1.2) Жидкость бронхоальвеолярного лаважа (промывная бронхоальвеолярная жидкость) (BALF)

После рассечения трахеи встраивали пластиковую канюлю и промывали воздушное пространство, используя 0,3 мл раствора ЗФР, нагретого до 37°С. Собранные образцы разделяли на 2 фракции: первую (1 мл, что соответствует двум первым лаважам) применяли для оценки медиатора, а вторую для определения клеток (4 мл). Первую фракцию центрифугировали (600×g в течение 10 мин) и супернатант фракционировали и выдерживали при -80°С до определения медиатора. Затем клеточный дебрис ресуспендировали в 0,4 мл стерильного 0,9% NaCl и объединяли со второй фракцией, и применяли для подсчета клеток.

1.3) Гомогенизация легкого

После получения BAL все легкое изымали и помещали внутрь микротрубки (лизирующий матрикс D, фирма Q Bio Gene, Иллкирх, Франция) с 1 мл ЗФР, получали экстракт всей легочной ткани с помощью системы Fastprep® (FP120, фирма Q Bio Gene, Иллкирх, Франция), затем экстракт центрифугировали и супернатант хранили при -80°С до определения медиатора и анализа коллагена на основе анализа коллагена с помощью Sircol (краситель конго красный 80) (фирма France Biochem Division, Франция).

1.4) Подсчет и определение клеток

Общее количество клеток определяли в BAL-жидкости с помощью гемоцитометра Malassez. Дифференциальный подсчет клеток осуществляли на цитоспиновых препаратах (цитоспин 3, фирма Thermo Shandon) после окрашивания с помощью MGG Diff-quick (фирма Dade Behring AG). Дифференциальный подсчет клеток проводили для 200 клеток на основе стандартных морфологических критериев.

1.5) Оценка TNF

Уровень TNF в BALF определяли с помощью наборов для ELISA (Mouse DuoSet, фирма R&D system, Миннеаполис, США), используя инструкции производителя. Результаты представлены в пг/мл.

1.6) Оценка миелопероксидазы (МРО)

Уровни МРО оценивали после введения XG-102. В этом эксперименте обработка блеомицином приводила к несущественной индукции МРО. Кроме того, XG-102 не оказывал влияния на уровни МРО в легком.

1.7) Гистология

После осуществления BAL и перфузии легкого большую долю фиксировали в 4% забуференного формальдегида для стандартного микроскопического анализа. 3-микрометровые срезы окрашивали гематоксилином и эозином (Н&Е).

2.) Результаты

А) Первый опыт: Индуцированное блеомицином (BLM) острое воспаление легких

Группы: наполнитель, XG-102 (SEQ ID NO:233) в дозе 0,001 мг/кг и XG-102 (SEQ ID NO:233) в дозе 0,1 мг/кг.

Путь: s.с. - путь, однократная доза

а) Рекрутмент клеток в бронхоальвеолярном пространстве, подвергаемом лаважу

При применении в дозе 0,1 мг/кг XG-102 (SEQ ID NO:233) снижал в значительной степени рекрутмент нейтрофилов и общее количество клеток, участвующих в рекрутменте на воспалительной стадии. При применении в дозе 0,001 мг/кг XG-102 (SEQ ID NO:233) не оказывал воздействия на рекрутмент нейтрофилов или других типов клеток в бронхоальвеолярном пространстве (один репрезентативный эксперимент, n=5 мышей на группу; *, р<0,05; **, р<0,001).

б) Рекрутмент клеток в легком, оцененный на основе МРО, при гомогенизации легкого

Миелопероксидазы (МРО) играют важную роль в защитных системах хозяина. Этот белок массой 140 кДа, состоящей из двух тяжелых цепей массой 53 кДА и двух легких цепей массой 15 кДа, впервые описан в 1960-х годах. Высвобождение МРО из гранул нейтрофилов и моноцитов в ответ на активацию лейкоцитов позволяет осуществлять превращение перекиси водорода и хлоридных ионов в хлорноватистую кислоту (HOCl), которая представляет собой сильный окислитель. Хотя МРО выполняет важную роль в защитной системе, в различных исследованиях установлено, что МРО принимает также участие в некоторых воспалительных состояниях, при этом повышенные уровни МРО, например, связаны с болезнями коронарных артерий. Кроме того, уровни МРО в тканях отражают состояние активации нейтрофилов и являются показателем инфильтрации ткани нейтрофилами.

В настоящем эксперименте установлено, что введение блеомицина не приводило к существенной индукции уровня МРО. XG-102 (SEQ ID NO:233) не оказывал воздействия на уровни МРО в легком.

в) Оценка TNF

При оценке уровней TNF обнаружена тенденция к снижению уровня TNF в BALF после введения XG-102 (SEQ ID NO:233), хотя уровни TNF были очень низкими после введения BLM.

г) Заключение

Установлено, что при применении в дозе 0,1 мг/кг XG-102 (SEQ ID NO:233) снижал количество нейтрофилов и общий рекрутмент клеток в бронхоальвеолярном пространстве и обладал тенденцией к снижению уровня TNF. Кроме того, исследование гистологических срезов продемонстрировало уменьшение накопления воспалительных клеток в перибронхиальном пространстве. Таким образом, можно сделать заключение о том, что XG-102 (SEQ ID NO:233) снижает индуцированное блеомицином воспаление.

С учетом полученных результатов осуществляли дополнительный эксперимент на модели фиброза.

Б) Второй опыт: Индуцированный блеомицином (BLM) фиброз легкого

Группы: наполнитель, XG-102 (SEQ ID NO:233) в дозе 0,001 мг/кг и XG-102 (SEQ ID NO:233) в дозе 0,1 мг/кг.

Путь: s.c. - путь, 3 раза в течение 10 дней

а) Рекрутмент клеток в бронхоальвеолярном пространстве, подвергаемом лаважу

При применении в дозе 0,001 мг/кг XG-102 (SEQ ID NO:233) снижал в значительной степени рекрутмент лейкоцитов и общее количество клеток, участвующих в рекрутменте на воспалительной стадии, отличающейся в этом случае рекрутментом лимфоцитов. При применении в дозе 0,1 мг/кг, XG-102 (SEQ ID NO:233) не обладал эффективностью (n=5 мышей на группу; *, р<0,05; **, р<0,001).

б) Гистология

Срезы легких толщиной 3 мкм окрашивали гематоксилином и эозином. Через 10 дней после введения BLM было обнаружено накопление воспалительных клеток, наличие пораженных фиброзом областей, потеря архитектуры легкого. После введения XG-102 в низкой дозе (0,001 мг/кг), но не в высокой дозе (0,1 мг/кг), было обнаружено уменьшение этих параметров.

в) Заключение:

Удалось установить, что XG-102 (SEQ ID NO:233) при 3-кратном введении в низкой дозе, составлявшей 0,001 мг/кг, снижал более позднее воспаление, индуцированное блеомицином, в частности рекрутмент лимфоцитов, обнаруженный на этой стадии. Кроме того, изучаемая субстанция при ее 3-кратном введении в указанной дозе ослабляла индуцированный блеомицином фиброз. В этом случае обнаружено наличие меньших по размеру пораженных фиброзом областей и более консервативная структура легкого.

Пример 6: Определение активности полностью-D ретро-инвертированных пептидов IB (s) и их вариантов при лечении болезни Альцгеймера

Для определения активности репрезентативного полностью-D ретро-инвертированного пептида IB (s) XG-102 (SEQ ID NO:233) в отношении болезни Альцгеймера осуществляли изучение XG-102 (SEQ ID NO:233), используя в качестве модели трансгенных мышей линии hAPP, которые отличались сверхэкспрессией АРР751 с мутациями типа London и Swedish, с использованием поведенческого теста с использованием водного лабиринта Морриса, а также иммуногистохимических тестов, позволяющих оценивать загрузку бляшками, и ELISA-тестов, позволяющих оценивать уровни β-амилоида1-40 и β-амилоида1-42 в головном мозге мышей.

а) Методы

I) Введение

Опыт был спланирован для оценки эффективности тестируемой субстанции (XG-102, SEQ ID NO:233) в отношении поведенческих, биохимических и гистологических маркеров, его проводили на самках трансгенных (Tg) мышей линии hAPP возрастом 5 месяцев (±2 недели). Для этой цели мышей обрабатывали каждые 2-3 недели в течение периода времени, составлявшего вплоть до 4 месяцев, и в конце периода обработки оценивали поведение с помощью водного лабиринта Морриса. После умерщвления брали образцы головного мозга, СМЖ и крови. Уровни Aβ40 и Aβ42 определяли в четырех различных фракциях гомогената головного мозга, а также в СМЖ Tg-мышей. Загрузку бляшками оценивали количественно в корковом слое и гиппокампе восьми Tg-животных на каждую группу обработки.

II) Животные

Самок Tg-мышей, имеющих генетический фон C57BL/6xDBA, возрастом 5 месяцев (±2 недели) произвольно разделяли на группы обработки 1-3 (n=12). Животным, начиная с 5-месячного возраста и в течение периода времени, составлявшего вплоть до 4 месяцев, вводили наполнитель или XG-102 (SEQ ID NO:233) в двух различных концентрациях с помощью подкожных (s.c.) инъекций каждую вторую или третью неделю. Все животные, которых использовали для настоящего опыта, имели темные глаза и хорошо воспринимали ориентиры вне MWM-бассейна. Однако животных исключали из опыта при обнаружении, что они обладают плохой способностью видеть, что контролировали перед началом обработки путем обучения всех животных, включая резервных особей, включенных в опыт, на видимой платформе, с помощью так называемого предварительного теста. В случае подтверждения обнаруженного у конкретного животного недостатка, мышь исключали из опыта.

III) Идентификация животных и их содержание

Мышам присваивали индивидуальные идентификационные номера с помощью ушных маркеров. Их содержали в отдельных вентилируемых клетках (IVC) на стандартизованной подстилке для грызунов с добавлением Rettenmaier®. В каждую клетку помещали максимум 5 мышей. Мышей содержали согласно стандартным процедурам обращения с животными JSW (Standard Operating Procedures) (SOP GEN011), основанных на международных стандартах. Каждую клетку отмечали цветной карточкой, на которой был указан номер опыта, пол, индивидуальные регистрационные номера (IRN) животных, дата рождения, а также дата скрининга и принадлежность к конкретной группе обработки. Температуру во время опыта поддерживали на уровне примерно 24°С, а относительную влажность поддерживали на уровне примерно 40-70%. Животных содержали при постоянном световом цикле (12 ч свет/темнота). Животные имели свободный доступ к обычной водопроводной воде.

IV) Обработка

Сорок самок трансгенных мышей линии ПАРР обрабатывали либо 0,1 мг/кг веса тела/каждые две недели, либо 10 мг/кг веса тела/каждые три недели тестируемой субстанцией XG-102 (SEQ ID NO:233) в двух различных дозах (n=12/группу), либо наполнителем (n=12) s.c. один раз каждые три недели в течение четырех месяцев.

V) Водный лабиринт Морриса (MWM)

Тест с использованием водного лабиринта Морриса (MWM) проводили в черном округлом бассейне диаметром 100 см. Его заполняли водопроводной водой с температурой 22±1°С и бассейн фактически разделяли на четыре сектора. Прозрачную платформу (диаметром 8 см) помещали примерно на 0,5 см ниже поверхности воды. Во время всего периода испытания за исключением предварительного тестирования платформа находилась в юго-западном квадранте бассейна. За один день до периода обучения продолжительностью 4 дня животных подвергали так называемому «предварительному тестированию (тесту)» с использованием платформы (два опыта продолжительностью по 60 с) для гарантии того, что каждое животное обладало нормальным зрением. В MWM-тест включали только животных, полностью справившихся с таким заданием. При решении задания, связанного с использованием MWM, каждую мышь подвергали трем испытаниям в течение четырех последовательных дней. Одно испытание продолжалось максимум 1 мин. В это время мышь имела возможность найти укрытие, прозрачную мишень. Если животное не могло найти «путь» вне воды, исследователь направлял мышь к платформе или помещал ее на платформу. После каждого испытания мыши давали отдыхать на платформе в течение 10-15 с. За это время мыши имели возможность сориентироваться в окружающей среде. Исследователи находились в условиях пониженной освещенности для предотвращения отрицательного воздействия на систему отслеживания маршрута (Kaminski; PCS, фирма Biomedical Research Systems). На окружающих бассейн стенках фиксировали плакаты с геометрическими символами, выполненными черным жирным цветом (например, круг или квадрат), которые мыши могли использовать в качестве ориентиров при ориентации. Одна плавающая группа, применяемая в одном испытании, состояла из 5-6 мышей, поэтому был гарантирован промежуток времени между испытаниями, составляющий примерно 5-10 мин. Для количественной оценки латентности избегания (время [с], необходимое мыши для того, чтобы найти укрытие на платформе и, следовательно, избежать попадания в воду), пути (длина траектории [в метрах] для достижения мишени) и пребывания в требуемом квадранте использовали компьютеризованную систему отслеживания пути. Компьютер соединяли с видеокамерой, помещенной над центром бассейна. Камера обнаруживала сигнал светоиспускающего диода (LED), который фиксировали с помощью небольшого зажима для волос на хвосте мыши. Через 1 ч после последнего испытания в день 4 мышей подергали так называемому пробному испытанию. В этот момент платформу удаляли из бассейна и в течение 1 мин осуществляли пробное испытание; экспериментатор подсчитывал количество пересечений предыдущего положения мишени. Кроме того, подсчитывали пребывание в этом квадранте, а также в трех других квадрантах. Во время этого испытания мышь не могла получать никакой сколько-нибудь естественной информации («ключа») от платформы.

VI) Получение образцов тканей

В конце периода обработки и после проведения всех поведенческих опытов всех оставшихся мышей (n=28) умерщвляли. Для этого на всех мышей воздействовали седативным средством посредством стандартной ингаляционной анестезии (изофлуран, фирма Baxter) согласно методу, описанному в SOP МЕТОЗО. Спинномозговую жидкость (СМЖ) получали путем отслаивания (тупого отделения) и обнажения большого затылочного отверстия (foramen magnum). После обнажения вносили пастеровскую пипетку на глубину примерно 0,3-1 мм в больше затылочное отверстие. СМЖ собирали отсасыванием и посредством капиллярного действия до полного прекращения потока. По две аликвоты каждого образца немедленно замораживали и выдерживали при -80°С до проведения дополнительного анализа с помощью метода ELISA. После получения образцов СМЖ каждую мышь помещали в лежачее положение на спину, вскрывали грудной отдел и вносили иглу 26-размера, присоединенную к шприцу вместимость 1 см3, в камеру правого желудочка сердца. Осуществляли слабый отсос через иглу и собирали кровь в ЭДТК и затем использовали для получения плазмы. Для получения плазмы образцы крови каждой мыши центрифугировали при 1750 об/мин (700×g) в течение 10 мин в центрифуге (GS - 6R, фирма Beckman), используя ротор для качающихся корзин (GH - 3.8, фирма Beckman). Плазму замораживали при -20°С и хранили до осуществления дальнейшего анализа. После отбора образцов крови осуществляли внутрисердечную перфузию трансгенных мышей 0,9% хлорида натрия. Головной мозг быстро изымали и отрезали мозжечок. Правое полушарие мозга всех мышей подвергали иммерсионной фиксации в свежеприготовленной смеси 4% параформальдегида/ЗФР (рН 7,4) в течение 1 ч при комнатной температуре. Затем головной мозг переносили в раствор ЗФР, содержащий 15% сахарозы, на 24 ч для гарантии криопротекции. На следующий день головной мозг замораживали в изопентане и хранили при -80°С до применения в гистологических исследованиях (SOP MET042). Левое полушарие взвешивали и замораживали в жидком азоте и хранили при -80°С до биохимического анализа.

VII) Определение уровней Aβ1-40 и Aβ1-42

В четырех различных фракциях гомогенатов головного мозга каждой Tg-мыши, а также в образцах СМЖ, оценивали уровни Aβ1-40 и Aβ1-42 с помощью метода ELISA. Тест-наборы ELISA с высокой чувствительностью к Aβ1-40 и Aβ1-42 покупали у фирмы The Genetics Company™, Швейцария (SOP MET058). СМЖ получали согласно описанному выше методу. Для получения гомогенатов головного мозга замороженные полушария гомогенизировали в забуференном ТРИС физиологическом растворе ((TBS) - буфер) (5 мл), содержащем коктейль ингибиторов протеаз. 1,25 мл этого первичного полученного в TBS гомогената головного мозга хранили при -80°С, 1,25 мл подвергали дополнительному изучению. Оставшийся гомогенат головного мозга (2,5 мл) центрифугировали и образовавшийся супернатант (= TBS-фракция) разделяли на аликвоты и выдерживали при -20°С для исследования с помощью ELISA. Дебрис суспендировали в Тритон Х-100 (2,5 мл), центрифугировали и супернатант (= Тритон Х-100-фракция) разделяли на аликвоты и выдерживали при -20°С. Эти стадии повторяли с использованием ДСН (2,5 мл). Дебрис ДСН-фракции суспендировали в 70% муравьиной кислоты (0,5 мл) для осуществления последующего центрифугирования. Полученный супернатант нейтрализовали с помощью 1М ТРИС (9,5 мл), разделяли на аликвоты и выдерживали при -20°С (= FA-фракция (фракция муравьиной кислоты). Образцы четырех фракций гомогенатов головного мозга (TBS, Тритон Х-100, ДСН и FA) применяли для определения уровней Aβ1-40 и Aβ1-42 с помощью метода ELISA. Тест-наборы для ELISA покупали у фирмы The Genetics Company™, Швейцария (SOP MET062). Следует отметить, что TBS и Тритон Х-100 солюбилизировали мономеры с образованием олигомерных структур. Полимеры типа протофибрил и нерастворимые в воде фибриллы могли растворяться в ДСН и FA. Поэтому исследование всех четырех фракций также позволяет получать сведения о статусе полимеризации AR.

VIII) Оценка морфологического строения головного мозга

Ткани головного мозга всех изученных Tg-животных подвергали совершенно одинаковой обработке для того, чтобы избежать влияния вариации этой процедуры. Из половины образцов головного мозга, полученных из 24 Tg-мышей (по 8 в каждой группе), приготавливали по 20 сагиттальных криосрезов на слой (всего 5 слоев), каждый толщиной 10 мкм (Leica CM 3050S) и 5 (по одному из каждого слоя) обрабатывали и оценивали количественно загрузку бляшками. Пять сагиттальных слоев соответствовали чертежам 104-105, 107-108, 11-112, 115-116 и 118-119 в морфологическом атласе «The Mouse Brain» Paxinos и Franklin (2-ое изд.). Первый слой в соответствии с требованиями включал весь гиппокамп с его областями СА1, СА2, СА3, GDlb и GDmb. Иммунореактивность оценивали количественно в гиппокампе и в корковом слое с использованием моноклонального специфического для человеческого Аβ антитела 6Е10 (фирма Signet), а также путем окрашивания тиофлавином S. Остальные неиспользованные полусферы или ткани сберегали и хранили согласно JSW CNS до окончания проекта.

б) Осуществление оценки

I) Поведение

В опытах с использованием водного лабиринта Морриса с помощью специальной компьютерной программы оценивали для каждого Tg-животного длину дорожки, которую проплывали животные, латентность избегания, скорость плавания и в пробном испытании количество пересечений предыдущего положения платформы и время, проведенное в каждом квадранте бассейна.

II) Биохимическая оценка

Образцы СМЖ всех Tg-мышей, а также препараты головного мозга анализировали с помощью имеющихся в продаже наборов Aβ1-40- и Aβ1-42-ELISA Параллельно осуществляли оценку соответствующих стандартов. Образцы препаратов головного мозга анализировали с дублированием. Из-за небольшого размера образца образцы СМЖ анализировали только с использованием одного измерения.

III) Гистология

I1) Оценка отложения амилоида и загрузки бляшек

Для иммуногистохимического анализа с помощь 6Е10 использовали следующую процедуру оценки:

аа) контрастировали изображение для визуализации границ среза без применения контраста для изображения;

бб) интерактивно очерчивали кортикальные контуры и затем измеряли кортикальную площадь (= площадь области);

вв) интерактивно очерчивали представляющую интерес область (AOI), в котором окрашенные объекты выявляли на основе определенной интенсивности относительно порогового уровня (одинаковый для каждого изображения) и по размеру, превышающему 8 мкм2;

гг) измеряли площадь каждого объекта, сумму окрашенных площадей в AOI, а также количество объектов после однородного контрастирования с целью повышения соотношения сигнал/шум (одинаковое для каждого изображения);

дд) повторяли стадии аа)-гг) для гиппокампа;

ее) рассчитывали средний размер бляшек (= «сумма площадей бляшек/количество бляшек»), относительное количество бляшек и площадь (= «количество бляшек/площадь области» и «сумма площадей бляшек/площадь области × 100»);

жж) автоматически экспортировали данные в программу Excel для обработки крупноформатных таблиц, включая следующие параметры «обозначение изображения, площадь области, количество бляшек, сумму площадей бляшек, относительное количество бляшек, относительная площадь бляшек и средний размер бляшек. Поле для комментариев использовали для регистрации качества изображения и критериев исключения соответственно. Критериями исключения являлись отсутствие частей среза, большое количество складок, наличие доминирующих трещин или противоречивая (изменчивая) окраска (например, из-за выпуклостей, которые могут препятствовать полной реакции блокирующего реагента);

зз) закрывали изображение, не запасая его (чтобы держать необработанные данные в исходном состоянии).

в) Результаты

I) Общие сведения

Для опыта использовали в целом 40 самок Tg-мышей линии hAPP. Из этих мышей 12 животных погибло по неизвестной причине до окончания обработок.

II) Результаты поведенческих опытов

На пространственное научение при использовании MWM в целом не влияла обработка XG-102 (SEQ ID NO:233). При использовании соединения в дозе 0,1 мг/кг у мышей обнаружена тенденция к ухудшению характеристик научения в период между днем 1 и днем 4. Двусторонний дисперсионный анализ средних характеристик в день 1 и 4 продемонстрировал очень значительное научение у животных во всех группах (р<0,001), но также продемонстрировал значительное влияние фактора обработки (р=0,045). Однако последующая оценка на основе поправок Бонферрони не свидетельствовала о соответствии критерию значимости.

III) Результаты биохимических исследований

аа) Уровни Аβ в фракциях гомогенатов головного мозга

Обработка тестируемым соединением XG-102 (SEQ ID NO:233) не оказывала влияния на уровни Aβ1-40 в гомогенатах головного мозга. Групповые отличия в уровнях Аβ1-42 обнаружены только в Тритон Х-100-фракции. При этом у животных, обработанных тестируемым соединением XG-102 (SEQ ID NO:233) в низкой дозе (0,1 мг/кг), обнаружено значительное снижение по сравнению с группой, обработанной наполнителем (р<0,5), а также по сравнению с группой, обработанной высокой дозой (р<0,01).

бб) Уровни Аβ в СМЖ

После обработки тестируемой субстанцией XG-102 (SEQ ID NO:233) уровни Aβ1-40 и Aβ1-42 в СМЖ существенно снижались по сравнению с группой, обработанной наполнителем. Как для Aβ1-40, так и для Aβ1-42 р-значения составляли р<0,01 для группы, обработанной высокой дозой (10 мг/кг), и <0,05 для группы, обработанной низкой дозой XG-102 (SEQ ID NO:233).

IV) Результаты гистологического и иммуногистохимического (ИГХ) исследования головного мозга

аа) Отложения амилоида и загрузка бляшками

Загрузку бляшками количественно оценивали двумя различными методами. С одной стороны, осуществляли ИГХ-окрашивание с использованием антитела 6Е10, прежде всего направленного против человеческого амилоидного пептида АА1-17, а с другой стороны, осуществляли окрашивание тиофлавином S, который является маркером бета-складчатой структуры и ядер созревания, т.е. нейритных бляшек. Прежде всего, установлено, что площади областей, т.е. коркового слоя и гиппокампа, оказались практически постоянными во всех группах, что свидетельствует о том, что проблемы, связанные с расщеплением и ИГХ-процедурами, можно исключить, кроме того, обработка в определенной степени вызывала атрофию (с помощью этого метода можно выявлять изменения, составляющие>5%). Количественная оценка с помощью 6Е10 и тиофлавина S продемонстрировали избирательное уменьшение бета-складчатых структур в центре бляшек после обработки XG-102 (SEQ ID NO:233), в то время как обнаружено отсутствие воздействия обработки на человеческий амилоид или небольшое повышение его уровня. В части кортикальной области по данным, полученным с помощью 6Е10 IR, загрузка бляшками повышалась по сравнению мышами, обработанными наполнителем, при применении XG-102 (SEQ ID NO:233) в дозе 10 мг/кг, при этом значимый уровень достигался для количества бляшек в гиппокампе. В отличие от этого, при осуществлении ИГХ с использованием 6Е10 обработка XG-102 (SEQ ID NO:233) приводила к снижению, характеризующемуся отрицательной дозовой зависимостью количества в гиппокампе тиофлавин S-позитивных бляшек, а также процента площади бляшек (количество бляшек: р<0,05 для 10 мг/кг, р<0,01 для 0,1 мг/кг XG-102 (SEQ ID NO:233)). Обработка XG-102 (SEQ ID NO:233) в дозе 0,1 мг/кг также снижала средний размер бляшек, однако это действие не достигало значимого уровня по данным дисперсионного анализа (неспаренный, двусторонний Т-критерий: р=0,074). Эти действия не обнаружены в случае кортикальных бляшек, данное обстоятельство наиболее вероятно связано с более поздним началом связанной с образованием бляшек патологии в гиппокампе по сравнению с корковым слоем. Обработку начинали в возрасте 5 месяцев, т.е. в возрасте, который точно совпадает с моментом отложения бляшек в гиппокампе, в то время как кортикальные бляшки становятся заметными при используемом для количественной оценки увеличении в возрасте трех месяцев. Качественно доля окрашенных 6Е10 относительно окрашенных тиофлавином S бляшек увеличивалась, а доля бета-складчатых ядер бляшек уменьшалась по размеру, что установлено в дважды меченых срезах. В целом, эти данные подтверждают, что обработка XG-102 (SEQ ID NO:233) оказывает воздействие на формирование бета-складок на ранней фазе отложения бляшек и образования бета-складок в ядрах бляшек соответственно.

г) Обобщение данных об эффективности и выводы

- Пространственная навигация, оцененная с помощью водного лабиринта Морриса, в целом не зависела от обработки. При использовании XG-102 (SEQ ID NO:233) в дозе 0,1 мг/кг у мышей обнаружено некоторое ухудшение характеристик научения в период между первым и последним днем испытания.

- За исключением снижения в Тритон Х-100-фракции при применении XG-102 (SEQ ID NO:233) в дозе 0,1 мг/кг уровни Aβ1-40 и Aβ1-42 в головном мозге оставались стабильными.

- Снижение уровней Аβ обнаружено в СМЖ при применении обеих доз и фрагментов.

- Обработка XG-102 (SEQ ID NO:233) приводила к тенденции к повышению уровня человеческого амилоида бета в группе, обработанной высокой дозой, при количественной оценке с помощью 6Е10, что согласуется данными, полученными с помощью Aβ-ELISA.

- В отличие от этого нагрузка бета-складчатыми структурами гиппокампа, выявленная с помощью окрашивания тиофлавином S, вызывала зависящее от дозы снижение после обработки XG-102 (SEQ ID NO:233, которое было более выраженным при использовании более низкой дозы 0,1 мг/кг XG-102 (SEQ ID NO:233), в то время как загрузка бляшками кортикального слоя оставалась без изменения. Согласуясь со связанным с возрастом отложением бляшек в гиппокампе в начале лечения, это указывает на раннюю активность в отношении формирования бета-складок на ранней фазе отложения бляшек.

Пример 7: Определение активности полностью-D ретро-инвертированных пептидов IB (s) и их вариантов в отношении лечения диабета типа 2

Целью исследования было определение активности пептидов IB (s) и полностью-D ретро-инвертированных пептидов IB (s) и их вариантов в отношении лечения диабета типа 2, прежде всего определение действия длительной обработки XG-102 (SEQ ID NO:233) на модели на мышах линии db/db диабета типа 2 по уровням глюкозы в крови натощак каждые три дня (28 дней).

а) Материалы и методы

I) Животные

В целом двадцать (20) самцов мышей линии db/db (8-недельного возраста) получали от фирмы Charles River (Германия). После прибытия животных разделяли на группы (n=6-7/группу) и содержали на обычном корме для грызунов (корм Altromin standard №1324; фирма С.Petersen, Рингстед, Дания) и, если не указано иное, животные имели свободный доступ к воде.

Мышей содержали при световом цикле 12 ч света/12 ч темноты (свет включали в 4:00 и свет выключали в 16:00) и при контролируемой температуре и влажности в помещении.

II) Группы и рандомизация

В день - 4 мышей произвольно разделяли на группы в зависимости от уровня глюкозы в крови (натощак; уровень глюкозы в крови измеряли с помощью анализатора Biosen S line (фирма EKF diagnostic, Германия), различные группы подвергали одному из следующих вариантов обработки лекарственным средством (n=6):

1) наполнитель, контроль, S.C. (физиологический раствор),

2) XG-102 (SEQ ID NO:233); 1 мг/кг; s.c.,

3) XG-102 (SEQ ID NO:233); 10 мг/кг; s.c.

Все указанные дозы даны в пересчете на свободное основание. Чистота лекарственного средства: 95,28%, содержание пептидов: 78,0%. Все соединения вводили подкожно (s.c.) в объеме 3 мл/кг. Инструкции по приготовлению препаративных форм при использовании применяемого в качестве контроля наполнителя и XG-102 (SEQ ID NO:233) включали следующие этапы:

Сначала XG-102 (SEQ ID NO:233) растворяли в наполнителе. Препаративные формы (с концентрациями 0,33 и 3,3 мг/мл, соответствующими дозам 1 и 10 мг/кг соответственно) приготавливали согласно описанной ниже процедуре. Рассчитывали концентрации и их величины выражали с учетом оценки чистоты субстанции и содержания пептидов (коэффициент умножения 1,346).

- Получение маточного раствора: высушенное вымораживанием тестируемое соединение XG-102 (SEQ ID NO:233) оттаивали в течение как минимум 1 ч и приготавливали в виде маточного раствора в наполнителе в концентрации 1 мМ (соответствует 3,823 мг/мл). Приготавливали аликвоты для каждого дня обработки и хранили примерно при -80°С. Разведения этого маточного раствора до требуемых концентраций осуществляли в каждый день обработки;

- Хранение маточного раствора: примерно при -80°С;

- Хранение разведенных препаратов: при комнатной температуре в течение максимум 24 ч.

Перед солюбилизацией порошок хранили при -20°С. Стабильность маточного раствора составляла 3 месяца при хранении примерно при -80°С; стабильность разведенных препаративных форм для обработки животных составляла 24 ч при хранении при комнатной температуре. Неиспользованный разбавленный продукт можно было хранить вплоть до 7 дней, если хранение осуществляли при 4-8°С.

в) Экспериментальная процедура

После акклиматизации в течение 8 дней мышей обрабатывали указанными для соответствующих групп субстанциями ежедневно в 08.00 AM в течение 21 дня путем SC-введения доз за 8 ч до выключения света в 04.00 РМ. Затем в день опыта 21 прекращали применение наиболее высокой концентрации XG-102 (SEQ ID NO:233) (10 мг/кг), в то время как ежедневное введение доз используемого в качестве контроля наполнителя и XG-102 (SEQ ID NO:233) (1 мг/кг) продолжали до дня опыта 28. Начиная со дня 28 до окончания эксперимента в день 111, мышей, обрабатываемых наполнителем и XG-102 (SEQ ID NO:233) (10 мг/кг), обследовали в период без обработки (отсутствие дозирования), в то время как обследование мышей, обработанных XG-102 (SEQ ID NO:233) (1 мг/кг), прекращали после 28 дней обработки.

I) Уровень глюкозы в крови

Уровень глюкозы оценивали у голодавших в течение 7 ч животных через 6 ч после дозирования, собирая 10 мкл образцов крови из хвостовой вены в пробирку для гематокритной центрифуги, и затем анализировали на анализаторе Biosen s-line (фирма EKF-diagnostic; Германия).

II) Клетки для изучения метаболизма (метаболические клетки)

Группы 1+3: Мышей помещали в метаболические клетки для регистрации в течение 24 ч потребления корма воды, а также выделения в течение 24 ч мочи и экскрементов. Мышей подразделяли на 2 подгруппы (n=6-7) и затем осуществляли изучение метаболических характеристик в дни опыта 71-72.

III) Панель адипокинов

Группы 1+3: Трижды (в дни опыта 57, 66 и 108) получали образцы крови из хвостовой вены, используя покрытые ЭДТК пробирки для гематокритной центрифуги (100 мкл). После центрифугирования крови собирали плазму и хранили при -20°С до оценки. Затем определяли следующую панель адипокинов/цитокинов, используя 7-плексный набор фирмы Luminex: лептин, резистин, МСР-1, PAI-1, TNFα, инсулин и интерлейкин-6 (IL-6).

IV) Окончание опыта

Группы 1+3 (день 111): Изымали и взвешивали следующие органы: ингвинальный подкожный жир, эпидидимальный жир, ретроперитонеальный жир, головной мозг, печень, почка, селезенка и сердце. Образцы всех указанных выше органов приготавливали в 4% PFA (парафторфенилаланин) для возможной гистопатологической оценки в будущем. Кроме того, готовили образцы поджелудочных желез (целиком) для возможных стереологических и иммуногистохимических анализов, а образцы глаз готовили для возможных анализов ретинопатии. Группа 2 (день 28): Не получали образцов тканей или плазмы.

в) Результаты

I) Общие сведения

В течение острой фазы дозирования у животных обнаружены нормальные уровни живости и активности и, таким образом, не было признаков седативного действия лекарственного средства на обработанных животных. Потребление корма и воды находилось в нормальном диапазоне относительно животных, обработанных наполнителем. Однако примерно через 2 недели дозирования обнаружен нодулярный фиброз в подкожной ткани как реакция на обработку соединением XG-102 (SEQ ID NO:233) в высокой дозе, его развитие приводило к образованию открытых ран у всех мышей в группе В. В группе Б обнаружен слабый нодулярный фиброз. Вследствие этого использовали другие места для инъекций. После окончания обработки у животных произошло заживление и нодулярный фиброз постепенно исчез. Не обнаружено никаких клинических проявлений у обработанных наполнителем животных.

II) Уровень глюкозы в крови

Уровни глюкозы в крови натощак (абсолютные и относительные) определяли каждые три дня вплоть до дня 68 и регулярно до прекращения опыта в день 111 в группах А и В. Обнаружено выраженное и значимое (р<0,001) снижение уровня глюкозы в крови натощак у страдающих диабетом мышей линии db/db, которых обрабатывали XG-102 (SEQ ID NO:233) (10 мг/кг), по сравнению с группой, обработанной наполнителем в качестве контроля. Уровни глюкозы в крови натощак у мышей, обработанных XG-102 (SEQ ID NO:233) (10 мг/кг), достигали низкого плато на уровне примерно 5 ммолей/л. Это действие обнаружено после 14 дней дозирования и сохранялось в течение опыта, в том числе во время периода без обработок со дня 21 по день 111. В противоположность этому не обнаружено действия при применении XG-102 (SEQ ID NO:233) в низкой дозе (1 мг/кг) в течение 28 дней дозирования.

III) Вес тела

Обнаружено выраженное и значимое (р<0,001) предупреждение повышения веса тела у мышей, обработанных XG-102 (SEQ ID NO:233) (10 мг/кг), по сравнению с наполнителем в качестве контроля. Это действие начинало проявляться с дня 28 дозирования и сохранялось до окончания опыта в день 111. В противоположность этому не обнаружено никакого воздействия XG-102 (SEQ ID NO:233) при его применении в низкой дозе (1 мг/кг) на вес тела в течение 28 дней дозирования.

IV) Метаболические клетки

Воздействие наполнителя или XG-102 (SEQ ID NO:233) (10 мг/кг) на 24-часовое потребление корма и воды и выделение мочи и экскрементов изучали в метаболических клетках в день опыта 68 (стандартизация на г веса тела). Не обнаружено никакого существенного действия XG-102 (SEQ ID NO:233) (10 мг/кг) на какой-либо из оцениваемых параметров по сравнению с применяемым в качестве контроля наполнителем, хотя обнаружена тенденция к снижению потребления корма и образования мочи.

V) Адипокины

Анализировали воздействие наполнителя или XG-102 (SEQ ID NO:233) (10 мг/кг) по данным, полученным в дни 57, 77 и 108, на уровни в плазме инсулина, МСР-1, IL-6; на уровни в плазме tPAI-1, TNF и резистина; не обнаружено никаких существенных воздействий XG-102 (SEQ ID NO:233) (10 мг/кг) на любой из изученных параметров по сравнению с применяемым в качестве контроля наполнителем за исключением уровней в плазме резистина, который оказался существенно более высоким у обработанных XG-102 (SEQ ID NO:233) животных в дни 77 и 108.

IV) Вес ткани в момент прекращения опыта

Анализировали воздействие наполнителя или XG-102 (SEQ ID NO:233) (10 мг/кг) на массу эпидидимальной, подкожной ингвинальной и ретроперитонеальной жировых подушек. Обнаружено существенное снижение эпидидимальной (р<0,05) и ретроперитонеальной (р<0,01) жировой массы у мышей, обработанных XG-102 по сравнению с применяемым в качестве контроля наполнителем. Анализировали также воздействие наполнителя или XG-102 (SEQ ID NO:233) (10 мг/кг) на массу ткани головного мозга, селезенки и сердца. Не обнаружено никаких существенных воздействий XG-102 (SEQ ID NO:233) (10 мг/кг) на эти параметры по сравнению с применяемым в качестве контроля наполнителем. И, наконец, анализировали воздействие наполнителя или XG-102 (SEQ ID NO:233) (10 мг/кг) на массу почки и печени. Обнаружено существенное снижение массы почки (р<0,05) и печени (р<0,01) у мышей, обработанных XG-102 (SEQ ID NO:233), по сравнению с применяемым в качестве контроля наполнителем.

Обобщая эти результаты, можно сделать заключение о том, что введение XG-102 (SEQ ID NO:233) в дозе 10 мг/кг, приводит к существенному снижению уровней глюкозы в крови и поэтому XG-102 (SEQ ID NO:233), вероятно, является перспективным новым «инструментом» лечения диабета и повышенных уровней глюкозы в крови.

Пример 8. Поглощение (интернализация) пептидов клетками и оценка интернализации пептидов в клетки

В этом эксперименте способность к интернализации (поглощению) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro оценивали с помощью флуоресцентного планшет-ридера на клетках линии HL-60 (лейкоз).

8.1. Применяемые в экспериментах тест-образцы

Применяемые в этом эксперименте конструкции представляли собой 4 различные полученные из ТАТ конструкции транспортеров (обозначены как L-ТАТ, r3-ТАТ (также обозначена как r3-L-Tat), r3-TATi (также обозначена как r3-L-TATi) и D-TAT), каждую из которых получали согласно описанному выше методу. Эти конструкции состояли из 9 аминокислот, но имели различные D-/L-схемы. Кроме того, в качестве контроля использовали конструкцию DAK, которая не включала транспортной последовательности. Конструкции защищали на N-конце бета-аланином (βA) и метили с помощью ФИТЦ.

ФИТЦβА-L-TAT ФИТЦβА-RKKRQRRR
ФИТЦβА-D-TAT ФИТЦβА-rrrqrrkkr
ФИТЦβА-r3-L-TAT ФИТЦβА-rKXRrQRRr
ФИТЦβА-r3-L-TATi ФИТЦβА-rRRQrRKKr
ФИТЦβА-DAK (ctl) ФИТЦβА-DAK (без транспортной последовательности).

Конструкции получали согласно описанному выше методу, очищали, хранили в виде 10 мМ раствора в стерильной воде и использовали в чистом виде без дополнительной обработки.

8.2. Дополнительные конструкции транспортеров TAT(s2-1) - TAT(s2-96)

Получали дополнительные конструкции транспортеров TAT(s2-1) - TAT(s2-96) согласно методу, в целом описанному выше для предлагаемых в изобретении конструкций транспортеров. Для этой цели при осуществлении синтеза применяли следующие последовательности и защитные группы (связанные со смолой):

TATs2-1: D-Arg(Pmc)-Ala-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Prnc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-2: D-Arg(Pmc)-Lys(Boc)-Ala-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-3: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Ala-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-4: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Ala-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-5: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Ala-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-6: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Ala-D-Arg(Pmc)-смола
TATs2-7: D-Arg(Pmc)-Asp(OBut)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-8: D-Arg(Pmc)-Lys(Boc)-Asp(OBut)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-9: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Asp(OBut)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-10: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Asp(OBut)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-11: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Asp(OBut)-Arg(Pmc)-D-Arg(Pmc)- TATs2-смола
TATs2-12: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Asp(OBut)-D-Arg(Pmc)- TATs2-смола
TATs2-13: D-Arg(Pmc)-Glu(OBut)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-14: D-Arg(Pmc)-Lys(Boc)-Glu(OBut)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-15: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Glu(OBut)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-16: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Glu(OBut)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-17: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Glu(OBut)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-18: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Glu(OBut)-D-Arg(Pmc)-смола
TATs2-19: D-Arg(Pmc)-Phe-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-20: D-Arg(Pmc)-Lys(Boc)-Phe-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-21: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Phe-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-22: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Phe-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-23: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Phe-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-24: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Phe-D-Arg(Pmc)-смола
TATs2-25: D-Arg(Pmc)-Arg(Pmc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-26: D-Arg(Pmc)-Lys(Boc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-27: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Lys(Boc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-28: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Arg(Pmc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-29: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-30: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Lys(Boc)-D-Arg(Pmc)-смола
TATs2-31: D-Arg(Pmc)-His(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-32: D-Arg(Pmc)-Lys(Boc)-His(Trt)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-33: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-His(Trt)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-34: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)His(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-35: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-His(Trt)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-36: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-His(Trt)-D-Arg(Pmc)-смола
TATs2-37: D-Arg(Pmc)-Ile-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-38: D-Arg(Pmc)-Lys(Boc)-Ile-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-39: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Ile-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-40: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Ile-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-41: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Ile-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-42: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Ile-D-Arg(Pmc)-смола
TATs2-43: D-Arg(Pmc)-Leu-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-44: D-Arg(Pmc)-Lys(Boc)-Leu-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-45: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Leu-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-46: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Leu-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-47: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Leu-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-48: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Leu-D-Arg(Pmc)-смола
TATs2-49: D-Arg(Pmc)-Met-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-50: D-Arg(Pmc)-Lys(Boc)-Met-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-51: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Met-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-52: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Met-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-53: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Met-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-54: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Met-D-Arg(Pmc)-смола
TATs2-55: D-Arg(Pmc)-Asn(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-56: D-Arg(Pmc)-Lys(Boc)-Asn(Trt)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-57: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Asn(Trt)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-58: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Asn(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-59: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Asn(Trt)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-60: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Asn(Trt)-D-Arg,(Pmc)-смола
TATs2-61: D-Arg(Pmc)-G!n(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-62: D-Arg(Pmc)-Lys(Boc)-Gln(Trt)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-63: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Gln(Trt)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-64: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Lys(Boc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-65: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Gln(Trt)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-66: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Gln(Trt)-D-Arg(Pmc)-смола
TATs2-67: D-Arg(Pmc)-Ser(But)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-68: D-Arg(Pmc)-Lys(Boc)-Ser(But)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-69: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Ser(But)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-70: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Ser(But)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-71: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Ser(But)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-72: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Ser(But)-D-Arg(Pmc)-смола
TATs2-73: D-Arg(Pmc)-Thr(But)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-74: D-Arg(Pmc)-Lys(Boc)-Thr(But)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-75: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Thr(But)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-76: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Thr(But)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-77: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Thr(But)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-78: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Thr(But)-D-Arg(Pmc)-смола
TATs2-79: D-Arg(Pmc)-Val-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-80: D-Arg(Pmc)-Lys(Boc)-Val-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-81: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Val-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-82: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Val-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-CMona
TATs2-83: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Val-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-84: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Val-D-Arg(Pmc)-смола
TATs2-85: D-Arg(Pmc)-Trp(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-86: D-Arg(Pmc)-Lys(Boc)-Trp(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-87: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Trp(Boc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-88: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Trp(Boc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-89: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Trp(Boc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-90: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Trp(Boc)-D-Arg(Pmc)-смола
TATs2-91: D-Arg(Pmc)-Tyr(But)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-92: D-Arg(Pmc)-Lys(Boc)-Tyr(But)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-93: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Tyr(But)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-94: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Tyr(But)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-95: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Tyr(But)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-96: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Tyr(But)-D-Arg(Pmc)-смола

8.3 Материалы и методы, применяемые при проведении экспериментов

а) Клеточная линия:

Применяемая в этом эксперименте клеточная линия представляла собой HL-60 (Ref CCL-240, ATCC, лот 116523).

б) Культуральная среда и планшеты

Среда RPMI (Ref 21875-091, фирма Invitrogen, лот 8296) или DMEM (Ref 41965, фирма Invitrogen, лот 13481), дополненная 05.05.2008 г. следующими компонентами:

10% FBS (RefA64906-0098, фирма РАА, лот А15-151): декомплементированная при 56°С, 30 мин 04.04.2008 г.;

1 мМ пируват натрия (RefS8636, фирма Sigma, лот 56К.2386);

пенициллин (100 ед./мл)/стрептомицин (100 мкг/мл) (Ref P4333, фирма Sigma, лот 106К2321).

ЗФР 10× (Ref 70011, фирма Invitrogen, лот 8277): разведенный до 1× стерильной H2O.

Трипсин - 0,05% ЭДТК (Ref L-11660, фирма РАА, лот L66007-1194).

6-луночные культуральные планшеты (Ref 140675, фирма Nunc, лот 102613),

24-луночные культуральные планшеты (Ref 142475, фирма Nunc, лот 095849),

96-луночные культуральные планшеты (Ref 167008, фирма Nunc, лот 083310),

96-луночные планшеты для дозирования белков (Ref 82.1581, фирма Sarstedt),

96-луночные планшеты для оценки флуоресценции (Ref 6005279, фирма Perkin Elmer).

в) Растворы

Поли-D-лизиновый раствор для нанесения покрытия (сенсибилизации) (фирма Sigma P9011, лот 095K5104): 25 мкг/мл конечное разведение в ЗФР 1×.

Кислый буфер для отмывки: 0,2М глицин, 0,15М NaCl, pH 3.0.

Буфер для лизиса Ripa: 10 мМ NaH2PO4, pH 7,2, 150 мМ NaCl, 1% Тритон X-100, 1 мМ ЭДТК, pH 8,0, 200 мкМ Na3VO2, 0,1% ДСН, 1× коктейль ингибиторов протеаз (Ref 11873580001, фирма Roche, лот 13732700).

г) Микроскопия и анализ с помощью флуоресцентного планшет-ридера

Выявление и подсчет клеток осуществляли с помощью инвертированного микроскопа (Axiovert 40 CFL; фирма Zeiss; 20×).

Флуоресценцию определяли с помощью планшет-ридера Fusion Alpha (фирма Perkin Elmer).

д) Метод

Интернализацию меченного с помощью ФИТЦ пептида изучали на суспензионной культуре клеток. Клетки высевали в покрытые поли-DL-лизином планшеты в концентрации 1×106 клеток/мл. Затем планшеты инкубировали в течение 24 ч при 37°С, 5% CO2 и 100% относительной влажности перед добавлением пептида в известной концентрации. После добавления пептида клетки инкубировали в течение 30 мин, 1, 6 или 24 ч при 37°С, 5% CO2 и 100% относительной влажности. Затем клетки отмывали дважды кислым буфером (глицин 0,2М, NaCl 0,15М, pH 3,0) для удаления адсорбированного на клеточной поверхности пептида (см. Kameyama и др., Biopolymers, 88, 2007, cc.98-107). Применяли кислый буфер поскольку пептиды, богатые основными аминокислотами сильно адсорбировались на поверхности клеток, что часто приводило к переоценки количества интернализованого пептида. Таким образом, для удаления адсорбированных на поверхности клеток пептидов применяли отмывку клеток кислым буфером. При определении поглощения клетками проникающих в клетку пептидных конъюгатов Fab осуществляли кислотную отмывку с последующими двумя отмывками с помощью ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Относительное количество интернализованного пептида затем определяли на основе флуоресценции после вычитания фонового уровня и стандартизации содержимого белка.

Таким образом, осуществляли следующие стадии:

1. культивирование клеток;

2. кислотная отмывка и экстрагирование клеток;

3. анализ интернализации пептидов с помощью флуоресцентного планшет-ридера.

е) Культивирование клеток и обработка пептидами

(1) 6-луночные культуральные планшеты сенсибилизировали 3 мл поли-D-Lys (фирма Sigma P9011; 25 мкг/мл в ЗФР), 24-луночные - 600 мкл, а 96-луночные планшеты - 125 мкл и инкубировали в течение 4 ч при 37°С, CO2 5% и 100% относительной влажности.

(2) Через 4 ч планшеты дважды отмывали 3,5 мл ЗФР, 700 мкл или 150 мкл ЗФР в случае 6-, 24- или 96-луночных планшетов соответственно.

(3) Клетки высевали в планшеты в 2,4 мл среды (RPMI) с плотностью 1000000 клеток/мл для получения суспензии клеток. После инокуляции планшеты инкубировали при 37°С, 5% CO2 и 100% относительной влажности в течение 24 ч перед добавлением пептида. Прикрепленные (прилипшие) клетки, плотность которых должна составлять 90-95% в день обработки, высевали в DMEM:

Лунки Поверхность культуры (см2) Среда Количество прикрепившихся клеток Количество клеток в суспензии
96 лунок 0,3 100-200 мкл 8000-30000 100000
24 лунок 2 500-1000 мкл 100000-200000 500000-1000000
35 мм (Р35)/6 лунок 10 2,4 мл 250000-2100000 2400000
60 мм (Р60) 20 3,5 мл 15×105 1000000/мл
10 см (P100) 60 10 мл 15-60×105

(4) Клетки обрабатывали меченным с помощью ФИТЦ пептидом в требуемой концентрации (маточный раствор с концентрацией 10 мМ в Н2О).

(5) После добавления пептида клетки инкубировали в течение 0-24 ч (например, 30 мин, 1, 6 или 24 ч) при 37°С, СО2 5% и 100% относительной влажности.

Кислотная отмывка и получение клеточных экстрактов:

(6) Экстракты охлаждали на льду.

Суспензионные клетки (или клетки, не прикрепившиеся к планшету):

- Переносили клетки в «Falcon 15 мл». Для получения максимального количества клеток отмывали планшет 1 мл ЗФР.

- Собирали клетки в течение 2 мин максимум при 2400 об/мин.

- Суспендировали клетки в 1 мл холодного ЗФР.

- Переносили клетки в сенсибилизированную «пробирку Эппендорфа» (покрытую 1 мл поли-D-Lys на 4 ч и отмытую дважды 1 мл ЗФР).

- Отмывали трижды 1 мл холодного кислого буфера и центрифугировали в течение 2 мин максимум при 2400 об/мин. Применяли меры предосторожности для предупреждения распространения клеток в «пробирке Эппендорфа».

- Отмывали дважды 1 мл холодного ЗФР для нейтрализации.

- Добавляли 50 мкл буфера для лизиса RIPA.

- Инкубировали в течение 30 мин-1 ч на льду при перемешивании.

Прикрепившиеся (прилипшие) клетки:

- Отмывали трижды, используя по 3 мл, 1 мл или 200 мкл (для 6-, 24- или 96-луночных планшетов соответственно) холодного кислого буфера для отмывки. Применяли меры предосторожности для предупреждения отлипания клеток от планшета.

- Отмывали дважды 1 мл холодного ЗФР (для 6-, 24- или 96-луночных планшетов соответственно) для нейтрализации.

- Добавляли 50 мкл буфера для лизиса RIPA.

- Инкубировали в течение 30 мин-1 ч на льду при перемешивании.

- Отскабливали клетки с помощью холодного лезвия. 24- и 96-луночные планшеты непосредственно центрифугировали при 4000 об/мин при 4°С в течение 15 мин для удаления клеточного дебриса. Затем супернатанты (100 или 50 мл соответственно для 24- или 96-луночных планшетов) непосредственно переносили в темные 96-луночные планшеты. Планшеты считывали с помощью флуоресцентного планшет-ридера (Fusion Alpha, фирма Perkin Elmer).

- Переносили лизат в сенсилизированную «пробирку Эппендорфа» (покрытую 1 мл поли-D-Lys на 4 ч и отмытую дважды 1 мл ЗФР).

- Затем лизированные клетки центрифугировали в течение 30 мин при 10000 g при 4°С для удаления клеточного дебриса.

- Удаляли супернатант и хранили при -80°С в сенсибилизированной «пробирке Эппендорфа» (покрытой 1 мл поли-D-Lys в течение 4 ч и отмытой дважды 1 мл ЗФР).

Анализ интернализации пептидов с помощью флуоресцентного планшет-Ридера:

(7) Содержание белка в каждом белковом экстракте определяли с помощью стандартного ВСА-анализа (набор №23225, фирма Pierce) согласно инструкциям производителя.

(8) Определяли относительную флуоресценцию каждого образца после считывания 10 мкл каждого образца с помощью флуоресцентного планшет-ридера (Fusion Alpha, фирма Perkin Elmer), вычитали фоновый уровень и стандартизовали относительно концентрации белка.

8.4 Эксперименты по интернализации и анализ полученных результатов

Зависящую от времени интернализацию (поглощение) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров в клетки клеточной линии HL-60 осуществляли с использованием указанных выше материалов и методов.

В целом, метод состоял в следующем: HL-60-клетки инкубировали в течение 30 мин, 1, 6 или 24 ч с 10 мкМ полученными из ТАТ транспортерами. Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем относительное количество интернализованного пептида определяли, считывая интенсивность флуоресценции (ридер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта с последующим вычитанием фонового уровня и осуществлением стандартизации относительно содержания белка. Для конструкции транспортера r3-L-TAT обнаружена способность к интернализации такая же по эффективности, что и для конструкции транспортера D-TAT. Конструкция транспортера r3-L-TATi, интернализация которой зависела от времени, также как и в случае двух указанных выше транспортеров, вероятно, обладала более низкой, но все еще приемлемой эффективностью, в то время как для конструкции L-TAT не обнаружено накопления в течение 24 ч.

Кроме того, осуществляли исследование клеток, обработанных флуоресцентно меченными полученными из ТАТ конструкциями транспортеров, с помощью конфокального микроскопа согласно описанному выше методу. Диссоциированные кортикальные первичные нейроны из бластомеров Р2 крыс линии Sprague Dawley культивировали в течение 12 дней в нейробазальной среде перед обработкой в течение 24 ч 500 нМ меченными с помощью ФИТЦ полученными из ТАТ транспортерами. Клетки отмывали 5 раз ЗФР на льду и затем заключали в заливочную среду Fluorsave без предварительной фиксации. Обследование осуществляли с помощью метаконфокального микроскопа LSM510 (фирма Zeiss). Изображения обрабатывали с помощью программы LSM510 и представляли с помощью программы Adobe Photoshop. Визуализацию меченных 500 нМ ФИТЦ транспортеров (А: зеленый) осуществляли с помощью конфокального микроскопа. Ядра окрашивали с помощью красителя Hoechst (Б: голубой). Конструкции транспортеров r3-L-TAT, а также D-TAT и r3-L-TATi, были интернализованы в цитоплазме не подвергнутых стрессу нейронов (В: панель с наложением изображений). Однако после 24-часовой инкубации транспортер L-TAT больше не присутствовал.

8.5 Дополнительные эксперименты по интернализации и их анализ

Зависящую от времени интернализацию (поглощение) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров в клетки клеточной линии HL-60 осуществляли также с использованием указанных выше материалов и методов, применяя последовательности 96 меченных с помощью ФИТЦ транспортеров-производных D-TAT. Эти последовательности перечислены ниже.

SEQ ID NO: Пептид No: сокращение
15 r3-L-TAT H2N dR K K R dR Q R R dR CONH2
21 1 H2N dR A K R dR Q R R dR CONH2
22 2 H2N dR K А R dR Q R R dR CONH2
23 3 H2N dR K K А dR Q R R dR CONH2
24 4 H1N dR K K R dR А R R dR CONH2
25 5 H2N dR K K R dR Q A R dR CONH2
26 6 H2N dR K K R dR Q R A dR CONH2
27 7 H2N dR D K R dR Q R R dR CONH2
28 8 H2N dR К D R dR Q R R dR CONH2
SEQ ID NO: Пептид No: сокращение
29 9 H2N dR K K D dR Q R R dR CONH2
30 10 H2N dR K K R dR D R R dR CONH2
31 11 H2N dR K K R dR Q D R dR CONH2
32 12 H2N dR K K R dR Q R D dR CONH2
33 13 H2N dR Е K R dR Q R R dR CONH2
34 14 H2N dR K Е R dR Q R R dR CONH2
35 15 H2N dR K K Е dR Q R R dR CONH2
36 16 H2N dR K K R dR Е R R dR CONH2
37 17 H2N dR K K R dR Q Е R dR CONH2
38 18 H2N dR K K R dR Q R E dR CONH2
39 19 H2N dR F K R dR Q R R dR CONH2
40 20 H2N dR K F R dR Q R R dR CONH2
41 21 H2N dR K K F dR Q R R dR CONH2
42 22 H2N dR K K R dR F R R dR CONH2
43 23 H2N dR K K R dR Q F R dR CONH2
44 24 H2N dR K K R dR Q R F dR CONH2
45 25 H2N dR R K R dR Q R R dR CONH2
46 26 H2N dR K R R dR 0 R R dR CONH2
47 27 H2N dR K K K dR Q R R dR CONH2
48 28 H2N dR K K R dR R R R dR CONH2
49 29 H2N dR K K R dR Q K R dR CONH2
50 30 H2N dR K K R dR Q R К dR CONH2
51 31 H2N dR Н K R dR Q R R dR CONH2
52 32 H2N dR K Н R dR Q R R dR CONH2
53 33 H2N dR K K Н dR Q R R dR CONH2
54 34 H2N dR K K R dR Н R R dR CONH2
55 35 H2N dR K K R dR Q Н R dR CONH2
56 36 H2N dR K K R dR Q R H dR CONH2
57 37 H2N dR I к R dR Q R R dR CONH2
58 38 H2N dR K I R dR Q R R dR CONH2
59 39 H2N dR K K I dR Q R R dR CONH2
60 40 H2N dR K K R dR I R R dR CONH2
61 41 H2N dR K K R dR Q I R dR CONH2
62 42 H2N dR K K R dR Q R I dR CONH2
63 43 H2N dR L K R dR Q R R dR CONH2
4 44 (D-TAT) H2N dR dR dR dQ dR dR dK dK dR CONH2
16 45 (r3-L-TATi) H2N dR R R Q dR R K K dR CONH2
15 46 (r3-L-TAT) H2N dR K K R dR Q R R dR CONH2
14 47 (L-TAT) H2N R K K R R Q R R R CONH2
68 48 H2N dR K K R dR Q R L dR CONH2
69 49 H2N dR M K R dR Q R R dR CONH2
70 50 H2N dR K M R dR Q R R dR CONH2
71 51 H2N dR K K M dR Q R R dR CONH2
72 52 H2N dR K K R dR M R R dR CONH2
73 53 H2N dR K K R dR Q M R dR CONH2
74 54 H2N dR K K R dR Q R M dR CONH2
75 55 H2N dR N K R dR Q R R dR CONH2
SEQ ID NO: Пептид No: сокращение
76 56 H2N dR K N R dR Q R R dR CONH2
77 57 H2N dR K K N dR Q R R dR CONH2
78 58 H2N dR K K R dR N R R dR CONH2
79 59 H2N dR K K R dR Q N R dR CONH2
80 60 H2N dR K K R dR Q R N dR CONH2
81 61 H2N dR Q K R dR Q R R dR CONH2
82 62 H2N dR K Q R dR Q R R dR CONH2
83 63 H2N dR K K Q dR Q R R dR CONH2
84 64 H2N dR K K R dR K R R dR CONH2
85 65 H2N dR K K R dR Q Q R dR CONH2
86 66 H2N dR K K R dR Q R 0 dR CONH2
87 67 H2N dR S K R dR Q R R dR CONH2
88 68 H2N dR K S R dR Q R R dR CONH2
89 69 H2N dR K K S dR Q R R dR CONH2
90 70 H2N dR K K R dR S R R dR CONH2
91 71 H2N dR K K R dR Q S R dR CONH2
92 72 H2N dR K K R dR Q R S dR CONH2
93 73 H2N dR T K R dR Q R R dR CONH2
94 74 H2N dR K T R dR Q R R dR CONH2
95 75 H2N dR K K Т dR Q R R dR CONH2
96 76 H2N dR K K R dR T R R dR CONH2
97 77 H2N dR K K R dR Q T R dR CONH2
98 78 H2N dR K K R dR Q R T dR CONH2
99 79 H2N dR K K R dR Q R R dR CONH2
100 80 H2N dR K V R dR Q R R dR CONH2
101 81 H2N dR K K V dR Q R R dR CONH2
102 82 H2N dR K K R dR V R R dR CONH2
103 83 H2N dR K K R dR Q V R dR CONH2
104 84 H2N dR K K R dR Q R V dR CONH2
105 85 H2N dR W K R dR Q R R dR CONH2
106 86 H2N dR K W R dR Q R R dR CONH2
107 87 H2N dR K K W dR Q R R dR CONH2
108 88 H2N dR K K R dR W R R dR CONH2
109 89 H2N dR K K R dR 0 W R dR CONH2
110 90 H2N dR K K R dR Q R W dR CONH2
111 91 H2N dR Y K R dR Q R R dR CONH2
112 92 H2N dR K Y R dR Q R R dR CONH2
113 93 H2N dR K K Y dR Q R R dR CONH2
114 94 H2N dR K K R dR Y R R dR CONH2
115 95 H2N dR K K R dR Q Y R dR CONH2
116 96 H2N dR K K R dR Q R Y dR CONH2

В приведенной выше таблице D-аминокислоты обозначены прописной буквой «d» перед соответствующим аминокислотным остатком (например, dR D-Arg).

Для некоторых последовательностей при использовании первого подхода, к сожалению, не удалось осуществить синтез по техническим причинам. Однако остальные последовательности применяли в экспериментах по интернализации.

Все транспортеры с консенсусной последовательностью rXXXrXXXr (см. выше о выборе возможных последовательностей) отличались более высокой способностью к интернализации, чем транспортер L-TAT. Клетки линии Hela инкубировали в течение 24 ч в 96-луночном планшете с 10 мМ полученными из r3-L-TAT транспортерами. В альтернативном варианте использовали клетки человеческой лимфомы. Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем определяли относительное количество интернализованного пептида, считывая интенсивность флуоресценции (ридер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта, с последующим вычитанием фонового уровня.

Одно из положений, вероятно, играет решающее значение для обеспечения наиболее высокой активности транспортера и улучшенных кинетических характеристик транспортной активности: Y в положении 2 (пептид №91, соответствующий SEQ ID NO:111). В целом, метод состоял в следующем: клетки линии Hela инкубировали в течение 2, 6 или 24 ч в 24-луночном планшете с возрастающими дозами полученных из r3-L-TAT транспортеров (0, 500 нМ, 1 мМ или 10 мМ). Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем относительное количество интернализованного пептида определяли, считывая интенсивность флуоресценции (ридер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта с последующим вычитанием фонового уровня.

На основе результатов, полученных в этом эксперименте, можно сделать следующие выводы:

- После 24-часовой инкубации все транспортеры с консенсусной последовательностью rXXXrXXXr (см. таблицу 1 для выбора возможных последовательностей) отличались более высокой способностью к интернализации, чем транспортер L-TAT. Эти результаты полностью валидируют консенсусную последовательность rXXXrXXXr.

- Одно из положений имеет решающее значение для улучшения активности транспортера: Y в положении 2 (последовательность 91, соответствующая SEQ ID NO:111).

- Одно из положений влияет на улучшение кинетических характеристик транспортной активности: Y в положении 2 (последовательность 91, соответствующая SEQ ID NO:111).

Таким образом, указанные полученные из ТАТ последовательности, представленные в таблице 1, являются предпочтительными, они отличаются наличием Y в положении 2, прежде всего, когда последовательность согласно общей формуле (I) состоит из 9 аминокислот.

Пример 9. Определение внутриклеточной концентрации конкретных конструкций транспортеров после поглощения (интернализации) этих пептидов клетками линии U937

В следующем эксперименте определяли концентрацию конкретных конструкций транспортеров после поглощения (интернализации) этих пептидов клетками линии U937. Эксперименты осуществляли, используя последовательности RKKRRQRRR (L-TAT), rrrqrrkkr (D-TAT), rKKRrQRRr (r3-L-TAT) и rYKRrQRRr (XG-91), каждую в концентрации 10 мкМ.

10 мкМ 2 ч 4 ч 6 ч 24 ч
RKKRRQRRR (L-TAT) 1,20 1,38 1,07 0,5
rrrqrrkkr (D-TAT) 2,00 2,24 3,55 17,3
rKKRrQRRr (r3-L-TAT) 2,34 3,16 3,56 11,2
rYKRrQRRr (XG-91, последовательность 91, соответствующая SEQ ID NO:111) 3,16 4,27 4,68 50

При создании изобретения неожиданно было установлено, что накопление rYKRrQRRr (XG-91, последовательность 91, соответствующая SEQ ID NO:111), является очень высоким в клетке, даже существенно превышающим концентрацию конструкции транспортера в среде или среднюю концентрацию, составляющую примерно 20 мкМ, которая ожидалась для конструкции D-TAT. Это подчеркивает важность конструкций транспортеров общей формулы (I), прежде всего конструкций транспортеров, которые содержат полученную из ТАТ последовательность, представленную в таблице 1, которая несет Y в положении 2 и предпочтительно состоит из 9 аминокислот и несет консенсусную последовательность rXXXrXXXr.

Пример 10. Поглощение (интернализация) пептидов клетками и оценка интернализации пептидов с использованием клеток линии HepG2 (гепатокарцинома). НСТ-116 (опухоль ободочной кишки), U937 (лимфома) и клеточных линий WBC (клеточные линии лейкоцитов) и клеточных линий не относящихся к WBC

В этих экспериментах способность к интернализации (поглощению) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro оценивали с помощью флуоресцентного планшет-ридера на других клеточных линиях, таких как HepG2 (гепатокарцинома), НСТ-116 (опухоль ободочной кишки), U937 (лимфома), клеточные линии WBC (клеточные линии лейкоцитов) и клеточные линии, не относящиеся к WBC.

Тест-образцы и условия, применяемые в этих экспериментах

В этом эксперименте применяли описанные выше для эксперимента 3 конструкции и условия со следующими изменениями и клеточными линиями:

(а) Поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (10 мкМ, HepG2 (гепатокарцинома). НСТ-116 (опухоль ободочной кишки. 24 ч)

Применяемые конструкции представляли собой различные полученные из ТАТ конструкции транспортеров, обозначенные как D-TAT и r3-TATi (обозначают также как r3-L-TATi), D-TAT, каждая из которых состояла из 9 аминокислот, но имела отличную от других D-/L-схему, и конструкции r6R3 (rrrRRRrrr) и DAK, эти конструкции дополнительно метили бета-аланином на N-конце. Наиболее высокая эффективность обнаружена для конструкций D-TAT и r6R3, далее в порядке снижения эффективности следовала конструкция r3-L-TATi.

(б) Поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (10 мкМ, U937 (лимфома) 24 ч)

Применяемые конструкции представляли собой 4 различные полученные из ТАТ конструкции транспортеров (обозначенные как L-TAT, r3-ТАТ (обозначают также как r3-L-Tat), r3-TATi (обозначают также как r3-L-TATi) и D-TAT), каждая из которых состояла из 9 аминокислот, но имела отличную от других D-/L-схему. Кроме того, применяли конструкцию DAK для сравнения и контрольный образец, не содержащий пептид. Наиболее высокая эффективность поглощения клетками обнаружена для конструкций транспортеров r3-ТАТ, r3-TATi и D-TAT, в то время как для L-TAT характерна существенно меньшее поглощение клетками.

в) Зависящее от HSPG (гепаринсульфатпротеогликан) поглощение (интернализация) конструкции транспортера D-TAT

Эксперимент осуществляли с целью решения вопроса о том, является ли поглощение (интернализация) конструкции транспортера D-TAT HSPG-зависимой. Установлено, что поглощение (интернализация) конструкции транспортера D-TAT являлось HSPG-зависимым при концентрации 500 нМ в течение 24 ч при оценке на клетках лимфомы линии U937. Применяемая в этом эксперименте конструкция представляла собой D-TAT (SEQ ID NO:4), которая состояла из 9 аминокислот, и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина.

г) Выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров при использовании клеток линии U937 (лимфома)

Следующий эксперимент осуществляли с целью решения вопроса о том, имеет ли место выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров при использовании клеток линии U937. В этом случае выход при использовании клеток линии U937 не обнаружен при применении ФИТЦ-D-TAT в концентрации 500 нМ. Применяемая для эксперимента конструкция представляла собой D-TAT, которая состояла из 9 аминокислот, и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина.

Кроме того, удалось установить, что выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров обнаружен при применении ЮмкМ ФИТЦ-D-TAT и он являлся HSPG-зависимым в случае клеток линии U937 (лимфома). Применяемая для эксперимента конструкция представляла собой также описанную выше конструкцию D-TAT.

д) Поглощение (интернализация) и выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров, таких как 10 мкМ ФИТЦ-D-ТАТ, в линиях клеток, не относящихся к WBC (клеточные линии лейкоцитов)

В следующем эксперименте изучали поглощение (интернализацию) и выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров при использовании ФИТЦ-D-TAT в концентрации 10 мкМ и линий клеток, не относящихся к WBC (клеточные линии лейкоцитов). Применяемая для эксперимента конструкция представляла собой D-TAT, которая состояла из 9 аминокислот, и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина.

е) Заключение

Из представленных выше результатов экспериментов по оценке поглощения (интернализации) следует, что поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров, содержащих или состоящих только из D-аминокислот, являлось линейным в течение нескольких часов в опытах in vitro. Кроме того, через 24 ч поглощение (интернализация) этих меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro по внутриклеточным концентрациям превышало в 50-100 раз L-TAT. Кроме того, поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров, содержащих или полностью состоящих из D-аминокислот, WBC-линиями (клеточные линии лейкоцитов) оказалось в 10-50-раз более эффективным по сравнению с не относящимися к WBC линиями in vitro. Во всех этих экспериментах установлено, что при использовании WBC выход являлся эффективным при высокой внутриклеточной концентрации, но не обнаружен при низкой концентрации.

Пример 11. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-цисплатин, r3-L-ТАТ-цисплатин и r3-L-TATi-цисплатин

11.1 Пептидный синтез

Пептидные последовательности D-TAT (rrrqrrkkr), r3-L-TAT (rKKRrQRRr) и r3-L-TATi (rRRQrRKKr), включающие дополнительный метионин, синтезировали вручную, используя 0,4 ммоля Fmoc-амид-АМ-смолы, на основе Fmoc-химии. Затем пептид отщепляли от смолы с помощью ТФК, фильтровали при пониженном давлении, осаждали холодным простым эфиром и сушили. Неочищенный пептид очищали с помощью полупрепаративной ЖХВР и характеризовали с помощью масс-спектрометрии с ионизацией электроспреем (ESI-MC).

11.2 Алкилирование пептида с цисплатином

5,0 мкмоля цисплатина (1,5 мг в 3,0 мл натрий-хлоридного буфера, рН 5,0) растворяли в 2,0 мл 10 мМ Na2HPO4-буфера (рН 7,4), при этом значение рН раствора составляло 7,0. 5,0 мкмоля пептида D-TAT-метионин (или пептида r3-L-TAT-метионин, или пептида r3-L-TATi-метионин) приготавливали в 10 мМ Na2HPO4-буфере (рН 7,4), при этом значение рН раствора составляло 6,0. Затем начинали алкилирование путем смешения двух растворов при комнатной температуре в темноте (значение рН смеси 7,0). Через 0, 1, 3 и 24 ч продукт анализировали с помощью аналитической ОФ-ЖХВР и характеризовали с помощью ESI-MC. Раствор, включающий ожидаемый пик, окончательно очищали с помощью полупрепаративной ОФ-ЖХВР и лиофилизировали.

Пример 12. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-оксалиплатин, r3-L-TAT-оксалиплатин и r3-L-TATi-оксалиплатин

12.1. Синтез пептидов (D-Tat-метионин, r3-L-ТАТ-метионин r3-L-TATi-метионин)

Пептидные последовательности D-TAT (rrrqrrkkr), r3-L-TAT (rKKRrQRRr) и r3-L-TATi (rRRQrRKKr), синтезировали вручную, используя 0,23 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого Gly до N-концевого l-Met (L-форма), последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ), и аминокислотного сочетания (ГБТУ/ГОВt/ДИЭА (диизопропилэтиламин), активация в ДМФ). Пептид отщепляли от смолы с помощью ТФК (2 ч в присутствии 2,5% dH2O, 0,5% ЭДТ и 2,0% ТИС), фильтровали при атмосферном давлении, уменьшали объем барботированием N2, осаждали холодным простым эфиром и сушили на воздухе. Неочищенный пептид очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

12.2. Алкилирование пептида с оксалиплатином

10 мкмолей оксалиплатина, в виде лекарственной формы Eloxatin® (оксалиплатин 4,0 мг, моногидрата лактозы 36,0 мг) растворяли в 5,0 мл 10 мМ Na2HPO4- буфера (рН 7,4). 10 мкмолей пептида D-Tat-метионин (или пептида r3-L-TAT-метионин, или пептида r3-L-TATi-метионин) приготавливали в 5,0 мл dH2O. Начинали алкилирование путем смешения двух растворов при комнатной температуре. Затем реакционную смесь выдерживали при 37°С и осуществляли мониторинг с помощью аналитической ОФ-ЖХВР при 214 и 280 нм в течение 24 ч, целевой пик характеризовали с помощью ESI-MC и очищали полупрепаративной ОФ-ЖХВР с последующей лиофилизацией.

12.3. Условия тестирования

Изучали воздействие обработки возрастающими концентрациями молекулы-конъюгата, предлагаемой в изобретении (D-Tat-оксалиплатин, r3-L-ТАТ-оксалиплатин или r3-L-TATi-оксалиплатин), на выживаемость клеток MCF-7 (клеточная линия человеческой аденокарциномы молочной железы) и SiHa (клеточная линия человеческой плоскоклеточной карциномы шейки матки). Воздействие конъюгатов D-Tat-оксалиплатин, r3-L-ТАТ-оксалиплатин или r3-L-TATi-оксалиплатин сравнивали с действием конъюгата L-Tat-оксалиплатин и двух неконъюгированных противораковых лекарственных средств (оксалиплатин и цисплатин). Клетки каждой клеточной линии (10000 клеток на лунку) высевали в 96-луночные планшеты (200 мкл общий объем среды MEM, дополненной 10% FBS, 1% L-глутамина, 1% Na-пирувата, 1% заменимых аминокислот, для MCF-7-клеток и среды МЕМ/Эрла, дополненной 10% FBS, 1% Na-пирувата, 1% заменимых аминокислот, для SiHa-клеток). Для каждой оцениваемой субстанции тестировали от 6 до 10 различных концентраций. Контрольные клетки представляли собой необработанные клетки. Клетки инкубировали при 37°С в течение 24 ч перед обработкой оцениваемой субстанцией. Каждый эксперимент осуществляли в трех повторностях. Инкубацию клеток после обработки осуществляли в течение 96 ч при 37°С. Воздействие тестируемой молекулы на выживаемость этих клеточных линий (in vitro цитотоксическая активность) оценивали с помощью МТТ-анализа. Добавляли в каждую лунку по 20 мкл (5 мг/мл), профильтрованного через фильтр с размером отверстий 0,22 мкм раствора МТТ (тиазолил синий тетразолий бромид) (МТТ, фирма Sigma, Ref. №88415) в забуференным фосфатом физиологическом растворе (ЗФР, фирма CHUV) и планшет инкубировали в течение 4 ч при 37°С. Супернатант удаляли и кристаллы формазана растворяли в ДМСО (200 мкл на лунку). Оценивали абсорбцию (ОП) с помощью ридера для микропланшетов при 595 нм (ридер типа Expert Plus, фирма Asys Hitech). Значения IC50 (концентрация лекарственного средства, ингибирующая на 50% рост клеток) для оцениваемых субстанций рассчитывали с помощью программы Prism.

Пример 13. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-хлорамбуцил, r3-L-TAT-хлорамбуцил и r3-L-TATi-хлорамбуцил

13.1 Синтез молекул-конъюгатов (D-Tat-хлорамбуцил, r3-L-TAT-хлорамбуцил и r3-L-TATi-хлорамбуцил)

Пептидные последовательности D-TAT (rrrqrrkkr), r3-L-TAT (rKKRrQRRr) или r3-L-TATi (rRRQrRKKr) синтезировали вручную, используя 0,23 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого Gly до N-концевого 1-β□А (L-форма), последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ) и аминокислотного сочетания (ГБТУ/ГОВt/ДИЭА, активация в ДМФ).

После удаления защитной группы Fmoc (20% пиперидина в ДМФ) N-концевого 1-β□А, осуществляли сочетание с хлорамбуцилом, используя стандартные условия для аминокислотного сочетания (ГБТУ/ГОВУДИЭА, активация в ДМФ). Молекулу-конъюгат отщепляли от смолы с помощью ТФК (70 мин в присутствии 3% dH2O и 3% ТИС), фильтровали при атмосферном давлении, уменьшали объем барботированием N2, осаждали холодным простым эфиром и сушили на воздухе. Неочищенную молекулу-конъюгат очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC с последующей лиофилизацией.

13.2 Сравнительные исследования

Изучали воздействие обработки возрастающими концентрациями конъюгатов D-Tat-хлорамбуцил, r3-L-ТАТ-хлорамбуцил или r3-L-TATi-хлорамбуцил на выживаемость клеток MCF-7 (клеточная линия человеческой аденокарциномы молочной железы) и SiHa (клеточная линия человеческой плоскоклеточной карциномы шейки матки). Воздействие конъюгатов D-Tat-хлорамбуцил, r3-L-ТАТ-хлорамбуцил или r3-L-TATi-хлорамбуцил сравнивали также с воздействием конъюгата L-Tat-хлорамбуцил и некоъюгированными противораковыми лекарственными средствами (хлорамбуцил и цисплатин). Клетки каждой клеточной линии (10000 клеток на лунку) высевали в 96-луночные планшеты (200 мкл общий объем среды MEM, дополненной 10% FBS, 1% L-глутамина, 1% Na-пирувата, 1% заменимых аминокислот, для MCF-7-клеток и среды МЕМ/Эрла, дополненной 10% FBS, 1% Na-пирувата, 1% заменимых аминокислот, для SiHa-клеток). Тестировали от 6 до 10 различных концентраций для каждой оцениваемой субстанции. Контрольные клетки представляли собой необработанные клетки. Клетки инкубировали при 37°С в течение 24 ч перед обработкой оцениваемой субстанцией. Каждый эксперимент осуществляли в трех повторностях. Инкубацию клеток после обработки осуществляли в течение 96 ч при 37°С. Воздействие тестируемой молекулы на выживаемость этих клеточных линий (цитотоксическая активность in vitro) оценивали с помощью МТТ-анализа. Добавляли в каждую лунку по 20 мкл (5 мг/мл), профильтрованного через фильтр с размером отверстий 0,22 мкм раствора МТТ (тиазолил синий тетразолий бромид) (МТТ, фирма Sigma, Ref. №88415) в забуференным фосфатом физиологическом растворе (ЗФР, фирма CHUV) и планшет инкубировали в течение 4 ч при 37°С. Супернатант удаляли и кристаллы формазана растворяли в ДМСО (200 мкл на лунку). Оценивали абсорбцию (ОП) с помощью ридера для микропланшетов при 595 нм (ридер типа Expert Plus, фирма Asys Hitech). Значения IC50 (концентрация лекарственного средства, ингибирующая на 50% рост клеток) для оцениваемых субстанций рассчитывали с помощью программы Prism.

Пример 14. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-доксорубицин, r3-L-TAT-доксорубицин и r3-L-TATi-доксорубицин

14.1. Синтез молекул-конъюгатов (D-Tat-доксорубицин, r3-L-TAT-доксорубицин and r3-L-TATi-доксорубицин)

Пептидные последовательности D-TAT (rrrqrrkkr), r3-L-TAT (rKKRrQRRr) и r3-L-TATi (rRRQrRKKr) синтезировали вручную, используя 0,23 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого Gly до N-концевого 1-Е (L-форма), последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ) и аминокислотного сочетания (ГБТУ/ГОВt/ДИЭА, активация в ДМФ).

После удаления защитной группы Fmoc (20% пиперидина в ДМФ) N-концевого 1-Е, осуществляли ацетилирование (уксусный ангидрид, ДИЭА, активация в ДМФ) Удаление защитной группы Odmab боковой цепи осуществляли, используя 2% моногидрата гидразина в ДМФ. Сочетание хлорамбуцила в виде лекарственной формы Adriblastin® (доксорубицин×HCl, 18%, NaCl, лиофилизированный, 82%) осуществляли через сложный эфир OBt (ДИПКДИ/ГОВt/ДИЭА, активация ДХМ/ДМФ).

Молекулу-конъюгат отщепляли от смолы с помощью ТФК (2 ч в присутствии 1,7% dH2O и 1,7% ТИС), фильтровали при атмосферном давлении, уменьшали объем барботированием N2, осаждали холодным простым эфиром и сушили на воздухе. Неочищенную молекулу-конъюгат очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC с последующей лиофилизацией.

Пример 15. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-саквинавир, r3-L-TAT-саквинавир и r3-L-TATi-саквинавир

15.1. Синтез пептидов (D-TAT-D-цистеин, r3-L-ТАТ-D-цистеин и r3-L-TATi-D цистеин)

Пептидные последовательности D-TAT (rrrqrrkkr), r3-L-TAT (rKKRrQRRr) и r3-L-TATi (rRRQrRKKr) синтезировали вручную, используя 0,40 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого D-Arg до N-концевого D-Cys, последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ) и аминокислотного сочетания (ГБТУ/ГОВt/ДИЭА, активация в ДМФ).

Пептид отщепляли от смолы с помощью ТФК, предварительно инкубировали на льду (5 ч в присутствии 2,5% dH2O, 2,5% ЭДТ и 1,0% ТИС), фильтровали при пониженном давлении, осаждали холодным простым эфиром и сушили в вакууме. Неочищенный пептид очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

15.2. Получение активного сложного эфира саквинавира (SQV)

375 мкмолей Boc-Gly-OH растворяли в безводном ДХМ при комнатной температуре и к этому раствору добавляли 265 мкмолей ДМАП, 375 мкмолей DIPCI и 110 мкмолей саквинавира в виде лекарственной формы Invirase® (лактоза, эксципиенты pro compresso obducto) при 0°С. Реакционной смеси навали нагреться до комнатной температуры и перемешивали в течение ночи. Продукт обрабатывали 0,1 н. HCl, сушили над MgSO4 и упаривали при пониженном давлении, получая твердый продукт SQV-Gly(Boc). Защитную группу Вое удаляли инкубацией сложного эфира SQV-Gly(Boc) в течение 3 ч в смеси CH2Cl2 и ТФК (50:50). Продукт перекристаллизовывали из холодного простого эфира в вакууме в течение ночи. Растворяли 47 мкмолей сложного эфира SQV-Gly в 3 мл безводного ДМСО при комнатной температуре и к этому раствору добавляли 94 мкмоля СПДП. Значение рН реакционной смеси доводили до 8,0 при постоянном перемешивании при комнатной температуре. Реакционную смесь выдерживали в течение 3 ч при постоянном перемешивании. Неочищенный продукт SQV-Gly-СОСН2СН2-SS-пиридил очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

15.3. Конъюгация пептидов D-ТАТ (rrrgrrkkr), r3-L-TAT (rKKRrQRRr) или r3-L-TATi (rRRQrRKKr)-D-цистеин с саквинавиром

27 мкмолей SQV-Gly-COCH2CH2-SS-пиридила растворяли в 0,5 мл ЗФР-буфера, рН 7,5 при комнатной температуре и к раствору добавляли 54 мкмоля конструкции D-TAT (rrrqrrkkr), r3-L-TAT (rKKRrQRRr) или r3-L-TATi (rRRQrRKKr)-D-цистеин в 0,5 мл ЗФР-буфера, рН 7,5. Реакционную смесь выдерживали при комнатной температуре в течение 3 ч при постоянном перемешивании. Неочищенный конъюгат D-TAT (rrrqrrkkr)-саквинавир, r3-L-ТАТ (rKKRrQRRr)-саквинавир и r3-L-TATi (rRRQrRKKr)-саквинавир очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

Пример 16. Импорт в клетку предлагаемых в изобретении молекул-. конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEO ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200

Оценивали способность проникать в клетки молекул-конъюгатов, которые являются транспортерами карго-молекул, включающих полученные из ТАТ конструкции транспортеров, которые имеют любую из последовательностей, представленных в SEQ ID NO:1-116, и выведенные из JNK1 или IB1 карго-пептиды, которые имеют любую из последовательностей, представленных SEQ ID NO:117-200. Предлагаемые в изобретении конструкции транспортеров и предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, метили, добавляя на N-конец остаток глицина, конъюгированный с флуоресцеином. Меченые пептиды (1 мкМ) добавляли в культуры клеток ТС-3. В предварительно определенные моменты времени клетки отмывали ЗФР и фиксировали в течение 5 мин в охлажденном на льду метаноле-ацетоне (1:1) перед оценкой с помощью флуоресцентного микроскопа. Меченный флуоресциеном БСА (1 мкМ, 12 молей/моль БСА) применяли в качестве контроля.

Оценивали флуоресцентные сигналы этих конструкций транспортеров и предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул.

Пример 17. Ингибирование предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, индуцированной облучением гибели панкреатических β-клеток

JNK активировали также ионизирующим излучением. Для решения вопроса о том, могут ли предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, обеспечивать защиту от индуцируемого облучением повреждения JNK, клетки линии «WiDr» облучали (30 Гр) в присутствии D-TAT, L-TAT и предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200 (добавляли за 30 мин до облучения в концентрации 1 мкМ), или без них. Контрольные клетки (CTRL) не облучали. Клетки анализировали через 48 ч с помощью окрашивания ИП (йодид пропидия) и красителем Hoechst 3342 согласно описанному выше методу. Представлены среднеквадратичные отклонения средних значений (СКО) при n=3.

Пример 18: Радиационная защита от ионизирующего излучения с помощью предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116. и полученные из JNK1 или IB1 карго-пептиды. последовательность которых представлена в любой из SEQ ID NO:117-200

Для выявления способности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, осуществлять радиационную защиту мышей линии С57 В1/6 (возрастом 2-3 месяца) облучали рентгеновскими лучами (R-лучи) с помощью устройства Phillips RT 250 в дозе 0,74 Гр/мин (17 мА, 0,5 мм Cu-фильтр). За 30 мин до облучения животным вводили i.p. предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200. В целом, метод состоял в следующем: для облучения мышей их помещали в небольшие пластиковые боксы, при этом голова оставалась вне бокса. Перед облучением животных клали на спину и фиксировали шею с помощью небольшой пластмассовой трубки для поддержания головы в правильном положении. Тело защищали свинцом. Перед облучением мышей содержали на стандартном пеллетированном корме для мышей, однако после облучения мышей содержали на полужидком корме, который заменяли каждый день. Затем оценивали реакцию слизистой оболочки губ в двух независимых анализах, используя балльную систему, разработанную Parkins с соавторами (Parkins и др., Radiotherapy & Oncology, 1, 1983, cc.165-173), в которой оценивали статус эритемы, а также наличие отека, шелушения и экссудата. Кроме того, животных взвешивали перед каждой оценки статуса эритемы/отека.

Пример 20: Лечение шумовой травмы

Предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, прежде всего предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат пептидные ингибиторы L-TAT-IB1 (s1-34) или D-TAT-IB1 (s1-34), наносили на мембрану круглого окна улитки 3 групп морских свинок (по 6 животных в каждой группе) в виде 2 мкл геля на основе 2,6% забуференной гиалуроновой кислоты (Hylumed, фирма Genzyme Corp.) в концентрации ЮОмкМ либо за 30 мин до осуществления шумовой травмы (120 дБ при 6 кГц в течение 30 мин), либо через 30 мин или через 4 ч после травмы. В качестве контроля служили необработанные уши. Изменения в уровне слухового порога оценивали путем измерения ответа слухового ствола головного мозга через 20 мин после шумовой травмы (временный сдвиг порога, TTS) и через 15 дней после травмы (перманентный сдвиг порога, PTS). D-TAT-IB1 (s) защищал от перманентной потери слуха даже при его введении после избыточного шумового воздействия по сравнению с необработанными ушами.

Пример 20. Оценка терапевтической активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200. при лечении колита

а) Тест-система:

I) Вид/линия: Мыши линии BALB/c

II) Источник: фирма Harlan Israel, Ltd.

(III) Пол: Самки.

(IV) Общее количество животных: n=150.

(V) Возраст: Молодые взрослые животные возрастом 7 недель в начале опыта.

(VI) Вес тела: Вариации веса тела животных в момент обработки начальными дозами не превышали ±20% от среднего веса.

(VII) Состояние здоровья животных: Состояние здоровья животных, которых применяли в этом опыте, оценивали по прибытии; только животных, которые имели хорошее состояние здоровья, акклиматизировали в лабораторных условиях (по меньшей мере в течение 7 дней) и применяли при проведении опыта.

(VIII) Рандомизация: Животных произвольно разделяли на экспериментальные группы согласно Таблице случайных чисел.

(IX) Окончание опыта: В конце опыта выживших животных умерщвляли путем цервикальной дислокации.

б) Процедуры тестирования

Колит индуцировали путем введения тринитробензолсульфоната (TNBS), растворенного в 50%-ном этаноле.

Затем всех животных обрабатывали предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержали полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в дозах, составляющих от 0,1 до 1000 мкг/кг, либо внутрибрюшино, либо подкожно в виде однократных или повторных суточных доз (см. выше)

в) Обследование и оценка

I) Клинические признаки

В ходе описанного выше эксперимента осуществляли тщательные клинические оценки и регистрировали их. Обследование включало определение изменения внешних признаков, например, состояния кожи, шерсти, глаз, слизистых мембран, появление секреции и экскреции (например, диарея), и вегетативной активности. Отмечали также изменения походки, позы и ответ на уход, а также наличие аномального поведения, тремора, конвульсий, состояния сна и наличие комы.

II) Вес тела

Определение веса тела индивидуальных животных осуществляли ежедневно.

(III) Клиническая оценка колита

Все параметры, такие как вес тела, консистенция экскрементов и кровотечение из прямой кишки, регистрировали ежедневно, и они служили в качестве параметров для балльной оценки серьезности болезни:

Балл Потеря веса (%) Консистенция экскрементов Наличие кровотечения из прямой кишки
0 нет нормальная нет
1 1-5 покраснение, отек ануса нет
2 5-10 неоформленные экскременты нет
3 10-15 диарея нет
4 >15 диарея кровотечение
5 смерть

IV) Макроскопическая патология ободочной кишки

В последний день эксперимента животных умерщвляли и изымали ободочную кишку для оценки макроскопической патологии согласно следующей балльной системе:

Степень Показатели
0 Отсутствие выявляемых аномалий
1 Отек и покраснение в одной области
2 Отек и покраснение в более чем одной области или очень сильный отек и покраснение, захватывающие более 50% ободочной кишки
3 Одна язва
4 Более одной язвы или очень длинная серьезная язва

Пример 21. Оценка активности предлагаемых в изобретении молекул-конъюгатов. являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEO ID NO:117-200, при лечении хронического обструктивного заболевания легких (COPD)

Для оценки активности репрезентативных предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в отношении лечения хронического обструктивного заболевания легких (COPD) использовали животную модель индуцированного блеомицином острого воспаления легких и фиброза. Протокол индуцированного блеомицином воспаления и фиброза ранее описан в литературе. Задача эксперимента заключалась в изучении воздействия указанных предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, при подкожном пути (s.c.) введения на рекрутмент нейтрофилов в бронхоальвеолярном лаваже (BAL) и легком при индуцированном блеомицином воспалении и фиброзе:

- в день 1 после однократного введения блеомицина (10 мг/кг)

- и в день 10 при развитом фиброзе.

1) Метод и экспериментальный подход

Тестируемые соединения, выбранные из предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в двух дозах и наполнитель в качестве контроля вводили s.c. в сочетании с однократным интраназальным введением блеомицина и осуществляли анализ мышей через 1 и 10 дней. Применяемые для создания модели животные представляли собой мышей линии C57BL/6 (8-недельного возраста) по 10 особей на группу. Экспериментальные группы представляли собой группу, обработанную наполнителем, 0,001 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, и 0,1 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, и обработка заключалась в повторном подкожном введении этих предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, до введения блеомицина и затем каждые 3 дня. Через 24 ч осуществляли мониторинг острого воспаления легких с помощью осуществления BAL-лаважа, цитологического обследования, определения количества клеток и определения активности легочной миелопероксидазы. Воздействие соединения сравнивали с действием применяемого в качестве контроля наполнителя. Фиброз легкого оценивали гистологически с использованием окрашивания гематоксилином и эозином в день 10 после введения однократной дозы блеомицина.

1.1) Введение блеомицина

Блеомицина сульфат в физиологическом растворе (10 мг/кг веса тела) фирмы Bellon Laboratories (Монруж, Франция) или физиологический раствор вводили в дыхательные пути путем назальной инстилляции в объеме 40 мкл под слабой анестезией кетамином-ксилазином. Группы, обработанные блеомицином с целью индукции блеомицином как воспаления, так и фиброза, включали: группу, обработанную наполнителем, 0,001 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, и 0,1 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул. Для индукции блеомицином воспаления использовали подкожный (s.c.) путь введения, и ее осуществляли посредством введения однократной дозы. Для индукции блеомицином фиброза использовали подкожный (s.c.) путь введения, и ее осуществляли посредством трехкратного введения в течение 10 дней.

1.2) Жидкость бронхоальвеолярного лаважа (промывная бронхоальвеолярная жидкость) (BALF)

После рассечения трахеи встраивали пластиковую канюлю и воздушное пространство промывали, используя 0,3 мл раствора ЗФР, нагретого до 37°С. Собранные образцы разделяли на 2 фракции: первую (1 мл, что соответствует двум первым лаважам) применяли для оценки медиатора, а вторую для определения клеток (4 мл). Первую фракцию центрифугировали (600 g в течение 10 мин) и супернатант фракционировали и выдерживали при -80°С до определения медиатора. Клеточный дебрис затем ресуспендировали в 0,4 мл стерильного 0,9%-ного NaCl, объединяли со второй фракцией и применяли для подсчета клеток.

1.3) Гомогенизация легкого

После осуществления BAL легкое целиком изымали и помещали внутрь микротрубки (лизирующий матрикс D, фирма Q Bio Gene, Иллкирх, Франция) с 1 мл ЗФР, получали экстракт всей легочной ткани с помощью системы Fastprep® (FP120, фирма Q Bio Gene, Иллкирх, Франция), затем экстракт центрифугировали и супернатант хранили при -80°С до определения медиатора и анализа коллагена на основе анализа коллагена с помощью Sircol (фирма France Biochem Division, Франция).

1.4) Подсчет и определение клеток

Общее количество клеток определяли в BAL-жидкости с помощью гемоцитометра Malassez. Дифференциальный подсчет клеток осуществляли на цитоспиновых препаратах (цитоспин 3, фирма Thermo Shandon) после окрашивания с помощью MGG Diff-quick (фирма Dade Behring AG). Дифференциальный подсчет клеток проводили для 200 клеток на основе стандартных морфологических критериев.

1.5) Оценка TNF

Уровень TNF в BALF определяли с помощью наборов для ELISA (Mouse DuoSet, фирма R&D system, Миннеаполис, США), используя инструкции производителя. Результаты представлены в пг/мл.

1.6) Оценка МРО

Уровни МРО оценивали после введения предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200.

1.7) Гистология

После осуществления BAL и перфузии легкого большую долю фиксировали в 4% забуференного формальдегида для стандартного микроскопического анализа. 3-мкметровые срезы окрашивали гематоксилином и эозином (Н&Е).

Пример 22: Определение активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116. и полученные из JNK1 или IB1 карго-пептиды. последовательность которых представлена в любой из SEO ID NO:117-200, при лечении болезни Альцгеймера

Для определения активности репрезентативных предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в отношении болезни Альцгеймера эти пептиды изучали, используя в качестве модели трансгенных мышей лини hAPP, которые отличались сверхэкспрессией АРР751 с мутациями типа London и Swedish, с использованием поведенческого теста, основанного на применении водного лабиринта Морриса, а также иммуногистохимических тестов, позволяющих оценивать загрузку бляшками, и ELISA-тестов, позволяющих оценивать уровни β-амилоида1-40 и β-амилоида1-42 в головном мозге мышей.

а) Методы

I) Введение

Опыт был спланирован с целью оценки эффективности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в отношении поведенческих, биохимических и гистологических маркеров, его проводили на самках Tg-мышей линии hAPP возрастом 5 месяцев (±2 недели). Для этой цели мышей обрабатывали каждые 2-3 недели в течение вплоть до 4 месяцев и в конце периода обработки оценивали поведение с помощью водного лабиринта Морриса. После умерщвления брали образцы головного мозга, СМЖ и крови. Уровни Аβ40 и Аβ42 определяли в четырех различных фракциях гомогената головного мозга, а также в СМЖ Tg-мышей. Загрузку бляшками оценивали количественно в корковом слое и гиппокампе восьми Tg-животных на каждую группу обработки.

II) Животные

Самок Tg-мышей, имевших генетический фон C57BL/6xDBA, и возрастом 5 месяцев (±2 недели) произвольно разделяли на группы обработки 1-3 (n=12). Животным вводили наполнитель или предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в двух различных концентрациях, начиная с 5-месячного возраста и в течение вплоть до 4 месяцев с помощью подкожных (s.c.) инъекций каждую вторую или третью неделю. Все животные, которых использовали для настоящего опыта, имели темные глаза и хорошо воспринимали ориентиры вне MWM-бассейна. Однако животных исключали из опыта при обнаружении того, что они обладают плохой способностью видеть, что контролировали перед началом обработки с помощью обучения всех животных, включая резервных особей, включенных в опыт, с использованием видимой платформе, так называемого предварительного теста. В случае подтверждения обнаруженного у конкретного животного недостатка, мышь исключали из опыта.

III) Идентификация животных и их содержание

Мышам присваивали индивидуальные идентификационные номера с помощью ушных маркеров. Их содержали в отдельных вентилируемых клетках (IVC) на стандартизованной подстилке для грызунов с добавлением Rettenmaier®. В каждую клетку помещали максимум 5 мышей. Мышей содержали согласно стандартным процедурам обращения JSW (Standard Operating Procedures) (SOP GEN011), лежащим в основе международных стандартов. Каждую клетку отмечали цветной карточкой, на которой были указаны номер опыта, пол, индивидуальные регистрационные номера (IRN) животных, дата рождения, а также дата скрининга и принадлежность к группе обработки. Температуру во время опыта поддерживали на уровне примерно 24°С, а относительную влажность поддерживали на уровне примерно 40-70%. Животных содержали при постоянном световом цикле (12 ч свет/темнота). Животные имели свободный доступ к обычной водопроводной воде.

IV) Обработка

Сорок самок трансгенных мышей линии hAPP обрабатывали предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в двух различных дозах (n=12/группу), а именно, либо в дозе 0,1 мг/кг веса тела/каждые две недели, либо 10 мг/кг веса тела/каждые три недели, либо наполнителем (n=12) s.c. один раз каждые три недели в течение четырех месяцев.

V) Водный лабиринт Морриса (MWM)

Тест с использованием водного лабиринта Морриса (MWM) проводили в черном округлом бассейне диаметром 100 см. Его заполняли водопроводной водой с температурой 22±1°С и бассейн фактически разделяли на четыре сектора. Прозрачную платформу (диаметром 8 см) помещали примерно на 0,5 см ниже поверхности воды. Во время всего периода испытания за исключением предварительного тестирования платформа находилась в юго-западном квадранте бассейна. За один день до периода обучения продолжительностью 4 дня животных подвергали так называемому «предварительному тестированию (тесту)» с использованием платформы (два опыта продолжительностью по 60 с) для гарантии того, что способность видеть каждого животного была нормальной. Только животные, полностью справившиеся с таким заданием, были включены в MWM-тест. При решении задания, связанного с использованием MWM, каждую мышь подвергали трем испытаниям в течение четырех последовательных дней. Одно испытание продолжалось самый максимум 1 мин. В это время мышь имела возможность найти укрытие, прозрачную мишень. Если животное не могло найти «путь» вне воды, исследователь направлял мышь к платформе или помещал ее на платформу. После каждого испытания мыши давали отдыхать на платформе в течение 10-15 с. В это время мыши имели возможность сориентироваться в окружающей среде. Исследователи находились в условиях с пониженной освещенностью для предотвращения отрицательного воздействия на систему маршрута (Kaminski; PCS, фирма Biomedical Research Systems). На окружающих бассейн стенках фиксировали плакаты с геометрическими символами, выполненными черным жирным цветом (например, круг или квадрат), которые мыши могли использовать в качестве ориентиров при ориентации. Одна плавающая группа, применяемая в одном испытании, состояла из 5-6 мышей, поэтому был гарантирован промежуток времени между испытаниями, составляющий примерно 5-10 мин. Для количественной оценки латентности избегания (время [с], необходимое мыши для того, чтобы найти укрытие на платформе и следовательно избежать попадания в воду), пути (длина траектории [в метрах] до достижения мишени) и пребывания в требуемом квадранте использовали компьютеризованную систему отслеживания пути. Компьютер соединяли с видеокамерой, помещенной над центром бассейна. Камера обнаруживала сигнал светоиспускающего диода (LED), который фиксировали с помощью небольшого зажима для волос на хвосте мыши. Через 1 ч осле последнего испытания в день 4 мышей подвергали так называемому пробному испытанию. В этот момент платформу удаляли из бассейна и в течение 1 мин осуществляли пробное испытание; экспериментатор подсчитывал количество пересечений предыдущего положения мишени. Кроме того, подсчитывали время пребывания в этом квадранте, а также в трех других квадрантах. Во время этого испытания мышь не могла получать никакой сколько-нибудь естественной информации («ключа») от платформы.

VI) Получение образцов тканей

В конце периода обработки и после проведения всех поведенческих опытов всех оставшихся мышей (n=28) умерщвляли. Для этого на всех мышей воздействовали седативным средством посредством стандартной ингаляционной анестезии (изофлуран, фирма Baxter) согласно методу, описанному в SOP МЕТ030. Спинномозговую жидкость (СМЖ) получали путем отслаивания и обнажения большого затылочного отверстия (foramen magnum). После обнажения вносили пастеровскую пипетку на глубину примерно 0,3-1 мм в больше затылочное отверстие. СМЖ собирали отсасыванием и посредством капиллярного действия до полного прекращения потока. По две аликвоты каждого образца немедленно замораживали и выдерживали при -80°С до проведения дополнительного анализа с помощью метода ELISA. После получения образцов СМЖ каждую мышь помещали в лежачее положение на спину, вскрывали грудной отдел и вносили иглу 26-размера, присоединенную к шприцу вместимость 1 см3, в камеру правого желудочка сердца. Осуществляли слабый отсос через иглу и собирали кровь в ЭДТК и затем использовали для получения плазмы. Для получения плазмы образцы крови каждой мыши центрифугировали при 1750 об/мин (700×g) в течение 10 мин в центрифуге (GS - 6R, фирма Beckman), используя ротор для качающихся корзин (GH - 3.8, фирма Beckman). Плазму замораживали при -20°С и хранили до проведения дальнейшего анализа. После отбора образцов крови осуществляли внутрисердечную перфузию трансгенных мышей 0,9% хлорида натрия. Головной мозг быстро изымали и отрезали мозжечок. Правое полушарие мозга всех мышей подвергали иммерсионной фиксации в свежеприготовленной смеси 4% параформальдегида/ЗФР (рН 7,4) в течение 1 ч при комнатной температуре. Затем головной мозг переносили в раствор ЗФР, содержащий 15% сахарозы, на 24 ч для гарантии криопротекции. На следующий день головной мозг замораживали в изопентане и хранили при -80°С до применения в гистологических исследованиях (SOP MET042). Левое полушарие взвешивали и замораживали в жидком азоте и хранили при -80°С для биохимического анализа.

VII) Определение уровней Аβ1-40 и Aβ1-42

В четырех различных фракциях гомогенатов головного мозга каждой Tg-мыши, а также в образцах СМЖ, оценивали уровни Aβ1-40 и Aβ1-42 с помощью метода ELISA. Тест-наборы ELISA с высокой чувствительностью к Aβ1-40 и Aβ1-42 покупали у фирмы The Genetics Company™, Швейцария {SOP МЕТ058). СМЖ получали согласно описанному выше методу. Для получения гомогенатов головного мозга замороженные полушария гомогенизировали в забуференном ТРИС физиологическом растворе ((TBS) - буфер) (5 мл), содержащем коктейль ингибиторов протеаз. 1,25 мл этого первичного полученного в TBS гомогената головного мозга хранили при -80°С, 1,25 мл подвергали дополнительному изучению. Оставшийся гомогенат головного мозга (2,5 мл) центрифугировали и образовавшийся супернатант (= TBS-фракция) разделяли на аликвоты и выдерживали при -20°С для исследования с помощью ELISA. Дебрис суспендировали в Тритон Х-100 (2,5 мл), центрифугировали и супернатант (= Тритон Х-100-фракция) разделяли на аликвоты и выдерживали при -20°С. Эти стадии повторяли с использованием ДСН (2,5 мл). Дебрис ДСН-фракции суспендировали в 70% муравьиной кислоты (0,5 мл) для осуществления последующего центрифугирования. Полученный супернатант нейтрализовали с помощью 1М ТРИС (9,5 мл), разделяли на аликвоты и выдерживали при -20°С (= FA-фракция). Образцы четырех фракций гомогенатов головного мозга (TBS, Тритон Х-100, ДСН и FA) применяли для определения уровней Aβ1-40 и Aβ1-42 с помощью метода ELISA. Тест-наборы для ELISA покупали у фирмы The Genetics Company™, Швейцария (SOP MET062). Следует отметить, что TBS и Тритон X-100 солюбилизировали мономеры с образованием олигомерных структур. Полимеры типа протофибрил и нерастворимые в воде фибриллы могли растворяться в ДСН и FA. Поэтому исследование всех четырех фракций также позволяет получать сведения о статусе полимеризации Аβ.

VIII) Оценка морфологического строения головного мозга

Ткани головного мозга всех изученных Tg-животных подвергали совершенно одинаковой обработке для того, чтобы избежать влияния вариации этой процедуры. Из половины образцов головного мозга, полученных из 24 Tg-мышей (по 8 в каждой группе), приготавливали по 20 сагиттальных криосрезов на слой (всего 5 слоев), каждый толщиной Юмкм (Leica CM 3050S) и 5 (по одному из каждого слоя) обрабатывали и оценивали количественно загрузку бляшками. Пять сагиттальных слоев соответствовали чертежам 104-105, 107-108, 11-112, 115-116 и 118-119 в морфологическом атласе «The Mouse Brain» Paxinos и Franklin (2-е изд.). Первый слой в соответствии с требованиями включал весь гиппокамп с его областями СА1, СА2, СА3, GDlb и GDmb. Иммунореактивность оценивали количественно в гиппокампе и в корковом слое с использованием моноклонального специфического для человеческого Аβ антитела 6Е10 (фирма Signet), а также путем окрашивания тиофлавином S. Остальные неиспользованные полушария или ткани сберегали и хранили согласно JSW CNS до окончания проекта.

б) Осуществление оценки

I) Поведение

В опытах с использованием водного лабиринта Морриса с помощью специальной компьютерной программы оценивали для каждого Tg-животного длину дорожки, которую проплывали животные, латентность избегания, скорость плавания и в пробном испытании количество пересечений предыдущего положения платформы и время, проведенное в каждом квадранте бассейна.

II) Биохимическая оценка

Образцы СМЖ всех Tg-мышей, а также препараты головного мозга анализировали с помощью имеющихся в продаже Aβ1-40- и Aβ1-42- ELISA. Параллельно осуществляли оценку соответствующих стандартов. Образцы препаратов головного мозга анализировали с дублированием. Из-за небольшого размера образца образцы СМЖ анализировали только с использованием одного измерения.

III) Гистология

I1) Оценка отложения амилоида и загрузки бляшками

Для иммуногистохимического анализа с помощь 6Е10 использовали следующую процедуру оценки:

аа) контрастировали изображение для визуализации границ среза без применения контраста для изображения;

бб) получали интерактивный рисунок кортикальных наружных контуров и затем измеряли кортикальную площадь (= площадь области);

вв) получали интерактивный рисунок представляющей интерес области (AOI), на котором окрашенные объекты выявляли на основе определенной интенсивности относительно порогового уровня (одинаковый для каждого изображения) и по размеру, превышающему 8 мкм2;

гг) измеряли площадь каждого объекта, сумму окрашенных площадей в AOI, а также количество объектов после однородного контрастирования с целью повышения соотношения сигнал/шум (одинаковое для каждого изображения);

дд) повторяли стадии аа)-гг) для гиппокампа;

ее) рассчитывали средний размер бляшек (= «сумма площадей бляшек/количество бляшек»), относительное количество бляшек и площадь (= «количество бляшек/площадь области» и «сумма площадей бляшек/площадь области × 100»);

жж) автоматически экспортировали данные в программу Excel для обработки крупноформатных таблиц, включая следующие параметры «обозначение изображения, площадь области, количество бляшек, сумма площадей бляшек, относительное количество бляшек, относительная площадь бляшек и средний размер бляшек». Поле для комментариев использовали для регистрации качества изображения и критериев исключения соответственно. Критериями исключения являлись: отсутствие частей среза, большое количество складок, наличие доминирующих трещин или противоречивая (изменчивая) окраска (например, из-за выпуклостей, которые могут препятствовать полной реакции блокирующего реагента);

зз) закрывали изображение, не запасая его (чтобы держать необработанные данные в исходном состоянии).

Пример 23. Определение активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116. и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, при лечении диабета типа 2

Целью исследования было определение активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, в отношении лечения диабета типа 2, прежде всего определение действия длительной обработки предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, на модели на мышах линии db/db диабета типа 2 по уровням глюкозы в крови натощак каждые три дня (28 дней).

а) Материалы и методы

I) Животные

В целом двадцать (20) самцов мышей линии db/db (8-недельного возраста) получали от фирмы Charles River (Германия). После прибытия животных разделяли на группы (n=6-7/группу) и содержали на обычном корме для грызунов (корм Altromin standard №1324; фирма С.Petersen, Рингстед, Дания) и, если не указано иное, животные имели свободный доступ к воде.

Мышей содержали при световом цикле 12:12 свет/темнота (свет включали в 4:00 и свет выключали в 16:00) и при контролируемой температуре и влажности в помещении.

II) Группы и рандомизация

В день -4 мышей произвольно разделяли на группы в зависимости от уровня глюкозы в крови (натощак; уровень глюкозы в крови измеряли с помощью анализатора Biosen S line (фирма EKF diagnostic, Германия), группы подвергали одному из следующих вариантов обработки лекарственным средством (n=6):

1) наполнитель, контроль, s.c. (физиологический раствор),

2) предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200; 1 мг/кг; s.c.,

3) предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200; 10 мг/кг; s.c.

Все указанные дозы даны в пересчете на свободное основание. Чистота лекарственного средства: 95,28%, содержание пептидов: 78,0%. Все соединения вводили подкожно (s.c.) в объеме 3 мл/кг. Инструкции по приготовлению препаративных форм для применяемого в качестве контроля наполнителя и предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, включали следующие этапы:

Сначала предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, растворяли в наполнителе. Препаративные формы (концентрации 0,33 и 3,3 мг/мл, соответствующие дозам 1 и 10 мг/кг соответственно) приготавливали согласно описанной ниже процедуре. Рассчитывали концентрации и выражали их величины с учетом чистоты субстанции и содержания пептидов (коэффициент умножения 1,346).

- Получение маточного раствора: высушенные вымораживанием предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:1-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:117-200, оттаивали в течение минимум 1 ч и приготавливали в виде маточного раствора в наполнителе в концентрации 1 мМ (соответствует 3,823 мг/мл). Готовили аликоваты для каждого дня обработки и хранили примерно при -80°С. Разведения этого маточного раствора до требуемых концентраций осуществляли в каждый день обработки;

- Хранение маточного раствора: примерно при -80°С;

- Хранение разведенных препаратов: при комнатной температуре в течение максимум 24 ч.

Перед солюбилизацией порошок хранили при -20°С. Стабильность маточного раствора сохранялась в течение 3 месяцев при хранении примерно при -80°С; стабильность разведенных препаративных форм для обработки животных сохранялась в течение 24 ч при хранении при комнатной температуре. Неиспользованный разбавленный продукт можно было хранить в течение периода времени, составлявшего вплоть до 7 дней, если хранение осуществляли при 4-8°С.

в) Экспериментальная процедура

После акклиматизации в течение 8 дней мышей обрабатывали ежедневно в 08.00 AM в течение 21 дня путем s.с. - введения доз за 8 ч до включения света в 04.00 РМ в соответствии с указанными группами.

I) Уровень глюкозы в крови

Уровень глюкозы оценивали у голодавших в течение 7 ч животных через 6 ч после дозирования, для чего собирали по 10 мкл образцов крови из хвостовой вены в пробирку для гематокритной центрифуги и затем анализировали на анализаторе Biosen s-line (фирма EKF-diagnostic; Германия).

II) Клетки для изучения метаболизма (метаболические клетки)

Группы 1+3: Мышей помещали в метаболические клетки для регистрации в течение 24 ч потребления корма, воды, а также выделения в течение 24 ч мочи и экскрементов. Мышей подразделяли на 2 подгруппы n=6-7 и затем осуществляли изучение метаболических характеристик.

III) Панель адипокинов

Группы 1+3: Трижды (дни опыта 57, 66 и 108) получали образцы крови из хвостовой вены, используя покрытые ЭДТК пробирки для гематокритной центрифуги (100 мкл). После центрифугирования крови собирали плазму и хранили при -20°С до осуществления оценки. Затем определяли следующую панель адипокинов/цитокинов, используя 7-плексный набор фирмы Luminex: лептин, резистин, МСР-1, PAI-1, TNFα, инсулин и интерлейкин-6 (IL-6).

IV) Окончание опыта

Группы 1+3 (день 111): Изымали и взвешивали следующие органы: ингвинальный подкожный жир, эпидидимальный жир, ретроперитонеальный жир, головной мозг, печень, почка, селезенка и сердце. Образцы всех указанных выше органов приготавливали в 4% PFA для возможной гистопатологической оценки в будущем. Кроме того, готовили образцы поджелудочных желез (целиком) для возможных стереологических и иммуногистохимических анализов, а образцы глаз готовили для возможных анализов ретинопатии. Группа 2 (день 28): Не получали образцов тканей или плазмы.

Пример 24. Популяции человеческих лейкоцитов в качестве мишеней для производных ТАТ

Получали первичные человеческие лейкоциты (WBC) из цельной крови после лизиса эритроцитов. WBC инкубировали с 1 мкМ D-TAT (SEQ ID NO:4)-ФИТЦ или r3-L-TAT (SEQ ID NO:15)-ФИТЦ в течение 30 мин при 37°С, отмывали кислотным буфером и окрашивали флуоресцентномеченными антитела к специфическим поверхностным маркерам разных типов клеток (CD 14 для моноцитов, CD15 для полиморфно-ядерных лейкоцитов, CD3 для Т-лимфоцитов, CD19 для В-лимфоцитов). И, наконец, клетки, содержащие D-TAT-ФИТЦ и r3-L-ТАТ-ФИТЦ, анализировали с помощью проточной цитометрии для оценки содержания в них соответствующего транспортера. Мишенью обоих производных ТАТ являлись популяции человеческих лейкоцитов. DTAT и r3LTAT связывались с моноцитами, нейтрофилами и Т-лимфоцитами и менее эффективно с В-лимфоцитам. Обнаружено небольшое различие специфичности между DTAT и r3-L-TAT, D-TAT, вероятно, более эффективно связывался с Т-лимфоцитами, чем r3-L-TAT.

Пример 25. Поглощение выбранных конструкций транспортеров, предлагаемых в настоящем изобретении, различными типами клеток

Клетки высевали в предварительно сенсибилизированные поли-D-лизином 96-луночные планшеты с плотностью, соответствующей субконфлюэнтной культуре (которая может варьироваться в зависимости от применяемого типа клеток). Затем различные сцепленные с ФИТЦ транспортеры в концентрации 3 мкМ инкубировали с клетками в течение 15 ч. После этого клетки выдерживали на льду для осуществления остальной процедуры. Для удаления связанных с клеточной поверхностью пептидов клетки сначала отмывали дважды, используя кислотную отмывку, для удаления связанных с плазматической мембраной молекул. Затем клетки отмывали дважды ЗФР и лизировали с помощью стандартного буфера для лизиса в течение 30 мин. Затем планшеты, содержащие клеточные лизаты, центрифугировали в течение 5 мин при 1500 об/мин при 4°С. Затем прозрачный супернатант собирали и переносили в черный 96-луночный планшет для оценки флуоресценции внутриклеточного ФИТЦ. Применяли следующие клетки:

Линии клеток лейкоцитов: Raw: клетки макрофагов (мышиные)
J77: клетки макрофагов (мышиные)

Первичные очищенные лейкоциты: BMDM: макрофаги из костного мозга (мышиные)

Результаты выражали в виде процента поглощения D-TAT (SEQ ID NO:4) (фиг.17) или r3-L-TAT (SEQ ID NO:15) (фиг.18). Для всех конструкций транспортеров обнаружено поглощение соответствующими клетками, хотя и с различной скоростью.

Пример 26. Иммуногистохимический анализ лап при индуцированном CFA-воспалении (4 ч)

В этом опыте использовали самцов мышей линии С57/В16 8-недельного возраста. Периферическое воспаление индуцировали путем подкожной инъекции полного адъюванта Фрейнда (CFA) (фирма Sigma, 20 мкл) в левую заднюю лапу, использую непродолжительную анестезию изофлуораном. Обработанным XG-102 (SEQ ID NO:233) животным вводили в виде однократной болюсной i.v.-инъекции XG-102 в дозе 10 мкг/кг за 1 ч до инъекции CFA. Мышей умерщвляли через 4 ч после инъекции CFA путем перфузии сердца 4% PFA в ЗФР. Задние лапы подвергали криопроотекции в сахарозе (30% в ЗФР) и затем замораживали, используя жидкий изопентан, и хранили для последующего получения срезов с использованием криостата. Срезы окрашивали либо гематоксилином и эозином (Н&Е), либо обрабатывали для иммуноокрашивания XG-102 (SEQ ID NO:233). Срезы сначала обрабатывали для облегчения окрашивания в течение 30 мин 0,3% Н2О2 в метаноле и промывали в течение 3 мин Н2О, а затем в течение 5 мин промывали ЗФР. После этой стадии срезы предварительно инкубировали в течение 45 мин в ЗФР, содержащем 15% сыворотки и 0,3% Тритона, а затем в течение ночи инкубировали при КТ с первичным антителом (кроличье поликлональное антитело к XG102, разведение 1/1000), разведенным в 1,5% сыворотки, 0,1% Тритона в ЗФР. Затем срезы инкубировали в течение 2 ч при КТ с соответствующим биотинилированным вторичным антителом, отмывали трижды в ЗФР и инкубировали в течение 2 ч при КТ с комплексом стрептавидин-биотин-пероксидаза (АВС-набор, Vectastain, фирма Vector Laboratories). Иммуномечение проявляли после трехкратной отмывки ЗФР, используя 2,3'-диаминобензиден в качестве субстрата, который разводили в соотношении 1/10 в буфере, предложенном производителем (фирма Roche). И, наконец, срезы дегидратировали и монтировали с помощью Eukitt (фирма Kindler GmBH). Всех животных обрабатывали для иммуноокрашивания в одном и том же эксперименте и их подвергали обследованию в одно и то же время. Окрашивание HRP (нижние панели) продемонстрировало присутствие XG-102 в инфильтрующихся лейкоцитах у обработанных CFA-XG-102 животных.

Пример 27. Окрашивание CD11b

В этом опыте использовали самцов мышей линии С57/В16 8-недельного возраста. Периферическое воспаление индуцировали путем подкожной инъекции полного адъюванта Фрейнда (CFA) (фирма Sigma, 20 мкл) в левую заднюю лапу, использую непродолжительную анестезию изофлуораном. Обработанным XG-102 (SEQ ID NO:233) животным вводили в виде однократной болюсной i.v.-инъекции XG-102 в дозе 10 мкг/кг за 1 ч до инъекции CFA. Мышей умерщвляли через 4 ч после инъекции CFA путем перфузии сердца 4% PFA в ЗФР. Задние лапы подвергали криопроотекции в сахарозе (30% в ЗФР) и затем замораживали, используя жидкий изопентан, и хранили для последующего получения срезов с использованием криостата. Срезы окрашивали либо антителом к XG-102, либо CD11b, который применяли в качестве маркера поверхности лейкоцитов. Срезы сначала для облегчения окрашивания обрабатывали в течение 30 мин 0,3% H2O2 в метаноле и промывали в течение 3 мин Н2О, а затем в течение 5 мин промывали ЗФР. После этой стадии срезы предварительно инкубировали в течение 45 мин в ЗФР, содержащем 15% сыворотки и 0,3% Тритона, а затем в течение ночи инкубировали при КТ с первичным антителом (кроличье поликлональное антитело к XG102, разведение 1/1000), разведенным в 1,5% сыворотки, 0,1% Тритона в ЗФР. Затем срезы инкубировали в течение 2 ч при КТ с соответствующим биотинилированным вторичным антителом, отмывали трижды в ЗФР и инкубировали в течение 2 ч при КТ с комплексом стрептавидин-биотин-пероксидаза (АВС-набор, Vectastain, фирма Vector Laboratories). Иммуномечение проявляли после трехкратной отмывки ЗФР, используя 2,3'-диаминобензиден в качестве субстрата, который разводили в соотношении 1/10 в буфере, предложенном производителем (фирма Roche). И, наконец, срезы дегидратировали и монтировали с помощью Eukitt (фирма Kindler GmBH). Всех животных обрабатывали для иммуноокрашивания в одном и том же эксперименте, и их подвергали обследованию в одно и то же время.

Пример 28. Выявление и кинетические характеристики XG-102 (SEQ ID NO:233) при изучении на клетках цельной крови крыс

Самцов крыс линии Sprague Dawley весом 180-200 г обрабатывали XG-102 (SEQ ID NO:233) в виде однократной болюсной i.v-инъекции в дозе 0,1 мг/кг. Момент инъекции рассматривался как референс-время для последующего отбора образцов. Крыс умерщвляли через различные промежутки времени после инъекции: через 30 мин, 24 ч, 3 дня, 7 дней, 14 дней и 27 дней. Крыс умерщвляли обескровливанием. Затем для приготовления гистологических срезов удаляли цепь мезентерических лимфатических узлов (и при возможности шейные, подмышечные, плечевые, почечные и поясничные лимфатические узлы). Органы промывали в 1×ЗФР при 4°С и фиксировали в течение ночи в 4% РАР4/1×ЗФР при 4°С. Через 24 ч образцы промывали 3×10 мин при перемешивании в 1×ЗФР при 4°С и погружали в 30% сахарозы/1×ЗФР до полного покрытия LN (лимфатических узлов). Затем образцы замораживали в изопентане в течение 3 мин при -(35-40)°С в пробирке на сухом льду. После приготовления срезов с использованием криостата срезы обрабатывали для иммуноокрашивания XG-102. Срезы после криостата сначала обрабатывали для облегчения окрашивания 30 мин 0,3% H2O2 в метаноле и промывали в течение 3 мин в H2O, а затем 5 мин промывали ЗФР. Затем срезы предварительно инкубировали в течение 45 мин в ЗФР, содержащем 15% сыворотки и 0,3% Тритона, а затем в течение ночи инкубировали при КТ с первичным антителом (кроличье поликлональное антитело к XG102, разведение 1/1000), разведенным в 1,5% сыворотки, 0,1% Тритона в ЗФР. Затем срезы инкубировали в течение 2 ч при КТ с соответствующим биотинилированным вторичным антителом, отмывали трижды в ЗФР и инкубировали в течение 2 ч при КТ с комплексом стрептавидин-биотин-пероксидаза (АВС-набор, Vectastain, фирма Vector Laboratories). После трехкратной отмывки с помощью ЗФР иммуномечение проявляли, используя 2,3'-диаминобензиден в качестве субстрата, который разводили в соотношении 1/10 в буфере, предложенном производителем (фирма Roche). И, наконец, срезы дегидратировали и монтировали с помощью Eukitt (фирма Kindler GmBH). Всех животных обрабатывали для иммуноокрашивания в одном и том же эксперименте и их подвергали обследованию в одно и то же время.

Пример 29. Локализация ФИТЦ-XG-102 (SEO ID NO:233) и ФИТЦ-D-TAT (SEQ ID NO:4) в печени и лимфатических узлах

Самкам крыс линии Sprague Dawley инъецировали i.v. в хвостовую вену либо 1 мг/кг ФИТЦ-XG102 (SEQ ID NO:233), либо 1 мг/кг ФИТЦ-D-TAT (SEQ ID NO:4). Крыс умерщвляли через 6 ч после инъекции, используя летальную дозу пентобарбитала натрия (150 мг/кг i.p.). Для гистологического анализа и в процессе наркоза осуществляли перфузию сердца крыс 4% параформальдегидом (PFA) в ЗФР. Органы (печень и лимфатические узлы) подвергали криопротекции в сахароза (30% в ЗФР), замораживали в жидком изопентане и хранили для дальнейшего приготовления срезов с использованием криостата. Срезы толщиной 14 мкм инкубировали в течение 5 мин в ЗФР перед окраской с помощью красителя Hoechst в течение 2 мин при КТ (1 мкг/мл). После отмывки с помощью ЗФР срезы заключали в заливочную среду Fluorsave. Срезы визуализировали с помощью эпифлуоресцентного микроскопа.

1. Применение молекулы-конъюгата, которая является транспортером карго-молекулы, для лечения, профилактики, ослабления и/или уменьшения интенсивности заболевания и/или нарушения, в котором принимают участие лейкоциты, где молекула-конъюгат, которая является транспортером карго-молекулы, содержит:
а) в качестве компонента (А): полипептид, имеющий остатки 49-57 (SEQ ID NO:2) аминокислотной последовательности ТАТ ВИЧ или ее вариант,
б) в качестве компонента (Б): (фармацевтически активную) карго-молекулу, и где вариант SEQ ID NO:2 выбирают из группы, включающей:
I) полипептид, содержащий одну или две аминокислотные последовательности, представленные в SEQ ID NO:235, или обратную ей последовательность, и
II) полипептид, содержащий одну или две аминокислотные последовательности, представленные в любой из SEQ ID NO:2-116, или обратную ей последовательность.

2. Применение по п. 1, в котором заболевание и/или нарушение, в котором принимают участие лейкоциты, выбирают из группы, включающей: рак и опухолевые заболевания, включая болезни, вызываемые нарушенным апоптозом; воспалительные заболевания, инфекционные болезни, включая бактериальные и вирусные (инфекционные) болезни, болезни, в значительной степени связанные с передачей сигналов JNK, аутоиммунные нарушения или заболевания, сердечно-сосудистые заболевания, нейронные или нейродегенеративные заболевания, болезни печени, болезни позвоночника, болезни матки, большие депрессивные нарушения, нехронические или хронические заболевания пищеварительной системы, диабет, потерю волос, потерю слуха или болезни внутреннего уха.

3. Применение по любому из пп. 1-2, в котором заболевание и/или нарушение, в котором принимают участие лейкоциты, выбирают из вирусных инфекций, в частности вирусных инфекций лейкоцитов.

4. Применение по любому из пп. 1-2, в котором заболевание и/или нарушение, в котором принимают участие лейкоциты, представляет собой инфекционные болезни, вызываемые агентом, выбранным из группы, включающей: ВИЧ, вирус Эпштейна-Барра, морбилливирус (корь), парамиксовирус, рубивирус, вирус герпеса типа 6, вирус герпеса, вирус лихорадки Денге, вирус герпеса простого 1, вирус герпеса простого 2, парвовирус, респираторно-синцитиальный вирус, вирус натуральной оспы, вирус ветряной оспы, флавивирус, человеческий Т-лимфотропный вирус типа 1, человеческий Т-лимфотропный вирус типа 2, человеческий Т-лимфотропный вирус типа 3, человеческий Т-лимфотропный вирус типа 4, вирус гепатита А, вирус гепатита В, вирус гепатита С, вирус гепатита D, вирус гепатита Е, вирус лихорадки Ласса, вирус гриппа А (включая подтипы H1N1 и H3N2), вирус гриппа В, вирус гриппа С.

5. Применение по любому из пп. 1-2, в котором заболевание и/или нарушение, в котором принимают участие лейкоциты, выбирают из группы, включающей: нейтрофилию, нейтропению, лейкопению, базопению, базофилию, эозинопению, эозинофилию, идиопатический гиперэозинофильный синдром, лимфолейкоз, лимфоцитоз, лимфоцитопению, моноцитоз, моноцитопению, аномалию Мая-Хеглина, аномалию Пельгера-Хюэта, аномалию Альдера-Рейли, синдром Чедиака-Хигаси, синдром Джобса (гипер-IgE), синдром «ленивых» лейкоцитов, врожденный дефицит С3, хроническую гранулематозную болезнь, лейкоцитарный дефицит глюкозо-6-фосфатдегидрогеназы, дефицит миелопероксидазы, доброкачественный тяжелый комбинированный иммунодефицит, синдром Ди Георге, синдром Незелоф, связанную с полом агаммаглобулинемию у детей, общую вариабельную гипогаммаглобулинемию, мукополисахаридоз, липодоз, болезнь Гоше, болезнь Ниманна-Пика, болезнь Фабри, болезнь Фарбера, ганглиозидоз; болезнь Тау Тея-Сакса, болезнь Сандхоффа, болезнь Краббе, метахроматическую лейкодистрофию, болезнь Вольмана, лейкоз, острый лимфоцитарный лейкоз (L1, L2, L3), хронический лимфоцитарный лейкоз, острый миелогенный лейкоз (AML), недифференцированный AML (МО), миелобластный лейкоз (Ml), миелобластный лейкоз (М2), промиелоцитарный лейкоз (М3), миеломоноцитарный лейкоз (М4), моноцитарный лейкоз (М5), эритолейкоз (М6), мегакариобластный лейкоз (М7), хронический миелогенный лейкоз.

6. Применение по любому из пп. 1-2, в котором доза (на кг веса тела) молекулы-конъюгата, которая является транспортером карго-молекулы, составляет вплоть до 10 ммолей/кг, предпочтительно вплоть до 1 ммоля/кг, более предпочтительно вплоть до 100 мкмолей /кг, еще более предпочтительно вплоть до 10 мкмолей /кг, еще более предпочтительно вплоть до 1 мкмоля/кг, еще более предпочтительно вплоть до 100 нмолей/кг, наиболее предпочтительно вплоть до 50 нмолей/кг.

7. Применение по п. 6, в котором доза (на кг веса тела) молекулы-конъюгата, которая является транспортером карго-молекулы, составляет от примерно 1 пмоля/кг до примерно 1 ммоля/кг, от примерно 10 пмолей/кг до примерно 0,1 ммоля/кг, от примерно 10 пмолей/кг до примерно 0,01 ммоля/кг, от примерно 50 пмолей/кг до примерно 1 мкмоля/кг, от примерно 100 пмолей/кг до примерно 500 нмолей/кг, от примерно 200 пмолей/кг до примерно 300 нмолей/кг, от примерно 300 пмолей/кг до примерно 100 нмолей/кг, от примерно 500 пмолей/кг до примерно 50 нмолей/кг, от примерно 750 пмолей/кг до примерно 30 нмолей/кг, от примерно 250 пмолей/кг до примерно 5 нмолей/кг, от примерно 1 нмоля/кг до примерно 10 нмолей/кг или находится в пределах, представляющих собой комбинацию любых двух из указанных значений.

8. Применение молекулы-конъюгата, которая является транспортером карго-молекулы, для транспортировки представляющей интерес субстанции (карго-молекулы) в лейкоциты, где молекула-конъюгат, которая является транспортером карго-молекулы, содержит:
а) в качестве компонента (А): полипептид, имеющий остатки 49-57 (SEQ ID NO:2) аминокислотной последовательности ТАТ ВИЧ или ее вариант,
б) в качестве компонента (Б): карго-молекулу, и где вариант SEQ ID NO:2 выбирают из группы, включающей:
I) полипептид, содержащий одну или две аминокислотные последовательности, представленные в SEQ ID NO:235, или обратную ей последовательность, и
II) полипептид, содержащий одну или две аминокислотные последовательности, представленные в любой из SEQ ID NO:2-116, или обратную ей последовательность.

9. Применение полипептида, имеющего остатки 49-57 (SEQ ID NO:2) аминокислотной последовательности ТАТ ВИЧ или ее варианты, где вариант SEQ ID NO:2 выбирают из группы, включающей:
I) полипептид, содержащий одну или две аминокислотные последовательности, представленные в SEQ ID NO:235, или обратную ей последовательность, и
II) полипептид, содержащий одну или две аминокислотные последовательности, представленные в любой из SEQ ID NO:2-116, или обратную ей последовательность,
для получения молекулы-конъюгата, которая является транспортером карго-молекулы, для транспортировки представляющей интерес субстанции (карго-молекулы) в лейкоциты.

10. Применение по любому из пп. 1, 2, 8 или 9, в котором два или большее количество компонентов молекулы-конъюгата, которая является транспортером карго-молекулы, ковалентно связаны друг с другом, прежде всего компоненты (А) и (Б) ковалентно связаны друг с другом.

11. Применение по любому из пп. 1, 2, 8 или 9, в котором карго-молекулу (компонент (Б)) выбирают из группы, включающей:
а) белки или полипептиды, включая терапевтически активные белки и/или полипептиды,
б) ингибиторы протеинкиназ, включая ингибиторы протеинкиназы, такой как аминоконцевая киназа c-Jun, или факторы,
в) антигены,
г) антитела,
д) проапоптозные факторы,
е) протеазы, участвующие в патологических состояниях, включая ингибиторы пептидных протеаз,
ж) ВН3-домены,
з) белки «ВН3-только»,
и) ДНК,
к) РНК, включая siPHK, антисмысловые РНК, микроРНК,
л) цитотоксические агенты,
м) небольшие органические соединения,
н) низкомолекулярные фармацевтические средства,
о) частицы золота,
п) флуоресцентные красители,
р) антибиотики и/или
с) вирусостатики.

12. Применение по п. 1 или 8, в котором молекула-конъюгат дополнительно содержит один или несколько компонентов, выбранных из сигнальной последовательности или локализующей последовательности, которая обеспечивает направленность молекулы-конъюгата, которая является транспортером карго-молекулы, в конкретную внутриклеточную целевую область локализации или в конкретный тип клеток.

13. Применение по любому из пп. 1, 2, 8 или 9, в котором один, два или большее количество и/или все компоненты молекулы-конъюгата, которая является транспортером карго-молекулы, представляет(ют) собой белковую или полипептидную последовательность и состоит(ят) из L-аминокислот, D-аминокислот или их смесей.

14. Применение по любому из пп. 1, 2, 8 или 9, в котором вариант содержит или состоит из полипептидной последовательности, которая идентична по меньшей мере на 90% последовательности полипептида SEQ ID NO:2, при условии сохранения присущей ему функциональной активности.

15. Применение по любому из пп. 1, 2, 8 или 9, в котором карго-молекула представляет собой ингибитор аминоконцевой киназы c-Jun, выбранный из SEQ ID NO:117- 200 или их фрагментов или вариантов.

16. Применение по любому из пп. 1, 2, 8 или 9, в котором транспорт в лейкоциты осуществляют ex vivo.

17. Применение по любому из пп. 1, 2, 8 или 9, в котором лейкоциты представляют собой первичные клетки.

18. Применение по любому из пп. 1, 2, 8 или 9, в котором лейкоциты представляют собой иммортализованные клетки.

19. Применение по любому из пп. 1, 2, 8 или 9, в котором лейкоциты представляют собой трансгенные клетки.

20. Применение по любому из пп. 1, 2, 8 или 9, в котором лейкоциты выбирают из гранулоцитов, лимфоцитов, моноцитов, макрофагов, дендритных клеток, клеток микроглии и/или тучных клеток.

21. Применение по п. 20, в котором гранулоциты выбирают из группы, включающей нейтрофилы, эозинофилы и базофилы.

22. Применение по п. 20, в котором лимфоциты выбирают из NK-клеток, Т-клеток-хелперов, цитотоксических Т-клеток, γδ-Т-клеток и В-клеток.

23. Способ транспортировки представляющей интерес субстанции (карго-молекулы) в лейкоциты, заключающийся в том, что осуществляют следующую стадию:
I) приводят в контакт молекулу-конъюгат, которая является транспортером карго-молекулы, содержащую:
а) в качестве компонента (А): полипептид, имеющий остатки 49-57 (SEQ ID NO:2) аминокислотной последовательности ТАТ ВИЧ или ее вариант,
б) в качестве компонента (Б): карго-молекулу и
где вариант SEQ ID NO:2 выбирают из группы, включающей:
I′) полипептид, содержащий одну или две аминокислотные последовательности, представленные в SEQ ID NO:235, или обратную ей последовательность, и
II′) полипептид, содержащий одну или две аминокислотные последовательности, представленные в любой из SEQ ID NO:2-116, или обратную ей последовательность,
и лейкоцит

24. Способ по п. 23, в котором один или несколько компонентов выбирают из сигнальной последовательности или локализующей последовательности, которая обеспечивает направленность молекулы-конъюгата, которая является транспортером карго-молекулы, в конкретную внутриклеточную целевую область локализации или в конкретный тип клеток.

25. Выделенный лейкоцит, содержащий молекулу-конъюгат, которая является транспортером карго-молекулы, где молекула-конъюгат, которая является транспортером карго-молекулы, содержит:
а) в качестве компонента (А): полипептид, имеющий остатки 49-57 (SEQ ID NO:2) аминокислотной последовательности ТАТ ВИЧ или ее вариант,
б) в качестве компонента (Б): карго-молекулу
где вариант SEQ ID NO:2 выбирают из группы, включающей:
I) полипептид, содержащий одну или две аминокислотные последовательности, представленные в SEQ ID NO:235, или обратную ей последовательность, и
II) полипептид, содержащий одну или две аминокислотные последовательности, представленные в любой из SEQ ID NO: 2-116, или обратную ей последовательность, или его фрагменты.

26. Выделенный лейкоцит по п. 25, в котором один или несколько компонентов выбирают из сигнальной последовательности или локализующей последовательности, которая обеспечивает направленность молекулы-конъюгата, которая является транспортером карго-молекулы, в конкретную внутриклеточную целевую область локализации или в конкретный тип клеток.



 

Похожие патенты:

Изобретение относится к биотехнологии, а именно к способу получения экзосом из крови. Кровь разделяют на плазму и клеточную фракцию.

Изобретение относится к области биотехнологии, конкретно к рекомбинантной продукции белков человека, и может быть использовано в производстве химерных антител к фактору некроза опухоли человека.

Изобретение относится к области биотехнологии. Предложен способ культивирования эпителиальных стволовых клеток или выделенных фрагментов ткани, содержащих указанные эпителиальные стволовые клетки, включающий обеспечение внеклеточного матрикса, инкубирование эпителиальной стволовой клетки или выделенного фрагмента ткани, содержащего указанные эпителиальные стволовые клетки, с внеклеточным матриксом, культивирование эпителиальной стволовой клетки или выделенного фрагмента ткани в присутствии клеточной культуральной среды, содержащей базальную среду для клеток животного или человека, в которую добавлены ингибитор морфогенетического белка кости (BMP) и 5- 500 нг/мл митогенного фактора роста, а также клеточная культуральная среда, ее применение, способ культивирования трехмерного органоида, способ его получения, трехмерный органоид и его применение.

Изобретение относится к биотехнологии. Раскрыт способ выращивания эмбриональных стволовых клеток человека.

Изобретение относится к биотехнологии и медицине. Предложен способ дифференцировки мезенхимальных стволовых клеток фиброзированных легких в фибробластные клетки, характеризующийся тем, что из правой доли фиброзированных легких выделяют клетки с фенотипом мезенхимальных стволовых клеток (CD44+, CD73+, CD90+, CD106+, CD31-, CD34-, CD45-), способные самообновляться in vitro в течение 60 дней, затем при добавлении в культуру мезенхимальных стволовых клеток фактора роста фибробластов 2 мкг/мл получают фибробластные клетки.
Изобретение относится к области биотехнологии. ВНК-21/13-13 - перевиваемая монослойно-суспензионная сублиния клеток почки новорожденного сирийского хомячка задепонированна в Российской коллекции клеточных культур (РКК) в специализированной коллекции перевиваемых соматических клеточных культур сельскохозяйственных и промысловых животных при Всероссийском научно-исследовательском институте экспериментальной ветеринарии им.

Настоящее изобретение касается способа получения популяции клеток, экспрессирующих маркеры плюрипотентности и маркеры, характерные для линии сформированной эндодермы.

Группа изобретений относится к медицине, а именно к иммунологии, и может быть использована в лабораторной диагностике как тест-система и способ определения антивирусной активности интерферона альфа (ИФН-α) в сыворотке крови человека.

Изобретение относится к медицине, а именно к экспериментальной хирургии, и может быть использовано для лечения инфекционного перитонита в эксперименте. Для этого крысам внутривенно вводят суспензию аллогенных мезенхимальных стволовых клеток из расчета 1,5×106 на 100 г массы животного в 2 мл физиологического раствора.

Изобретение относится к области биотехнологии, в частности к выращиванию колоний клеток. Система культивирования плюрипотентных стволовых клеток состоит из соединенных между собой системы управления и блока культивирования.

Изобретение относится к области биотехнологии. .

Изобретение относится к области биотехнологии, вирусологии и иммунологии. .

Изобретение относится к области биотехнологии, вирусологии и медицины. .

Изобретение относится к области вирусологии и генетической инженерии. .

Изобретение относится к нуклеиново-кислотным конструкциям, а также к вакцинным препаратам, содержащим такие конструкции, и к применению таких препаратов в медицине.

Изобретение относится к области биотехнологии, иммунологии и вирусологии. .

Изобретение относится к соединениям пэгилированных полипептидов Т20. .

Настоящее изобретение относится к области биотехнологии. Предложены варианты гуманизированного анти-CD79b антитела, каждый из которых характеризуется наличием легкой и тяжелой цепи и набором 6 CDR с установленной аминокислотной последовательностью.
Наверх