Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph



Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph
Аналоги глюкагона, обладающие повышенной растворимостью и стабильностью в буферах с физиологическими значениями ph

 


Владельцы патента RU 2560254:

Индиана Юниверсити Рисерч энд Текнолоджи Корпорейшн (US)

Изобретение относится к области биотехнологии, конкретно к получению модифицированных пептидов глюкагона, и может быть использовано в медицине. Получают пептид глюкагона с активностью агониста глюкагона, характеризующийся аминокислотной последовательностью SEQ ID NO: 1, содержащей вплоть до 7 аминокислотных замещений по отношению к SEQ ID NO: 1, где одно из замещений аминокислот представляет собой замещение глютамина в положении 3 последовательности SEQ ID NO: 1 на аминокислоту, содержащую боковую цепь структуры I, и где аминокислота в положении 16 пептида глюкагона представляет собой аминоизомасляную кислоту (AIB). Изобретение позволяет получить агонисты глюкагона, обладающие повышенной растворимостью и стабильностью. 8 н. и 4 з.п. ф-лы, 17 ил., 12 табл., 28 пр.

 

ПЕРЕКРЕСТНЫЕ ССЫЛКИ НА РОДСТВЕННЫЕ ЗАЯВКИ

Настоящая заявка утверждает приоритет относительно следующих заявок: предварительная заявка на патент США No. 61/073193, зарегистрированная 17 июня 2008 года, предварительная заявка на патент США No. 61/078165, зарегистрированная 3 июля 2008 года, и предварительная заявка на патент США No. 61/090415, зарегистрированная 20 августа 2008 года. Описание каждого из указанных документов включено в настоящую заявку полностью в качестве ссылок.

ПРЕДПОСЫЛКИ СОЗДАНИЯ ИЗОБРЕТЕНИЯ

Проглюкагон представляет собой предшественник полипептидной природы, состоящий из 158 аминокислот, который процессируется в разных тканях с образованием множества разнообразных получаемых из проглюкагона пептидов, включающих глюкагон, глюкагон-подобный пептид-1 (GLP-1), глюкагон-подобный пептид-2 (GLP-2) и оксинтомодулин (OXM), которые вовлекаются в большое множество физиологических функций, включающих поддержание гомеостаза глюкозы, секрецию инулина, опорожнение желудка и рост клеток кишечника, а также регуляцию приема пищи. Глюкагон представляет собой пептид из 29 аминокислот, которые соответствуют участку преглюкагона от 33 до 61 аминокислоты, а GLP-1 образуется в виде пептида из 37 аминокислот, что соответствует в преглюкагоне участку от 72 до 108 аминокислоты.

Гипогликемия возникает в том случае, когда уровни глюкозы в крови падают настолько сильно, что создается проблема в обеспечении организма достаточным уровнем энергии для осуществления его активности. У взрослых или детей старше 10 лет гипогликемия встречается достаточно редко, если не рассматривать случаи побочного эффекта лечения диабета, хотя она может быть результатом других методов лечения или определенных заболеваний, а также развиваться из-за недостаточности гормонов или ферментов или определяться развитием опухоли. В том случае, когда уровень глюкозы в крови начинает падать, глюкагон, будучи гормоном, продуцируемым поджелудочной железой, подает печени сигнал о необходимости расщепления гликогена и высвобождения глюкозы, что будет вызывать повышение уровней глюкозы в крови до нормального значения. Таким образом, по имеющимся данным, наиболее значимой ролью глюкагона в регуляции глюкозы является противодействие активности инсулина и поддержание нормальных уровней глюкозы в крови. Однако в случае диабета такой ответ глюкагона на гипогликемию может быть изменен, что затрудняет процесс нормализации уровней глюкозы.

Гипогликемия представляет собой опасное для жизни состояние, требующее немедленного медицинского вмешательства. Введение глюкагона представляет собой установленный способ лечения острой гликемии, поскольку он позволяет восстановить нормальный уровень глюкозы в течение нескольких минут после введения. В том случае, когда глюкагон используют в рамках острого медицинского лечения гипогликемии, кристаллическую форму глюкагона солюбилизируют разбавленным кислотным буфером и полученный раствор инъецируют внутримышечно. Несмотря на эффективность такого лечения, данная методика является сложной и опасной, если пациент находится в полубессознательном состоянии. Соответственно, имеется потребность в аналоге глюкагона, который бы сохранял биологические характеристики исходной молекулы и был достаточно растворимым и стабильным в релевантных физиологических условиях, так чтобы его можно было вводить в состав предварительных композиций в виде раствора, готового для инъекции.

Кроме того, диабетикам рекомендуется поддерживать примерно нормальный уровень глюкозы в крови, с тем, чтобы задерживать или предупреждать развитие осложнений микрососудистого характера. Обычно, для достижения этой цели требуется интенсивная инсулиновая терапия. В этой связи, лечащим врачам приходится значительно увеличивать частоту введения, что, соответственно, повышает выраженность гипогликемии у диабетических пациентов. Соответственно, есть потребность в улучшенных фармацевтических препаратах и способах лечения диабета, которые бы в меньшей мере индуцировали развитие гипогликемии, чем проводимая в настоящее время инсулиновая терапия.

В настоящей заявке описываются агонисты глюкагона с высокой эффективностью, которые обладают повышенной биофизической стабильностью и водорастворимостью в диапазоне физиологических значений pH в составе фармацевтических композиций, подходящих для коммерческого использования. Нативный глюкагон не является ни растворимым, ни стабильным в диапазоне физиологических значений pH и, в этой связи, его необходимо изготавливать в виде сухого продукта, который требуется восстанавливать и затем уже использовать. Приведенные в настоящем описании аналоги глюкагона обладают улучшенными физическими свойствами, что делает их более подходящими для использования в условиях медицинских учреждений, где в настоящее время используют нативный гормон. Указанные соединения могут использоваться для получения растворов предварительных композиций, готовых для инъекций при лечении гипогликемии. Альтернативно, агонисты глюкагона могут вводиться совместно с инсулином для забуферивания эффектов инсулина, с тем, чтобы поддерживать более стабильные уровни глюкозы в крови. Дополнительно, в настоящем описании приведены другие полезные варианты применения композиций, включающих модифицированные пептиды глюкагона по настоящему описанию.

КРАТКОЕ ОПИСАНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Один вариант осуществления настоящего изобретения относится к пептидам глюкагона, которые сохраняют активность рецептора глюкагона и обладают улучшенной растворимостью в сравнении с нативным пептидом глюкагона (SEQ ID NO: 1). Нативный глюкагон обладает плохой растворимостью в водных растворах, особенно при физиологических значениях pH, и демонстрирует тенденцию к агрегации и осаждению с течением времени. Тогда как пептиды глюкагона по одному из вариантов осуществления настоящего изобретения демонстрируют по меньшей мере в 2 раза, в 5 раз или еще более высокую растворимость, в сравнении с нативным глюкагоном, в диапазоне значений pH от 6 до 8, или от 6 до 9, например, при значении pH 7, через 24 часа хранения при температуре 25°С.

В одном варианте осуществления настоящего изобретения, пептиды глюкагона сохраняют по меньшей мере 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75% активности, 80% активности, 85% активности или 90% активности нативного глюкагона (где указанный показатель рассчитан как обратное соотношение значений EC50 для пептида глюкагона относительно самого глюкагона, например, определяемых при оценке продукции цАМФ в рамках теста, описанного в общих чертах в примере 13). В одном варианте осуществления настоящего изобретения, пептиды глюкагона по настоящему изобретению обладают такой же активностью, что и глюкагон, или еще более высокой активностью (в данном описании термины «активность» и «эффективность» используются как синонимы), чем глюкагон. В некоторых вариантах осуществления настоящего изобретения, пептиды глюкагона сохраняют примерно до 100%, 1000% 10000%, 100000% или 1000000% относительно активности нативного глюкагона.

В норме, глюкагон характеризуется примерно 1% активности от нативного GLP-1 по рецептору GLP-1. Амид GLP-1 (7-36) SEQ ID NO: 57 или кислотная форма GLP-1 (7-37) (SEQ ID NO: 58) представляют собой биологически активные формы GLP-1, которые обладают по существу эквивалентной активностью по рецептору GLP-1. Кроме того, глюкагон характеризуется в 10-20 большей селективностью по рецептору глюкагона, чем по рецептору GLP-1 (селективность рассчитывают как обратное соотношение показателя ЕС50 для глюкагона по рецептору глюкагона в сравнении с его активностью по рецептору GLP-1). Например, биотесты, в которых показатель ЕС50 глюкагона по рецептору глюкагона составляет 0,22 нМ и показатель ЕС50 для рецептора GLP-1 составляет 3,85 нМ, расчетный показатель селективности составляет 17, 5 раз. Активность может быть определена, например, по уровню продукции цАМФ с использованием методики, в общих чертах описанной в примере 13. В некоторых вариантах осуществления настоящего изобретения, пептиды глюкагона по настоящему изобретению характеризуются наличием менее чем примерно 5%, 4%, 3%, 2% или 1% активности от нативного GLP-1 по рецептору GLP-1 и/или более чем примерно 5-кратной, 10-кратной или 15-кратной селективностью для рецептора глюкагона в сравнении с рецептором GLP-1. Так, например, в некоторых вариантах осуществления настоящего изобретения, пептиды глюкагона по настоящему изобретению характеризуются наличием менее чем 5% активности нативного GLP-1 по рецептору GLP-1 и демонстрируют более чем 5-кратную селективность для рецептора глюкагона в сравнении с селективностью по рецептору GLP-1.

Любой из описанных в настоящем изобретении пептидов глюкагона может дополнительно характеризоваться улучшенной стабильностью и/или сниженным уровнем разложения, и, например, будет сохранять по меньшей мере 95% от исходной активности пептида через 24 часа при температуре 25°С. В некоторых вариантах осуществления настоящего изобретения, пептиды глюкагона по настоящему изобретению демонстрируют повышенную стабильность, так что по меньшей мере 75% (например, по меньшей мере 80%, по меньшей мере 85%, по меньшей мере 90%, по меньшей мере 95%, более чем 95%, вплоть до 100%) от концентрации пептида или менее чем примерно 25% (например, менее чем 20%, менее чем 15%, менее чем 10%, менее чем 5%, менее чем 4%, 3%, 2%, 1% вплоть до 0%) разложенного пептида выявляется в растворе при длине волны 280 нМ с использованием ультрафиолетового (УФ) детектора через 1 неделю или более (например, через 2 недели, 4 недели, 1 месяц, 2 месяца, четыре месяца, шесть месяцев, восемь месяцев, десять месяцев, двенадцать месяцев) при температуре, составляющей по меньшей мере 20°С (например, 21°С, 22°С, 23°С, 24°С, 25°С, 26°С, по меньшей мере 27,5°С, по меньшей мере 30°С, по меньшей мере 35°С, по меньшей мере 40°С, по меньшей мере 50°С) и меньше, чем примерно 100°С, меньше, чем 85°С, меньше, чем 75°С или меньше, чем 70°С.

Один из вариантов осуществления настоящего изобретения относится к пептиду глюкагона с улучшенной растворимостью, где указанный пептид был модифицирован за счет аминокислотных замещений и/или добавления заряженной аминокислоты в С-концевую часть пептида, и в одном варианте в положении от С-конца до 27 положения в SEQ ID NO: 1. Необязательно, в С-концевую часть могут быть введены одна, две или три заряженных аминокислоты, а в одном варианте, на участке от С-конца до положения 27. Согласно одному из вариантов, одна или обе нативные аминокислоты в положении 28 и/или 29 замещают заряженной аминокислотой, и/или одна-три заряженных аминокислоты добавляют к С-концу пептида после положения 29. В репрезентативных вариантах осуществления настоящего изобретения, одна, две или все заряженные аминокислоты заряжены отрицательно. В пептид глюкагона могут быть введены дополнительные модификации, например, консервативное замещение, что также способствует сохранению активности глюкагона.

Согласно одному репрезентативному варианту осуществления настоящего изобретения, пептид глюкагона включает аминокислотную последовательность SEQ ID NO: 11 или ее аналог, который содержит 1-3 дополнительных аминокислотных модификации, в сравнении с нативным глюкагоном, или соответствующий аналог агониста глюкагона. Последовательность SEQ ID NO: 11 обозначает модифицированный пептид глюкагона, где остаток аспарагина в положении 28 нативного белка был замещен аспарагиновой кислотой. В другом репрезентативном варианте осуществления настоящего изобретения, пептид глюкагона включает аминокислотную последовательность SEQ ID NO: 38, где остаток аспарагина в положении 28 нативного белка был замещен глютаминовой кислотой. Другие репрезентативные варианты включают пептиды глюкагона с последовательностями SEQ ID NO: 24, 25, 26, 33, 35, 36 и 37.

Согласно другому варианту осуществления настоящего изобретения, в нем рассматриваются пептида глюкагона, которые обладают повышенной активностью по рецептору глюкагона, где указанные пептиды включают модификацию аминокислоты в положении 16 нативного глюкагона (SEQ ID NO: 1). В качестве неограничивающего примера, следует отметить, что такая повышенная активность может быть получена при замещении природного серина в положении 16 глютаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь длиной в 4 атома, или, альтернативно, любой из следующих аминокислот: глютамин, гомоглютаминовая кислота или гомоцистеиновая кислота, или заряженной аминокислотой, которая содержит боковую цепь, включающую по меньшей мере один гетероатом (например, N, O, S, P) и где длина боковой цепи в указанной аминокислоте составляет примерно 4 (или 3-5) атомов. Замещение серина в положении 16 глютаминовой кислотой повышает активность глюкагона по меньшей мере в 2 раза, в 4 раза, в 5 раз и вплоть до 10 раз по рецептору глюкагона. В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона сохраняет селективность для рецептора глюкагона относительно рецептора GLP-1, например, сохраняет селективность, которая выше в 5 раз, в 10 раз или в 15 раз.

Растворимость любого из указанных выше соединений может быть дополнительно повышена за счет присоединения гидрофильной фрагмента к пептиду. Введение таких групп также увеличивает длительность действия, например, в случае измерения пролонгирования периода полувыведения соединения из кровотока. В одном варианте осуществления настоящего изобретения, указанная гидрофильная фрагмент представляет собой полиэтиленгликолевую (ПЭГ) цепь или другой водорастворимый полимер, который ковалентно присоединяют к боковой цепи аминокислотного остатка по одному или нескольким положениям из 16, 17,21, 24, 29, 40 указанного пептида глюкагона, в пределах С-концевого расширения или по С-концевой аминокислоте. В других вариантах осуществления настоящего изобретения, нативная аминокислота в указанном положении замещается аминокислотой, содержащей боковую цепь, подходящую для перекрестной сшивки с гидрофильными фрагментами, с тем, чтобы облегчиться связывание гидрофильного фрагмента с пептидом. Репрезентативные аминокислоты включают Cys, Lys, Orn, гомо-Cys или ацетилфенилаланин (Ac-Phe). В других вариантах осуществления настоящего изобретения, аминокислоту модифицируют таким образом, чтобы она содержала гидрофильную группу, добавленную к пептиду по С-концу. Указанная полиэтиленгликолевая цепь, вводимая согласно данному варианту осуществления настоящего изобретения, имеет молекулярную массу, выбранную из масс в диапазоне от примерно 500 до примерно 40000 дальтон. В одном варианте осуществления настоящего изобретения, указанная полиэтиленгликолевая цепь имеет молекулярную массу, выбранную их значений от примерно 500 до примерно 5000 дальтон. В другом варианте осуществления настоящего изобретения, указанная полиэтиленгликолевая цепь имеет молекулярную массу от примерно 10000 до примерно 20000 дальтон. В еще других репрезентативных вариантах осуществления настоящего изобретения, указанная полиэтиленгликолевая цепь имеет молекулярную массу от примерно 20000 до примерно 40000 дальтон.

Согласно некоторым вариантам осуществления настоящего изобретения, описываемые в нем глюкагоновые пептиды модифицируют таким образом, чтобы они включали ацильную группу или алкильную группу, например, ацильную или алкильную группу, которая является ненативной для природной аминокислоты. Ацилирование или алкилирование может удлинить период полувыведения глюкагоновых пептидов из кровотока, может способствовать задержке начала действия и/или увеличить длительность действия по рецепторам глюкагона и/или GLP-1, и/или повысить резистентность к протеазам, таким как DPP-IV. Ацилирование или алкилирование может также повысить растворимость пептида при нейтральном значении pH. Как показано в настоящем описании, активность по рецептору глюкагона и по рецептору GLP-1 данного глюкагонового пептида после ацилирования сохраняется или может даже повыситься.

В некоторых аспектах настоящего изобретения, пептид глюкагона ковалентно присоединяют к ацильной или алкильной группе через спейсер, например через аминокислоту, дипептид, трипептид, гидрофильный бифункциональный спейсер или гидрофобный бифункциональный спейсер. В некоторых аспектах настоящего изобретения, повышение активности по рецепторам GLP-1 и глюкагона наблюдается при ацилировании пептида спейсером. В выбранных аспектах, таких как, например, аспект, в рамках которого пептид не содержит внутримолекулярный мостик (например, ковалентный внутримолекулярный мостик), наблюдается дальнейшее повышение активности по рецепторам GLP-1 и глюкагона при ацилировании пептида спейсером, в сравнении с ацилированием пептида, где указанная ацильная группа присоединяется к пептиду без спейсера. Согласно некоторым вариантам осуществления настоящего изобретения, спейсер представляет собой аминокислоту или дипептид, содержащий аминокислотную или пептидную скелетную структуру длиной от 3 до 10 атомов (например, от 6 до 10 атомов). Согласно некоторым конкретным вариантам осуществления настоящего изобретения, общая длина спейсера и ацильной или алкильной группы составляет 14-28 атомов, например, 17-28, 19-26 атомов, 19-21 атома. Спейсеры, подходящие для достижения цели повышения активности глюкагона, также приведены в настоящем описании. В некоторых вариантах, ацилированные или алкилированные пептиды согласно настоящему описанию также включают модификацию, которая селективно снижает активность по рецептору GLP-1, например модификацию Thr в положении 7, такую как замещение Thr в положении 7 аминокислотой, не содержащей гидроксильную группу, например аминомасляной кислотой (Abu) или Ile; делецию одной или нескольких аминокислот на участке от С-конца до положения аминокислоты 27 или 28 (например, делецию одной или обеих аминокислот в положении 28 или 29), что приводит к получению пептида длиной 27 или 28 аминокислот.

Пептиды глюкагона могут быть ацилированы или алкилированы по той же аминокислоте, где была присоединена гидрофильная фрагмент, или по другому положению аминокислоты.

В некоторых вариантах, настоящее изобретение относится к пептиду глюкагона, модифицированному таким образом, что включает ацильную группу или алкильную группу, ковалентно присоединенную к аминокислоте в положении 10 пептида глюкагона. Указанный пептид глюкагона может дополнительно включать спейсер между аминокислотой в положении 10 пептида глюкагона и ацильной группой или алкильной группой. В некоторых вариантах осуществления настоящего изобретения, ацильная группа представляет собой жирную кислоту или желчную кислоту, или их соль, например С4-С30 жирную кислоту, С8-С24 жирную кислоту, холевую кислоту, С4-С30 алкил, С8-С24 алкил, или алкил, включающий стероидную группу желчной кислоты. Спейсер представляет собой любой фрагмент с такими реактивными группами, которые подходят для присоединения алкильных и ацильных групп. В репрезентативных вариантах осуществления настоящего изобретения, указанный спейсер включает аминокислоту, дипептид, трипептид, гидрофильный бифункциональный спейсер, амино(полиалкилокси)карбоксилатный или гидрофобный бифункциональный спейсер. В некоторых вариантах осуществления настоящего изобретения, указанный спейсер выбирают из группы, состоящей из Trp, Glu, Asp, Cys, и включает спейсер, содержащий NH2(CH2CH2O)n(CH2)mCOOH, где m равно любому целому числу от 1 до 6 и n равно любому целому числу от 2 до 12. Такие ацилированные или алкилированные пептиды глюкагона могут также включать гидрофильный фрагмент, необязательно полиэтиленгликоль. Любой из указанных выше пептидов глюкагона может включать две ацильных группы или две алкильных группы или их комбинацию.

Настоящее изобретение также относится к фармацевтически приемлемым солям указанных агонистов глюкагона.

В других репрезентативных вариантах осуществления настоящего изобретения, любое из указанных выше соединений может быть дополнительно модифицировано таким образом, чтобы изменить его фармацевтические свойства, за счет добавления второго пептида к карбоксильному концу пептида глюкагона. В одном варианте, пептид глюкагона ковалентно связывают через пептидную связь со вторым пептидом, где указанный второй пептид включает последовательность, выбранную из группы, состоящей из SEQ ID NO: 20, SEQ ID NO: 21 и SEQ ID NO: 22.

В некоторых вариантах осуществления настоящего изобретения, модификации в положении 1 или 2 могут повысить устойчивость пептида к расщеплению дипептидилпептидазой IV (DPP IV). Например, аминокислота в положении 2 может быть замещена D-серином, D-аланином, валином, глицином, N-метилсерином, N-метилаланином или аминоизомасляной кислотой. Альтернативно или дополнительно, аминокислота в положении 1 может быть замещена D-гистидином (D-His), дезаминогистидином, гидроксилгистидином, ацетилгистидином. гомогистидином, N-метилгистидином, альфа-метилгистидином, имидазолуксусной кислотой или альфа,альфа-диметилимидазолуксусной кислотой (DMIA).

Было показано, что модификации в положении 2 (например, AIB в положении 2) и в некоторых случаях модификации в положении 1 (например, DMIA в положении 1) могут снизить активность глюкагона, иногда значительно; неожиданно такое снижение активности глюкагона может быть восстановлено при стабилизации альфа-спиральной структуры в С-концевой части глюкагона (в районе аминокислот 12-29). В некоторых вариантах осуществления настоящего изобретения, стабилизация осуществляется через ковалентную связь между аминокислотами в положении «i» и «i+4», где i равно любому целому числу от 12 до 25. В некоторых конкретных вариантах осуществления настоящего изобретения, «i» и «i»+4 равны 12 и 16, 16 и 20, или 20 и 24, или 24 и 28. В некоторых вариантах осуществления настоящего изобретения, указанная ковалентная связь представляет собой лактамный мостик между глютаминовой кислотой в положении 16 или лизином в положении 20. В репрезентативных вариантах осуществления настоящего изобретения, указанный мостик или линкер имеет длину из 8 (или примерно 7 или 9) атомов. В других вариантах, стабилизация осуществляется через ковалентную связь между аминокислотами в положениях «j» и «j+3», где j равно любому целому числу от 12 до 27. В репрезентативных вариантах, указанный мостик и линкер имеет длину примерно из 6 (или 5 или 7) атомов. В еще других вариантах осуществления настоящего изобретения, стабилизация осуществляется через ковалентную связь между аминокислотами в положениях «к» и «к+7», где к равно целому числу от 12 до 22. В некоторых вариантах, указанная ковалентная связь представляет собой внутримолекулярный мостик, отличный от лактамного мостика. Например, подходящие способы ковалентного связывания (например, способы образования ковалентного внутримолекулярного мостика) включают осуществление одной или нескольких реакций обмена олефиновых групп, реакций циклизации на основе лантионина, образование дисульфидного мостика или модифицированного серосодержащего мостика, использование α,ω-диаминоалкановых связок, образование мостиков с участием атома металла и другие способы циклизации пептидов.

В еще других вариантах осуществления настоящего изобретения, спиральную структуру стабилизируют посредством нековалентных связей (например, нековалентных внутримолеклярных мостиков), включающих без ограничения, водородные связи, ионные взаимодействия и солевые мостики.

В еще других вариантах осуществления настоящего изобретения, стабилизация альфа-спиральной структуры в С-концевой части пептида глюкагона (в районе аминокислот 12-29) достигается при целевом введении одной или нескольких α,α-двузамещенных аминокислот в положения, которые позволяют сохранить желательную активность. В некоторых вариантах проводят замещение α,α-двузамещенной аминокислотой по одному, двум, трем, четырем или большему числу положений из числа 16, 17, 18, 19, 20, 21, 24 или 29 в пептиде глюкагона. Так, например, замещение положения 16 в пептиде глюкагона аминоизомасляной кислотой (AIB) обеспечивает получение стабилизированной α-спиральной структуры в отсутствие солевого мостика или локтама. Такие пептиды рассматриваются в настоящем описании как пептиды, не содержащие внутримолекулярный мостик. В конкретных аспектах, стабилизация альфа-спиральной структуры достигается за счет введения одной или нескольких аминокислот без введения ковалентного внутримолекулярного мостика, например, лактамного мостика, дисульфидного мостика. Такие пептиды рассматриваются в настоящем описании как пептиды, не содержащие ковалентный внутримолекулярный мостик. В некоторых вариантах осуществления настоящего изобретения, один, два, три или больше положений из числа 16, 20, 21 или 24 замещаются AIB

Таким образом, в некоторых вариантах, настоящее изобретение относится к пептиду глюкагона с активностью агониста глюкагона, где указанный пептид включает аминокислотную последовательность:

X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z (SEQ ID NO: 39) при наличии модификаций 1-3 аминокислот,

где X1 и/или X2 представляет(ют) собой ненативную аминокислоту, которая снижает чувствительность (или повышает устойчивость) пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV),

где Z выбран из группы, состоящей из -COOH (природный С-концевой карбоксилат), -Asn-COOH, Asn-Thr-COOH и Y-COOH, где Y обозначает 1-2 аминокислоты, и

где внутримолекулярный мостик, предпочтительно, ковалентная связь, соединяет боковые цепи аминокислоты в положении «i» и аминокислоты в положении «i+4», где i равно 12, 16, 20 или 24.

В некоторых вариантах осуществления настоящего изобретения, указанный внутримолекулярный мостик представляет собой лактамный мостик. В некоторых вариантах, указанные аминокислоты в положениях «i» и «i+4» в SEQ ID NO: 39 представляют собой Lys и Glu, например, Glu16 и Lys20. В некоторых вариантах, X1 выбирают из группы, состоящей из D-His, N-метил-His, альфа-метил-His, имидазолуксусной кислоты, дез-амино-His, гидроксил-His, ацетил-His, гомо-His и альфа,альфа-диметилимидазолуксусной кислоты. (DMIA). В других вариантах осуществления настоящего изобретения, X2 выбирают из группы, состоящей из D-Ser, D-Ala, Gly, N-метил-Ser, Val, и альфа,альфа-аминоизомасляной кислоты (AIB). В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона ковалентно связывают с гидрофильным фрагментом по любому из положений аминокислот 16, 17, 20, 21, 24, 29, 40 в пределах С-концевого расширения или по С-концевой аминокислоте. В репрезентативных вариантах осуществления настоящего изобретения, указанный гидрофильный фрагмент ковалентно присоединяют к Lys, Cys, Orn, гомоцистеиновому или ацетилфенилаланиновому остатку по любому из указанных положений. Репрезентативные гидрофильные фрагменты включают полиэтиленгликоль (ПЭГ), например, с молекулярной массой примерно от 1000 дальтон до 40000 дальтон или от примерно 20000 дальтон до примерно 40000 дальтон.

В других вариантах, настоящее изобретение относится к пептиду глюкагона с активностью агониста глюкагона, где указанный пептид включает аминокислотную последовательность:

Xl-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-I^u-Met-Z (SEQ ID NO: 39),

где X1 и/или X2 обозначает(ют) ненативную аминокислоту, которая снижает чувствительность (или повышает устойчивость) пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV),

где одно, два, три, четыре или большее число положений из числа 16, 20, 21, или 24 в пептиде глюкагона замещены α,α-двузамещенной аминокислотой, и

где Z выбран из группы, состоящей из: -COOH (природный С-концевой карбоксилат), -Asn-COOH, Asn-Thr-COOH и Y-COOH, где Y обозначает 1-2 аминокислоты.

Репрезентативные варианты других модификаций указанных выше пептидов глюкагона или их аналогов включают замещение Thr в положении 7 аминокислотой, не содержащей гидроксильную группу, например, Abu или Ile, необязательно в сочетании с замещением или добавлением аминокислоты, включающей боковую цепь, ковалентно присоединенную (необязательно через спейсер) к ацильной или алкильной группе, где указанная ацильная или алкильная группа является ненативной для природной аминокислоты, замещение Lys в положении 12 Arg; замещение Asp в положении 15 Glu; замещение Ser в положении 16 Thr или AIB; замещение Gin в положении 20 Ser, Thr, Ala или AIB; замещение Asp в положении 21 Glu; замещение Gln в положении 24 Ser, Thr, Ala или AIB; замещение Met в положении 27 Leu или Nle; замещение Asn в положении 28 заряженной аминокислотой; замещение Asn в положении 28 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замещение в положении 28 Asn, Asp или Glu; замещение в положении 28 Asp; замещение в положении 28 Glu; замещение Thr в положении 29 заряженной аминокислотой; замещение Thr в положении 29 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замещение в положении 29 Asp, Glu или Lys; замещение в положении 29 Glu; вставку 1-3 заряженных аминокислот после положения 29; вставку в положении 30 (например, после положения 29) Glu или Lys; необязательно со вставкой в положении 31 Lys; добавление SEQ ID NO: 20 к С-концу, необязательно, где аминокислота в положении 29 представляет собой Thr или Gly; замещение или дополнение аминокислоты, ковалентно присоединенной к гидрофильному фрагменту; или их комбинацию.

В еще одном репрезентативном варианте осуществления настоящего изобретения, любой из указанных выше пептидов может быть дополнительно модифицирован для повышения стабильности посредством модификации аминокислоты в положении 15 в SEQ ID NO: 1, с целью уменьшения разложения пептида с течением времени, особенно в кислом или щелочном буферах. В репрезентативных вариантах, Asp в положении 15 замещен Glu, гомо-Glu, цистеиновой кислотой или гомоцистеиновой кислотой.

Альтернативно, любой из приведенных в настоящем описании пептидов глюкагона может быть дополнительно модифицирован для целей повышения стабильности, за счет введения модификации в аминокислоту в положении 16 в SEQ ID NO: 1. В репрезентативных вариантах, Ser в положении 16 замещается Thr или AIB или вводится любое из указанных выше аминокислотных замещений, которое повышает активность по рецептору глюкагона. Такие модификации снижают уровень расщепления пептидной связи между Asp15-Ser16.

Сохраняемая или повышенная активность по рецептору глюкагона может быть достигнута за счет модификации Gln в положении 3 аналогом глютамина. Например, пептид глюкагона, включающий аналог глютамина в положении 3, может демонстрировать примерно 5%, примерно 10%, примерно 20%, примерно 50% или примерно 85%, или более активности нативного глюкагона (то есть SEQ ID NO: 1) по рецептору глюкагона. В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона, включающий аналог глютамина в положении 3, может демонстрировать примерно 20%, примерно 50%, примерно 75%, примерно 100%, примерно 200% или примерно 500% или более от активности соответствующего пептида глюкагона, имеющего такую же аминокислотную последовательность, что и пептид, включающий аналог глютамина, за исключением модифицированной аминокислоты в положении 3 (то есть SEQ ID NO: 69 или SEQ ID NO: 70), по рецептору глюкагона. В некоторых вариантах, пептид глюкагона, включающий аналог глютамина в положении 3, демонстрирует повышенную активность по рецептору глюкагона, но указанная повышенная активность не превышает 1000%, 10000%, 100000% или 1000000% от активности нативного глюкагона или соответствующего пептида глюкагона, имеющего такую же аминокислотную последовательность, что и пептид, включающий аналог глютамина, за исключением модифицированной аминокислоты в положении 3.

В некоторых вариантах осуществления настоящего изобретения, аналог глютамина представляет собой природную или неприродную аминокислоту, включающую боковую цепь структуры I, II или III:

Структура I

Структура II

Структура III

где R1 обозначает C0-3алкил или C0-3гетероалкил; R2 обозначает NHR4 или C1-3алкил; R3 обозначает C1-3алкил; R4 обозначает H или C1-3алкил; X обозначает NH, О или S; и Y обозначает NHR4, SR3 или OR3. В некоторых вариантах X обозначает NH или Y обозначает NHR4. В некоторых вариантах R1 обозначает C0-2алкил или C1гетероалкил. В некоторых вариантах R2 обозначает NHR4 или C1 алкил. В некоторых вариантах R4 обозначает H или C1 алкил. В репрезентативных вариантах осуществления настоящего изобретения, аминокислота, включающая боковую цепь структуры I, характеризуется тем, что R1 обозначает CH2-S, X обозначает NH, и R2 обозначает CH3 (ацетамидометилцистеин, C(Acm)); R1 обозначает CH2, X обозначает NH и R2 обозначает CH3 (ацетилдиаминбутановая кислота, Dab(Ac)); R1 обозначает C0алкил, X обозначает NH, R2 обозначает NHR4, и R4 обозначает H (карбамоилдиаминопропановая кислота Dap(мочевина)); или R1 обозначает CH2-CH2, X обозначает NH, и R2 обозначает CH3 (ацетилорнитин, Orn(Ac)). В репрезентативных вариантах осуществления настоящего изобретения, аминокислота, включающая боковую цепь Структуры II, характеризуется тем, что R1 обозначает CH2, Y обозначает NHR4, и R4 обозначает CH3 (метилглютамин, Q(Me)). В репрезентативных вариантах осуществления настоящего изобретения, аминокислота, включающая боковую цепь Структуры III, характеризуется тем, что R1 обозначает CH2 и R4 обозначает H (метионинсульфоксид, M(O)). В конкретных вариантах осуществления настоящего изобретения, аминокислота в положении 3 замещена Dab(Ac). Например: агонисты глюкагона могут включать аминокислотную последовательность SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73 и SEQ ID NO: 74.

Повышенной активности пептидов глюкагона по рецептору глюкагона можно также достичь при ковалентном присоединении ацильной или алкильной группы, например, ацильной или алкильной группы, которая является неприродной для природной аминокислоты (например, С430 жирноацильная группа, С430 алкильная группа) к боковой цепи аминокислоты в пептиде глюкагона. В некоторых вариантах осуществления настоящего изобретения, ацилированные или алкилированные пептиды глюкагона не содержат внутримолекулярный мостик, например, ковалентный внутримолекулярный мостик (например, лактам). В некоторых аспектах, указанную ацильную или алкильную группу присоединяют к боковой цепи аминокислоты в пептиде глюкагона через спейсер, например, спейсер, который содержит 3-10 атомов в длину. В некоторых вариантах осуществления настоящего изобретения, указанную ацильную или алкильную группу присоединяют к боковой цепи аминокислоты в положении 10 в пептиде глюкагона через спейсер. В конкретных вариантах осуществления настоящего изобретения, указанные ацилированные или алкилированные пептиды глюкагона дополнительно включают модификацию, которая селективно снижает активность пептида по рецептору GLP-1. Так, например, ацилированный или алкилированный пептид глюкагона может включать С-концевой альфа-карбоксилат, замещение Thr в положении 7 аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile, делецию одной или нескольких аминокислот на участке от С-конца до аминокислоты в положении 27 или 28, что приводит к получению пептида, содержащего 27 или 28 аминокислот, или используется сочетание таких модификаций.

В некоторых вариантах осуществления настоящего изобретения, любой из приведенных в настоящем описании пептидов глюкагона может быть дополнительно модифицирован для целей снижения разложения по разным положениям аминокислотных остатков, посредством модификации пептидов в положениях аминокислот 20, 21, 24 или 27, по любому одному, двум, трем или четырем указанным положениям. Репрезентативные варианты включают замещение Gln в положении 20 Ala или AIB, замещение Asp в положении 21 Glu, замещение Gln в положении 24 Ala или AIB, замещение Met в положении 27 Leu или Nle. Удаление или замещение метионина снижает уровень разложения за счет возможного окисления метионина. Удаление или замещение Gln или Asn снижает уровень разложения за счет дезамидирования Gln или Asn. Удаление или замещение Asp снижает уровень разложения, которое происходит при дегидратации Asp с образованием циклического сукцинимидного интермедиата с последующей изомеризацией до изоаспартата.

В некоторых вариантах осуществления настоящего изобретения, любой из приведенных в настоящем описании пептидов глюкагона может быть модифицирован без неблагоприятного воздействия на активность полученного пептида по рецептору глюкагона, при сохранении по меньшей мере частичной активности по рецептору глюкагона. Так, например, могут быть проведены консервативные или неконсервативные замещения, добавления или делеции по любому из положений 2, 5, 7, 10, 11, 12, 13, 14, 17, 18, 19, 20, 21, 24, 27, 28 или 29. В репрезентативных вариантах осуществления настоящего изобретения, Lys в положении 12 замещают Arg. В других репрезентативных вариантах, делетируют аминокислоты в положениях 29 и/или 28 и необязательно в положении 27.

Любой из приведенных в настоящем описании пептидов глюкагона может характеризоваться показателем EC50 по рецептору человеческого глюкагона, который составляет 100 нМ, 75 нМ, 50 нМ, 40 нМ, 30 нМ, 20 нМ, нМ, 5 нМ, 1 нМ или менее, при тестировании методом индукции сАМФ в клетках HEK293, которые демонстрируют суперэкспрессию рецептора глюкагона, например, с использованием теста, описанного в примере 13. Пептиды, характеризующиеся типичным характером ПЭГилирования, будут демонстрировать повышенный показатель EC50, в сравнении с неПЭГилированным пептидом. Так, например, приведенные в настоящем описании пептиды глюкагона, в отсутствие их неПЭГилирования, могут демонстрировать активность по рецептору глюкагона, которая составляет по меньшей мере 20% (например, по меньшей мере 30%, по меньшей мере 40%, 50%, по меньшей мере 60%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90% по меньшей мере 95%, по меньшей мере 98%, по меньшей мере 99%, 100%, 150%, 200%, 400%, 500% или более) относительно активности нативного глюкагона (SEQ ID NO: 1) по рецептору глюкагона. В некоторых вариантах осуществления настоящего изобретения, приведенные в настоящем описании пептиды глюкагона демонстрируют указанный процент активности от нативного по рецептору глюкагона, в отсутствие гидрофильного фрагмента, но демонстрируют сниженный процент активности от нативного глюкагона по рецептору глюкагона, когда включают гидрофильный фрагмент. Так, например, приведенные в настоящем описании пептиды глюкагона, в случае, если они не ПЭГилированы, могут демонстрировать активность по рецептору глюкагона, которая составляет по меньшей мере 2% (например, по меньшей мере 3%, по меньшей мере 4%, по меньшей мере 5%, по меньшей мере 6%, по меньшей мере 7%, по меньшей мере 8%, по меньшей мере 9% или по меньшей мере 10%) от активности нативного глюкагона. В некоторых вариантах осуществления настоящего изобретения, приведенные в настоящем описании пептиды глюкагона могут демонстрировать любой из указанных выше характеров активности, но не более чем 1000%, 10000%, 100000% или 1000000% от активности нативного глюкагона по рецептору глюкагона.

В некоторых конкретных вариантах осуществления настоящего изобретения, пептид глюкагона включает: (а) модификацию аминокислоты в положении 1 и/или 2, которая придает молекуле устойчивость к DPP-IV, например, замещение DMIA в положении 1 или AIB в положении 2, (b) внутримолекулярный мостик в положениях 12-29, например, в положениях 16 и 20, или одно или несколько замещений аминокислот в положениях 20, 21 и 24 α,α-двузамещенной аминокислотой, необязательно (с) присоединенной к гидрофильному фрагменту, такому как ПЭГ, например, через Cys в положении 24, 29 или по С-концевой аминокислоте, необязательно (d) модификацию аминокислоты в положении 27, которая замещает Met, например, Nle, необязательно (e) модификацию аминокислот в положении 20, 21 и 24, которая снижает уровень разложения, и необязательно (f) присоединение к SEQ ID NO: 20. В том случае, когда пептид глюкагона присоединяют к SEQ ID NO: 20, аминокислота в положении 29 представляет собой, в некоторых вариантах, Thr или Gly. В других конкретных вариантах, пептид глюкагона включает (a) Asp28Glu29 или Glu28Glu29, или Glu29Glu30, или Glu28Glu30, или Asp28Glu30, и необязательно (b) модификацию аминокислоты в положении 16, которую замещает Ser за счет Thr или AIB, и необязательно (c) модификацию аминокислоты в положении 27, которая замещает Met, например, Nle, и необязательно (d) модификацию аминокислот в положении 20, 21 и 24, которые снижают уровень разложения. В конкретном варианте, пептид глюкагона представляет собой T16, A20, E21, A24, Nle27, D28, E29.

Пептид глюкагона может представлять собой часть димера, тримера или мультимера более высокого порядка, который включает по меньшей мере две, три или более пептидов, соединенных через линкер, где по меньшей мере один или оба пептида представляют собой пептид глюкагона. Указанный димер может быть гомодимером или гетеродимером. В некоторых вариантах осуществления настоящего изобретения, указанный линкер выбирают из группы, состоящей из бифункционального тиолового кросс-линкера и бифункционального аминосодержащего кросс-линкера. В некоторых вариантах осуществления настоящего изобретения, указанный линкер представляет собой ПЭГ, например, ПЭГ размером 5 кДа, ПЭГ размером 20 кДа. В некоторых вариантах осуществления настоящего изобретения, указанный линкер представлен дисульфидной связью. Так, например, каждый мономер в таком димере может включать остаток Cys (например, расположенный на конце или внутри молекулы Cys), где атом серы в каждом остатке цистеина участвует в образовании дисульфидной связи. В некоторых вариантах осуществления настоящего изобретения, указанные мономеры соединяются через концевые аминокислоты (например, N-концевые или C-концевые), через внутренние аминокислоты или через концевую аминокислоту по меньшей мере одного мономера и внутреннюю аминокислоту по меньшей мере одного другого мономера. В конкретных аспектах, указанные мономеры объединяются через N-концевую аминокислоту. В некоторых аспектах, указанные мономеры в рассматриваемом мультимере присоединяются друг к другу в ориентации «хвост к хвосту», где С-концевые аминокислоты каждого мономера присоединяются друг к другу.

Конъюгированный фрагмент ковалентно присоединен к любому из приведенных в настоящем описании пептидов глюкагона, включая димер, тример или мультимер более высокого порядка. Слитые пептиды, включающие любую аминокислотную последовательность из SEQ ID NONO: 20-22, также рассматриваются в настоящем изобретении.

Любая из приведенных в настоящем описании модификаций, которая повышает активность по рецептору глюкагона, сохраняет частичную активность по рецептору глюкагона, повышает растворимость, улучшает стабильность или снижает уровень разложения, может быть использована для изменения пептидов глюкагона, по отдельности или в сочетании. Таким образом, могут быть получены пептиды глюкагона, которые сохраняют по меньшей мере 20% от активности активного глюкагона по рецептору глюкагона и которые являются растворимыми в концентрации по меньшей мере 1 мг/мл в диапазоне значений pH от 5 до 8 или от 6 до 9 (например, при pH 7), и которые необязательно сохраняют по меньшей мере 95% от активности исходного пептида (например, 5% или менее исходного пептида подвергается разложению или расщеплению) после 24 часов хранения при температуре 25°С. Альтернативно, могут быть получены пептиды глюкагона с высокой активностью, которые демонстрируют по меньшей мере примерно 100%, 125%, 175%, 200%, 250%, 300%, 350%, 400%, 450%, 500%, 600%, 700%, 800%, 900% или 10-кратное или более значительное повышение активности относительно нативного глюкагона по рецептору глюкагона и которые необязательно являются растворимыми в концентрации, составляющей по меньшей мере 1 мг/мл при значениях pH в диапазоне от 6 до 8 или от 6 до 9 (например, при pH 7) и которые необязательно сохраняют по меньшей мере 95% исходного пептида (например, 5% или менее от исходного пептида подвергается разложению или расщеплению) после 24 часов хранения при температуре 25°C. В некоторых вариантах осуществления настоящего изобретения, приведенные в настоящем описании пептиды глюкагона демонстрируют указанный процент активности относительно нативного глюкагона по рецептору глюкагона, в том случае, когда они не содержат гидрофильного фрагмента, но демонстрируют сниженный процент активности от нативного глюкагона по рецептору глюкагона, когда включают гидрофильный фрагмент. В некоторых вариантах осуществления настоящего изобретения, приведенные в описании пептиды глюкагона могут демонстрировать по меньшей мере любой из указанных выше относительных уровней активности по рецептору глюкагона, но не более, чем 10000%, 100000% или 1000000% от активности нативного глюкагона по рецептору глюкагона.

Согласно одному из вариантов осуществления настоящего изобретения, в нем рассматривается фармацевтическая композиция, включающая любой из приведенных в описании новых пептидов глюкагона, предпочтительно стерильных и предпочтительно с уровнем чистоты, составляющим по меньшей мере 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%, и фармацевтически приемлемый разбавитель, носитель или эксципиент. Такие композиции могут содержать пептид глюкагона в концентрации, составляющей по меньшей A, где A обозначает 0,001 мг/мл, 0,01 мг/мл, 0,1 мг/мл, 0,5 мг/мл, 1 мг/мл, 2 мг/мл, 3 мг/мл, 4 мг/мл, 5 мг/мл, 6 мг/мл, 7 мг/мл, 8 мг/мл, 9 мг/мл, 10 мг/мл, 11 мг/мл, 12 мг/мл, 13 мг/мл, 14 мг/мл, 15 мг/мл, 16 мг/мл, 17 мг/мл, 18 мг/мл, 19 мг/мл, 20 мг/мл, 21 мг/мл, 22 мг/мл, 23 мг/мл, 24 мг/мл, 25 мг/мл или более. В других вариантах осуществления настоящего изобретения, такие композиции могут содержать пептид глюкагона в концентрации, составляющей максимум B, где B обозначает 30 мг/мл, 25 мг/мл, 24 мг/мл, 23 мг/мл, 22 мг/мл, 21 мг/мл, 20 мг/мл, 19 мг/мл, 18 мг/мл, 17 мг/мл, 16 мг/мл, 15 мг/мл, 14 мг/мл, 13 мг/мл, 12 мг/мл, 11 мм/мл 10 мг/мл, 9 мг/мл, 8 мг/мл, 7 мг/мл, 6 мг/мл, 5 мг/мл, 4 мг/мл, 3 мг/мл, 2 мг/мл, 1 мг/мл или 0,1 мг/мл. В некоторых вариантах осуществления настоящего изобретения, указанные композиции могут содержать пептид глюкагона в концентрации, имеющей значение в диапазоне A-B мг/мл, например, в диапазоне от 0,001 до 30,0 мг/мл. В одном варианте указанная фармацевтическая композиция включает водные растворы, которые были простерилизованы и необязательно хранились в различных контейнерах. Такие растворы могут использоваться, согласно одному варианту осуществления настоящего изобретения, для получения предварительно подготовленных форм растворов, готовых для инъекции. В других вариантах, указанные фармацевтические композиции включают лиофилизированный порошок. Фармацевтические композиции могут также вводиться в упаковки как часть набора, который включает одноразовое устройство для введения композиции пациенту. В указанное устройство могут быть включены шприц и игла или шприц-тюбик. Такие контейнеры или наборы могут быть этикетированы с указанием условий хранения, которые включают хранение при соответствующей комнатной температуре или при охлаждении.

Согласно одному варианту осуществления настоящего изобретения, в нем рассматривается способ быстрого повышения уровня глюкозы, нормализации уровня глюкозы, стабилизации уровня глюкозы в крови или предупреждения или лечения гипогликемии с использованием предварительно изготовленной водной композиции пептида глюкагона по настоящему изобретению. Указанный способ включает стадию введения эффективного количества раствора, содержащего новый модифицированный пептид глюкагона по настоящему изобретению. В некоторых вариантах, водная композиция представляет собой упакованную в устройство композицию, которая используется для введения пациенту. В другом варианте, настоящее изобретение относится к способу индукции временного паралича кишечного тракта. Такой способ включает стадию введения пациенту одного или нескольких пептидов глюкагона по настоящему описании, в случае такой необходимости.

В еще одном варианте своего осуществления, настоящее изобретение относится к способу снижения набора веса или индукции потери веса, где указанный способ включает введение эффективного количества водного раствора, содержащего пептид глюкагона по настоящему изобретению. Способы снижения набора веса или индукции потери веса, как ожидаются, будут полезны для лечения ожирения разного происхождения, включая ожирение, индуцированное введением лекарственных средств, а также для снижения осложнений, ассоциированных с ожирением, которые включают сосудистые заболевания (болезнь коронарных артерий, инсульт, заболевание периферических сосудов, ишемию, связанную с реперфузией), гипертензию, начало развития диабета типа II, гиперлипидемию и скелетно-мышечные заболевания.

В других вариантах, настоящее изобретение относится к способам лечения гиперлипидемии или диабета, которые включают совместное введение инсулина и пептида глюкагона по настоящему изобретению. Гиперлипидемия включат диабет, сахарный диабет типа I, сахарный диабет типа II или диабет беременных, который может быть как инсулинозависимым, так и инсулиннезависимым, и настоящее относится к снижению осложнений диабета, которые включают нефропатию, ретинопатию и заболевания сосудов. Совместное введение инсулина и пептида глюкагона по настоящему изобретению может ослабить ночную гипогликемию и/или привести к забуфериванию гипогликемических эффектов инсулина, что позволяет вводить такие же или повышенные дозы быстро действующих или длительно действующих доз инсулина, где указанное введение сопровождается меньшими гипогликемическими эффектами. Настоящее изобретение также относится к композициям, включающим инсулин в сочетании с пептидом глюкагона по настоящему изобретению.

Согласно одному из вариантов осуществления настоящего изобретения, рассматривается улучшенный способ регуляции уровня глюкозы в крови у инсулинозависимых пациентов. Указанный способ включает стадии введения инсулина в количестве, терапевтически эффективном для контроля диабета, и введение нового модифицированного пептида глюкагона по настоящему изобретению в количестве, терапевтически эффективном для предупреждения гипогликемии, где указанные стадии введения разделяются периодом в двенадцать часов друг от друга. В одном варианте, совместное введение пептида глюкагона и инсулина осуществляют в виде одной композиции.

Все способы лечения, фармацевтические композиции, наборы и другие аналогичные варианты по настоящему описанию, в которых применимы термины «пептиды глюкагона» «аналоги агониста глюкагона», «агонисты глюкагона» или «аналоги глюкагона», включают также все фармацевтически приемлемые соли или сложные эфиры указанных соединений.

Репрезентативные пептиды глюкагона выбирают из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 33, где аминокислота в положении 29 пептида глюкагона связана со вторым пептидом через пептидную связь, и указанный второй пептид включает последовательность SEQ ID NO: 20, SEQ ID NO: 21 или SEQ ID NO: 22. В одном варианте, указанный пептид глюкагона является ПЭГилированным. В одном варианте, рассматриваемый способ включает стадию введения пептида, включающего последовательность SEQ ID NO: 24, SEQ ID NO: 25 и SEQ ID NO: 26, где полиэтиленовая цепь ковалентно присоединена к аминокислоте в положении 21 или в положении 24.

Оксиномодулин представляет собой пептид из 37 аминокислот, где имеется последовательность глюкагона из 29 аминокислот (например, SEQ ID NO: 1), за которой следует С-концевое расширение из 8 аминокислот с последовательностью SEQ ID NO: 21 (KRNRNNIA). Хотя в настоящем изобретении рассматривается вариант, когда рассматриваемые аналоги глюкагона могут быть необязательно присоединены к указанному С-концевому расширению из 8 аминокислот (SEQ ED NO: 21), в некоторых вариантах осуществления настоящее изобретение также относится к аналогам глюкагона и вариантам использования аналогов глюкагона, где указанные аналоги не содержат С-концевые аминокислоты с последовательность SEQ ID NO: 21 из непрерывной цепи 8 аминокислот.

Приведенное выше краткое описание не следует трактовать как ограничивающее какой-либо аспект настоящего изобретения, и в других разделах будут описаны дополнительные варианты, например в разделе, относящемся к подробному описанию изобретения. Объединенное описание приводится в полном документе и следует понимать, что могут рассматриваться все возможные сочетания описанных элементов, даже если сочетания таких элементов явно не указаны вместе в одном контексте, в одном предложении, абзаце или разделе данного документа.

Кроме того, настоящее изобретение включает любые, один или все, варианты осуществления настоящего изобретения, которые характеризуются более узким диапазоном охвата по любому из направлений, чем вариации, указанные в конкретных абзацах данного описания. Так, например, когда в качестве родового определения описываются конкретные аспекты настоящего изобретения, следует понимать, что каждый представитель такого родового понятия представляет собой, по отдельности, вариант настоящего изобретения и что сочетание двух или более компонентов такого родового понятия относится к вариантам осуществления настоящего изобретения.

КРАТКОЕ ОПИСАНИЕ РИСУНКОВ

На фиг. 1 приведена диаграмма, иллюстрирующая стабильность глюкагон-Cys21малеимидоПЭГ5K при температуре 37°C, который инкубировали в течение 24, 48, 72, 96, 144 и 166 часов, соответственно.

На фиг. 2 показаны данные, полученные при ВЭЖХ анализе глюкагон-Cys21малеимидПЭГ5K при pH 5, которые инкубировали при температуре 37°C в течение 24, 72 или 144 часов, соответственно.

На фиг. 3 показаны результаты, демонстрирующие растворимость аналогов глюкагона (D28, E29, E30) в сравнении с нативным глюкагоном после 60 часов хранения при температуре 25°C и при pH 2, 4, 5,5, 7 и 8, соответственно.

На фиг. 4 показаны данные, отражающие растворимость аналогов глюкагона (E15D28, D28E29 и D28E30) в сравнении с нативным глюкагоном после 24 часов хранения при температуре 25°C и затем в течение 24 часов при температуре 4°C при pH 2, 4, 5,5 и 7, соответственно.

На фиг. 5 проиллюстрирована максимальная растворимость аналогов глюкагона D28, D28E30, E15 и D28 через 24 часа при pH 7 при температуре 4°C.

На фиг. 6 проиллюстрированы данные, демонстрирующие индукцию цАМФ, опосредованную рецептором глюкагона, под действием аналогов глюкагона (K29 ▲, K30 ▼ и K29K30 ♦) относительно нативного глюкагона.

На фиг. 7 показаны данные, иллюстрирующие индукцию цАМФ, опосредованную рецептором глюкагона, под действием аналогов глюкагона (D28 □, E29 ∆, Е30 ▽, K30K31 ◊ и K30▼) относительно нативного глюкагона.

На фиг. 8 показаны результаты, демонстрирующие индукцию цАМФ, опосредованную рецептором глюкагона под действием аналогов глюкагона (D28 □, E28 ● и K29▲) относительно нативного глюкагона ■.

На фиг. 9 показаны результаты, демонстрирующие индукцию цАМФ, опосредованную рецептором глюкагона под действием аналогов глюкагона (D28E29 +, D28E30 X, E15D28 * и E29 ∆) в сравнении с нативным глюкагоном ■.

На фиг. 10 показаны данные, демонстрирующие изменения концентрации глюкозы в сыворотке крови у собак бигль после внутримышечного введения глюкагона и аналогов глюкагона. Животным вводили дозы по 0,005 мг/кг либо глюкагона, либо аналога глюкагона, где указанный глюкагон имел последовательность SEQ ID NO: 31, которая была присоединена к С-концу глюкагона (глюкагон CEX), или вводили аналог глюкагона, включающий замещение аспарагиновой кислотой по положению аминокислоты 28 (глюкагон-Asp28) в SEQ ID NO: 11.

На фиг. 11A и 11В показаны, соответственно, данные, демонстрирующие индукцию цАМФ, опосредованную рецептором глюкагона, и индукцию цАМФ, опосредованную рецептором GLP-1, под действием аналога глюкагона, включающего множественные замещения: T16, A20, E21, A24, Nle27, D28, E29.

На фиг. 12 приведен график, иллюстрирующий значения площади под кривой при оценке УФ поглощения при длине волны 280 нм для композиции, которая включает пептид SEQ ID NO: 71, в виде функции времени (месяцы).

На фиг. 13 приведен график, демонстрирующий значения площади под кривой при оценке УФ поглощения при длине волны 280 нм для композиции, которая включает пептид SEQ ID NO: 76, в виде функции времени (месяцы).

На фиг. 14 приведен график, демонстрирующий значения площади под кривой при оценке УФ поглощения при длине волны 280 нм для композиции, которая включает пептид SEQ ID NO: 78, в виде функции времени (месяцы).

На фиг. 15 приведен график, демонстрирующий общее изменение веса тела (%) у мышей, которым инъецировали носитель-контроль, лираглютид (Liraglutide), (C16) амид глюкагона γE-γE-CI6, амид глюкагона AA-C16 или βAβA-C16 амид глюкагона, в указанной дозе.

На фиг. 16 приведен график, показывающий уровень жировой массы (г), измеренный на 7 день в ходе исследования мышей, которым инъецировали носитель-контроль, лираглютид (Liraglutide), (C16) амид глюкагона, γE-γE-CI6 амид глюкагона, AA-C16 амид глюкагона или βAβA-C16 амид глюкагона в указанной дозе.

На фиг. 17 приведен график, демонстрирующий изменения уровня глюкозы в крови (мг/г) у мышей, которым инъецировали носитель-контроль, лираглютид (Liraglutide), (C16) амид глюкагона, γE-γE-CI6 амид глюкагона, AA-C16 амид глюкагона или βAβA-C16 амид глюкагона в указанной дозе.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

ОПРЕДЕЛЕНИЯ

В тексте описания и в формуле изобретения использовалась терминология, которая соответствует приведенным ниже определениям.

В контексте настоящего описания, термин «фармацевтически приемлемый носитель» включает любой из стандартных фармацевтических носителей, такой как фосфатно-буферный солевой раствор, вода, эмульсии, такие как эмульсия типа «масло-в-воде» или эмульсия типа «вода-в-масле», а также различные типы увлажнителей. Указанный термин также включает любое средство из числа средств, разрешенных регламентирующим агентством Федерального Правительства США или указанные в Фармакопее США как подходящее для использования у животных, включая людей.

В контексте настоящего описания, термин «фармацевтически приемлемая соль» относится к солям соединений, которые сохраняют биологическую активность исходного соединения и которые не являются биологически или в ином плане нежелательными. Многие из приведенных в настоящем описании соединений способны формировать соли добавления кислоты и/или соли добавления основания при добавлении амино и/или карбоксильных групп или аналогичных групп.

Фармацевтически приемлемые соли добавления основания могут быть получены с использованием неорганических и органических оснований. Соли, полученные из неорганических оснований, включают, в качестве примера, соли натрия, калия, лития, аммония, кальция и магния. Соли, полученные из органических оснований, включают, без ограничения, соли первичных, вторичных и третичных аминов.

Фармацевтически приемлемые соли добавления кислоты могут быть получены с использованием неорганических и органических кислот. Соли, полученные из неорганических кислот, включают соли хлористоводородной кислоты, бромистоводородной кислоты, серной кислоты, азотной кислоты, фосфорной кислоты и т.п. Соли, полученные с использованием органических кислот, включают соли уксусной кислоты, пропионовой кислоты, гликолевой кислоты, пировиноградной кислоты, щавелевой кислоты, яблочной кислоты, малоновой кислоты, янтарной кислоты, малеиновой кислоты, фумаровой кислоты, винной кислоты, лимонной кислоты, бензойной кислоты, коричной кислоты, миндальной кислоты, метансульфоновой кислоты, этансульфоновой кислоты, п-толуолсульфоновой кислоты, салициловой кислоты и т.п.

В контексте настоящего описания, термин «лечение» включает профилактику определенного заболевания или состояния, или ослабление симптомов, ассоциированных с определенным заболеванием или состоянием, и/или предупреждение или устранение указанных симптомов. Например, используемый в контексте настоящего описания термин «лечение диабета» относится в основном к изменению уровней глюкозы крови в направлении нормализации этих уровней и может включать повышение или понижение уровня глюкозы в крови, в зависимости от конкретной ситуации.

В контексте настоящего описания, термин «эффективное» применительно к количеству или термин «терапевтически эффективное количество» применительно к пептиду глюкагона относится к не токсичному, но достаточному количеству пептида, которое способно обеспечить желательный эффект. Например, одним из таких желательных эффектов может быть предупреждение или лечение гипогликемии, которое определяется, например, по увеличению уровня глюкозы в крови. Количество, которое является «эффективным», будет варьировать от субъекта к субъекту, в зависимости от возраста и общего состояния индивидуума, способа введения и т.п. Таким образом, не всегда возможно точно определить «эффективное количество». Однако, соответствующее «эффективное количество» в любом отдельном случае может быть определено специалистом в данной области с использованием несложных процедур.

Термин «парентеральное» означает введение не через пищеварительный канал, но каким-либо другим способом, таким как подкожное, внутримышечное, интраспинальное или внутривенное введение.

В контексте настоящего описания, термин «очищенный» и аналогичные термины относятся к выделению молекулы или соединения с получением их в форме, которая по существу свободна от контаминантов, обычно ассоциированных с данной молекулой или соединением в нативном или природном окружении. В контексте настоящего описания, термин «очищенный» не означает абсолютную чистоту. Скорее, это будет относительное определение. Термин «очищенный полипептид» в контексте настоящего описания относится к полипептиду, который был отделен от других соединений, включающих, без ограничения, молекулы нуклеиновой кислоты, липидов и углеводов.

Термин «выделенный» означает, что рассматриваемый материал был отделен от исходного окружения (например, от природной среды, если это природный материал). Так, например, природный полинуклеотид, присутствующий в живом организме животного, не является выделенным, но тот же самый полинуклеотид, который был отделен от части или от всех совместно присутствующих с ним материалов в природной системе, является выделенным.

В контексте настоящего описания термин «нативный глюкагон» относится к пептиду, состоящему из последовательности SEQ ID NO: 1, а термин «нативный GLP-1» представляет собой родовой термин, который обозначает амид GLP-l(7-36) (состоящий из последовательности SEQ ID NO: 57), кислотную форму GLP-l(7-37) (состоящую из последовательности SEQ ID NO: 58) или смесь указанных двух соединений. В контексте настоящего описания, общее упоминание «глюкагона» или «GLP-1» в отсутствие любых дополнительных определений, будет означать нативный глюкагон или нативный GLP-1, соответственно.

Термин «пептид глюкагона» в контексте настоящего описания обозначает любой пептид, включающий либо аминокислотную последовательность SEQ ID NO: 1, либо любой аналог аминокислотной последовательности SEQ ID NO: 1, который включает аминокислотные замещения, добавления, или делеции, или посттрансляционные модификации (например, метилирование, ацилирование, убихитинилирование и т.п.) пептида, где указанный аналог стимулирует активность по рецептору гликагона или GLP-1, например, при измерении в тесте на продукцию цАМФ с использование методики, описанной в примере 13.

Термин «агонист глюкагона» относится к комплексу, включающему пептид глюкагона, который стимулирует активность по рецептору глюкагона, которая может быть определена, в тесте на продукцию цАМФ с использование методики, описанной в примере 13.

В контексте настоящего описания, «аналог агониста глюкагона» представляет собой пептид глюкагона, включающий последовательность, выбранную из группы, состоящей из SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 и SEQ ID NO: 13, или аналог такой последовательности, которая была модифицирована таким образом, что включает одно или несколько консервативных замещений аминокислот в положениях 2, 5, 7, 10, 11, 12, 13, 14, 16,17, 18,19, 20, 21, 24, 27, 28 или 29.

В контексте настоящего описания, термин «модификация» применительно к аминокислоте относится к замещению, добавлению или делеции аминокислоты и включает замещение или добавление любой из 20 аминокислот, обычно присутствующих в белках человека, а также с использованием для этой цели атипичных или неприродных аминокислот. Все приведенные в ходе описания ссылки на конкретные положения аминокислот, указываемые цифровыми значениями (например, положение 28), будут относиться к аминокислоте в положении, характерном для нативного глюкагона (SEQ ID NO: 1), или к соответствующему положению аминокислоты в любом из ее аналогов. Так, например, ссылка в настоящем описании на «положение 28» будет означать соответствующее положение 27 в аналоге глюкагона, где первая аминокислота в SEQ ID NO: 1 была делетирована. Аналогично, ссылка в контексте настоящего описания на «положение 28», будет означать соответствующее положение 29 в аналоге глюкагона, где аминокислота была добавлена перед N-концом в SEQ ID NO: 1.

В контексте настоящего описания, термин «замещение» применительно к аминокислоте относится к замещению одного аминокислотного остатка другим аминокислотным остатком.

В тексте настоящего описания термин «консервативное замещение аминокислоты» определяется как взаимообмен в рамках одной из указанных ниже пяти групп:

I. Малые, алифатические, неполярные или слабо полярные остатки: Ala, Ser, Thr, Pro, Gly;

II. Полярные отрицательно заряженные остатки и их амиды:

Asp, Asn, Glu, Gin, цистеиновая кислота и гомоцистеиновая кислота;

III. Полярные положительно заряженные остатки:

His, Arg, Lys; Орнитин (Orn).

IV. Крупные алифатические, неполярные остатки:

Met, Leu, Ile, Val, Cys, норлейцин, (Nle), гомоцистеин;

V. Крупные ароматические остатки:

Phe, Tyr, Trp, ацетилфенилаланин.

В контексте настоящего описания, общий термин «полиэтиленгликоль» или «ПЭГ» относится к смесям конденсированных полимеров этиленоксида и воды, имеющих разветвленную или линейную цепь, которая обозначается общей формулой H(OCH2CH2)nOH, где n имеет значения по меньшей мере 9. В отсутствие дополнительной характеристики, этот термин будет включать полимеры этиленгликоля со средней общей молекулярной массой, выбранной из диапазона от 500 до 40000 дальтон. Термин «полиэтиленгликоль» или «ПЭГ» используется в сочетании с цифровым показателем, который означает приблизительный средний молекулярный вес данной молекулы. Например, ПЭГ-5000 относится к полиэтиленгликолю, имеющему суммарную среднюю молекулярную массу около 5000.

В контексте настоящего описания термин «ПЭГилированный» и аналогичные термины относятся к соединению, которое было модифицировано от его нативного состояния за счет присоединению полимера полиэтиленгликоля к такому соединению. «ПЭГилированный пептид глюкагона» обозначает пептид глюкагона, который содержит цепь ПЭГ, ковалентно присоединенную к пептиду глюкагона.

Если в тексте настоящего описания приводится общее упоминание о пептиде, это будет относиться к таким пептидам, которые содержат модифицированный амино- и карбоксильный конец. Так, например, аминокислотная цепь, включающая амидную группу вместо концевой карбоксильной группы, будет определяться аминокислотной последовательностью, которая обозначает стандартные аминокислоты.

В контексте настоящего описания, термин «линкер» обозначает связь, молекулу или группы молекул, которые соединяют две отдельных структуры друг с другом. Линкеры могут обеспечивать наличие оптимального пространственного промежутка между двумя структурами или могут дополнительно создавать лабильную связь, которая позволяет указанным двум структурам отделяться друг от друга. Лабильные связи включают фоторасщепляемые группы, кислотолабильные фрагмента, фрагмента, лабильные в щелочных условиях, и энзиматически расщепляемые группы.

В контексте настоящего описания, термин «димер» относится к комплексу, включающему две субъединицы, ковалентно соединенные друг с другом через линкер. Термин «димер», используемый без соответствующего дополнительного определения, относится как к гомодимерам, так и к гетеродимерам. Гомодимер включает две идентичных субъединицы, тогда как гетеродимер включает две субъединицы, которые различаются, хотя обе субъединицы в значительной мере аналогичны друг другу.

В контексте настоящего описания, термин «пептид глюкагона, стабилизированный по pH» относится к аналогу агониста глюкагона, который демонстрирует улучшенную стабильность и растворимость относительно нативного глюкагона в водных буферах в достаточно широком диапазоне pH, используемом для фармакологических целей.

В контексте настоящего описания, термин «заряженная аминокислота» относится к такой аминокислоте, которая включает боковую цепь с отрицательным зарядом (например, де-протонированную) или с положительным зарядом (например, протонированную), в водном растворе при физиологическом значении pH. Например, отрицательно заряженные аминокислоты включают аспарагиновую кислоту, глютаминовую кислоту, цистеиновую кислоту, гомоцистеиновую кислоту и гомоглютаминовую кислоту, тогда как положительно заряженные аминокислоты включают аргинин, лизин и гистидин. Заряженные аминокислоты включают заряженные аминокислоты из числа 20 аминокислот, обычно присутствующих в белках человека, а также атипичные или неприродные аминокислоты.

Неприродные аминокислоты относятся к аминокислотам, которые не встречаются в природных условиях in vivo, но которые, тем не менее, могут быть включены в пептидную структуру согласно настоящему описанию. Коммерческие источники атипичных аминокислот включают компании Sigma-Aldrich (Milwaukee, WI), ChemPep Inc. (Miami, FL) и Genzyme Pharmaceuticals (Cambridge, MA). Атипичные аминокислоты могут быть также приобретены от коммерческих поставщиков, могут быть синтезированы de novo или могут быть модифицированы химическим способом или дериватизированы на основе других аминокислот.

В контексте настоящего описания, термин «кислая аминокислота» относится к аминокислоте, которая включает вторичную кислую фрагмент, в частности, это может быть группа карбоновой кислоты или сульфоновой кислоты.

Термин «алкил» относится к линейному или разветвленному углеводороду, содержащему указанное количество атомов углерода. Репрезентативные алкилы включают метильные, этильные и линейные пропильные группы.

Термин «гетероалкил» относится к линейному или разветвленному углеводороду, содержащему указанное количество атомов углерода и по меньшей мере один гетероатом в структурном скелете углеводорода. Подходящие для целей настоящего изобретения гетероатомы включают, без ограничения, N, S и O.

ВАРИАНТЫ ОСУЩЕСТВЛЕНИЯ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ

Повышенная растворимость

Авторы изобретения обнаружили, что нативный глюкагон может быть модифицирован за счет введения заряда по карбоксильному концу, что приводит к повышению растворимости пептида при сохранении агонистических свойств пептида. Повышенная растворимость позволяет изготавливать и хранить растворы глюкагона при значениях pH, близких к нейтральным. Изготовление растворов глюкагона при относительно нейтральных значениях pH (например, при pH от примерно 6,0 до примерно 8,0) повышает длительную стабильность пептидов глюкагона.

Соответственно, один вариант осуществления настоящего изобретения относится к агонисту глюкагона, который был модифицирован относительно пептида дикого типа по последовательности His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr (SEQ ID NO: 1) с целью повышения растворимости пептида в водных растворах, в частности, при значениях pH, варьирующих от примерно 5,5 до примерно 8,0, с сохранением биологической активности нативного пептида. В одном варианте осуществления настоящего изобретения, введение заряда в пептид осуществляется путем замещения в нем нативных незаряженных аминокислот заряженными аминокислотами, выбранным из группы, включающей лизин, аргинин, гистидин, аспарагиновую кислоту, глютаминовую кислоту, или путем добавления заряженных аминокислот к амино- или карбоксильному концу пептида. Неожиданно, заявители обнаружили, что замещение аминокислоты, присутствующей в нормальном состоянии в положении 28 и/или 29, заряженными аминокислотами и/или добавление одной или двух заряженных аминокислот по карбоксильному концу пептида глюкагона повышает растворимость и стабильность пептидов глюкагона в водных растворах при физиологически релевантных значениях pH (то есть, при значениях pH от примерно 6,5 до примерно 7,5) по меньшей мере в 5 раз и до 30 раз.

Соответственно, пептиды глюкагона по одному из вариантов осуществления настоящего изобретения сохраняют активный глюкагон и демонстрируют по меньшей мере 2-кратную, 5-кратную, 10-кратную, 15-кратную, 25-кратную, 30-кратную или более высокую растворимость относительно нативного глюкагона при значениях pH в диапазоне от примерно 5,5 до примерно 8, например при значении pH 7, при измерении после 24 часов хранения при температуре 25°С. Любой из пептидов глюкагона по настоящему изобретению может дополнительно характеризоваться повышенной стабильностью при значениях pH в диапазоне от 5,5 до 8, например, будет сохранять по меньшей мере 75%, 80%, 90%, 95%, 96%, 97%, 98% или 99% исходного пептида после 24 часов хранения при температуре 25°С. В некоторых вариантах, пептиды глюкагона по настоящему изобретению демонстрируют повышенную стабильность, которая составляет по меньшей мере 75% (например, по меньшей мере 80%, по меньшей мере 85%, по меньшей мере 90%, по меньшей мере 95% более, чем 95%, вплоть до 100%) от концентрации пептида или выявляется деградация пептида на уровне, менее, чем 25% (например, по меньшей мере 20%, менее, чем 15%, менее, чем 10%, менее, чем 5%, 4%, 3%, 2%, 1%, вплоть до 0%), при оценке при длине волны 280 нм с использованием ультрафиолетового (УФ) детектора через 1 или большее число недель (например, примерно 2 недель, примерно 4 недель, примерно 1 месяца, примерно двух месяцев, примерно четырех месяцев, примерно шести месяцев, примерно восьми месяцев, примерно десяти месяцев, примерно двенадцати месяцев) в растворе при температуре, составляющей по меньшей мере 20°C (например, 21°С, 22°C, 23°C, 24°C, 25°C, 26°C, по меньшей мере 27,5°C, по меньшей мере 30°C, по меньшей мере 35°C, по меньшей мере 40°C, по меньшей мере 50°C) и меньше, чем 100°C, меньше, чем 85°C, меньше, чем 75°C или меньше, чем 70°C. Пептиды глюкагона могут включать дополнительные модификации, которые меняют их фармацевтические свойства, например, определяют повышенную эффективность, более длительный период полувыведения их кровотока, повышенный срок годности, сниженный уровень осаждения или агрегации и/или сниженный уровень разложения, например, сниженный уровня расщепленных или химически модифицированных форм после хранения.

В одном варианте осуществления настоящего изобретения, пептид глюкагона с повышенной стабильностью может быть получен, например, при введении одной, двух, трех или большего числа заряженных аминокислот к С-концевой части нативного глюкагона, и в одном варианте это осуществляется на С-конце в положении 27. Такая заряженная аминокислота может быть введена, например, путем замещения нативной аминокислоты заряженной аминокислотой, например, в положениях 28 или 29, или альтернативно, путем добавления заряженной аминокислоты, например, после положения 27, 28 или 29. В репрезентативных вариантах, указанные одна, две, три или большее число заряженных аминокислот заряжены отрицательно. В других вариантах, указанные одна, две, три или большее число аминокислот заряжены положительно. В конкретных репрезентативных вариантах осуществления настоящего изобретения, пептид глюкагона может включать одну или две из указанных ниже модификаций: замещение N28 на E; замещение N28 на D; замещение T29 на D; замещение T29 на E; вставка Е после положения 27, 28 или 29; вставка D после положения 27, 28 или 29. Например, это могут быть D28E29, E28E29, E29E30, E28E30, D28E30.

Другие модификации и сочетания

Могут быть введены дополнительные модификации в пептид глюкагона, которые могут дополнительно повысить растворимость и/или стабильность и/или активность глюкагона. Пептид глюкагона может альтернативно включать другие модификации, которые по существу не влияют на растворимость или стабильность и которые по существу не оказывают эффект на активность глюкагона. В репрезентативных вариантах осуществления настоящего изобретения, указанный пептид глюкагона может включать в целом 1, до 2, до 3, до 4, до 5, до 6, до 7, до 8, до 9, до 10, до 11, до 12, до 13 или до 14 аминокислотных модификаций относительно нативной последовательности глюкагона. В некоторых вариантах осуществления настоящего изобретения, такие аналоги сохраняют по меньшей мере 22, 23, 24, 25, 26, 27 или 28 природных аминокислот в соответствующих положениях, имеющихся в нативном глюкагоне (например, содержат 1-7, 1-5 или 1-3 модификаций относительно природного глюкагона).

В некоторых вариантах осуществления настоящего изобретения осуществляют 1, 2, 3, 4 или 5 неконсервативных замещений по любому из положений 2, 5, 7, 10, 11,12,13,14,17, 18, 19, 20, 21, 24, 27, 28 или 29, а также проводят до 5 дополнительных консервативных замещений по любому из этих положений. В некоторых вариантах, осуществляют 1, 2 или 3 аминокислотных модификации в аминокислотах, которые находятся в положениях 1-16 и вводят 1, 2 или 3 аминокислотных модификации в аминокислоты в положениях 17-26.

Репрезентативные модификации включают, без ограничения, следующие:

(a) неконсервативные замещения, консервативные замещения, добавления или делеции, которые сохраняют по меньшей мере частичную активность агониста глюкагона, например, консервативные замещения в одном или нескольких из указанных положений: 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27, 28 или 29, замещение Tyr в положении 10 на Val или Phe, замещение Lys в положении 12 на Arg, замещение одного или нескольких указанных положений на Ala;

(b) делецию аминокислот в положениях 29 и/или 28, и необязательно в положении 27, при сохранении по меньшей мере частичной активности агониста глюкагона;

(c) модификацию аспарагиновой кислоты в положении 15, например, за счет замещения глютаминовой кислотой, гомоглютаминовой кислотой, цистеиновой кислотой или гомоцистеиновой кислотой, что может снизить уровень разложения; или модификацию серина в положении 16, например, путем замещения треонина, AIB глютаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь с длиной 4 атома, или, альтернативно, любой из указанных ниже аминокислот: глютамин, гомоглютаминовая кислота или гомоцистеиновая кислота, которые также могут снизить уровень разложения, связанный с расщепления связи Asp15-Ser16;

(d) добавление гидрофильного фрагмента, такого как водорастворимый полимер полиэтиленгликоль, описанный выше, например, в положении 16, 17, 20, 21, 24, 29, 40 или по С-концевой аминокислоте, что может повысить растворимость и/или период полувыведения;

(e) модификацию метионина в положении 27, например, путем замещений лейцином или норлейцином, с целью снижения уровня окислительного разложения;

(f) модификацию Gln в положении 20 или 24, например, путем замещения на Ser, Thr, Ala или AIB, с целью снижения уровня разложения, который происходит при дезамидировании Gln;

(g) модификацию Asp в положении 21, например, путем замещения с использованием Glu, с целью снижения уровня разложения, которое происходит при дегидратации Asp с образованием циклического сукцинимидного интермедиата с последующей изомеризацией до изоаспартата;

(h) модификации в положении 1 или в положении 2, согласно приведенному описанию, которые повышают устойчивость с расщеплению DPP-IV, необязательно в сочетании с введением внутримолекулярного мостика, такого как лактамный мостик между положениями «i» и «i+4»", где i равно целому числу от 12 до 25, например, 12, 16, 20, 24;

(i) ацилирование или алкилирование пептида глюкагона по настоящему изобретению, которое может повысить его активность по рецепторам глюкагона и GLP-1, повысить период полувыведения из кровотока и/или увеличить длительность действия и/или задержать начало действия, необязательно в сочетании с добавлением гидрофильного фрагмента, дополнительно или альтернативно, необязательно в сочетании с модификацией, которая селективно снижает активность по пептиду GLP-1, например, за счет модификации Thr в положении 7, такой как замещение Thr в положении 7 аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile; делеции аминокислот на участке от С-конца до аминокислоты в положении 27 (например, делецию одной или двух аминокислот в положениях 28 и 29 с получением пептида, включающего в длину 27 и 28 аминокислот); или их комбинацию;

(j) C-концевое расширение согласно настоящему описанию;

(k) гомодимеризацию или гетеродимеризацию согласно настоящему описанию; и

сочетание всех указанных выше вариантов.

Репрезентативные модификации включают по меньшей мере одну модификацию аминокислоты, выбранную из группы А, и одну или несколько аминокислотных модификаций, выбранных из группы B и/или группы С;

где группа А включает:

замещение Asn в положении 28 заряженной аминокислотой;

замещение Asn в положении 28 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замещение в положении 28 Asn, Asp или Glu;

замещение в положении 28 Asp;

замещение в положении 28 Glu;

замещение Thr в положении 29 заряженной аминокислотой;

замещение Thr в положении 29 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замещение по положению 29 на Asp, Glu или Lys;

замещение по положению 29 на Glu;

вставку 1-3 заряженных аминокислот после положения 29;

вставку после положения 29 Glu или Lys;

вставку после положения 29 Gly-Lys или Lys-Lys;

или их сочетания;

где группа B включает:

замещение Asp в положении на Glu;

замещение Ser в положении 16 на Thr или AIB;

и где группа С включает:

замещение His в положении 1 ненативной аминокислотой; где указанное замещение снижает чувствительность пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV),

замещение Ser в положении 2 ненативной аминокислотой, где указанное замещение снижает чувствительность пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV),

замещение Lys в положении 12 на Arg;

замещение Gln в положении 20 на Ala или AIB;

замещение Asp в положении 21 на Glu;

замещение Gln в положении 24 на Ala или AIB;

замещение Met в положении 27 на Leu или Nle;

делецию аминокислот в положениях 27-29;

делецию аминокислот в положениях 28-29;

делецию аминокислоты в положении 29;

или их сочетания.

Модификации по положению 3

Активность рецептора глюкагона может быть снижена при осуществлении модификации аминокислоты в положении 3, например, за счет замещения имеющегося в природном глюкагоне глютамина в положении 3 кислой, основной или гидрофобной аминокислотой. Например, замещение аминокислоты в положении 3 глютаминовой кислотой, орнитином или норлейцином значительно снижает или полностью устраняет активность по рецептору глюкагона.

Сохранение или повышение активности по рецептору глюкагона может быть достигнуто за счет модификации Gln в положении 3 аналогом глютамина. Так, например, пептид глюкагона, включающий аналог глютамина в положении 3, может демонстрировать примерно 5 %, примерно 10%, примерно 20%, примерно 50% или примерно 85% или более высокую активность относительно нативного глюкагона (SEQ ID NO: 1) по рецептору глюкагона. В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона, включающий аналог глютамина в положении 3, может демонстрировать примерно 20%, примерно 50%, примерно 75%, примерно 100%, примерно 200% или примерно 500% или более высокую активность от активности соответствующего пептида глюкагона, который имеет такую же аминокислотную последовательность, что и пептид, включающий аналог глютамина, за исключением модифицированной аминокислоты в положении 3 (например, SEQ ID NO: 69 или SEQ ID NO: 70). В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона, включающий аналог глютамина в положении 3, демонстрирует более высокую активность по рецептору глюкагона, но указанная повышенная активность не составляет более, чем 1000%, 10000%, 100,000% или 1000000%, относительно активности нативного глюкагона соответствующего пептида глюкагона, имеющего такую же аминокислотную последовательность, что и пептид, включающий аналог глютамина, за исключение модифицированной аминокислоты в положении 3.

В некоторых вариантах осуществления настоящего изобретения, аналог глютамина представляет собой природную или неприродную аминокислоту, содержащую боковую цепь структуры I, II или III:

Структура I

Структура II

Структура III

где R1 обозначает С0-3алкил или С0-3гетероалкил; R2 обозначает NHR4 или С1-3алкил; R3 обозначает С1-3алкил; R4 обозначает H или C1-3алкил; X обозначает NH, O или S; и Y обозначает NHR4, SR3 или OR3. В некоторых вариантах, X обозначает NH или Y обозначает NHR4. В некоторых вариантах, R1 обозначает C0-2алкил или C1гетероалкил. В некоторых вариантах, R2 обозначает NHR4 или C1алкил. В некоторых вариантах, R4 обозначает H или C1алкил. В репрезентативных вариантах, аминокислота, содержащая боковую цепь структуры I, характеризуется тем, что R1 обозначает CH2-S, X обозначает NH и R2 обозначает CH3 (ацетоимидометилцистеин, С(Acm)); R1 обозначает CH2, X обозначает NH и R2 обозначает CH3 (ацетилдиаминобутановая кислота Dab(Ac)); R1 обозначает C0 алкил, X обозначает NH, R2 обозначает NHR4, и R4 обозначает H (карбамоилдиаминопропановая кислота Dap(мочевина)); или R1 обозначает CH2-CH2, X обозначает NH и R2 обозначает CH3 (ацетилорнитин Orn(Ac)). В репрезентативных вариантах, аминокислота, включающая боковую цепь структуры II, характеризуется тем, R1 обозначает CH2, Y обозначает NHR4 и R4 обозначает CH3 (метилглютамин, Q(Me)). В репрезентативных вариантах, аминокислота, включающая боковую цепь структуры III, характеризуется тем, что R1 обозначает CH2 и R4 обозначает H (метионинсульфоксид, M(O)). В конкретных вариантах осуществления настоящего изобретения, аминокислота в положении 3 замещена Dab(Ac). Например, агонисты глюкагона могут включать аминокислотную последовательность SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73 и SEQ ID NO: 74.

Повышенная активность по рецептору GLP-1 достигается за счет замещения карбоновой кислоты в С-концевой аминокислоте нейтрально заряженной группой, такой как амид или сложный эфир. И наоборот, сохранение нативной карбоновой кислоты по С-концу пептида сохраняет относительно более высокую селективность пептида глюкагона для рецептора глюкагона в сравнении с активностью по рецептору GLP-1 (например, выше, чем примерно в 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20-раз).

Устойчивость к DPP-IV

В некоторых вариантах осуществления настоящего изобретения, описываемые в нем пептиды глюкагона дополнительно модифицированы по положению 1 или 2 для целей снижения чувствительности к расщеплению дипептидилпептидазой IV. Более конкретно, в некоторых вариантах, положение 1 в пептидном аналоге замещается аминокислотой, выбранной из группы, состоящей из D-гистидина, альфа,альфа-диметилимидазолуксусной кислоты (DMIA), N-метилгистидина, альфа-метилгистидина, имидазолуксусной кислоты, дезаминогистидина, гидроксигистидина, ацетилгистидина и гомогистидина.

Более конкретно, в некоторых вариантах осуществления настоящего изобретения, положение 2 в пептидном аналоге замещается аминокислотой, выбранной из группы, состоящей из D-серина, D-аланина, валина, амино-N-масляной кислоты, глицина, N-метилсерина и аминоизомасляной кислоты. В одном варианте осуществления настоящего изобретения, положение 2 в пептидном аналоге замещено аминокислотой, выбранной из группы D-серина, D-аланина, глицина, N-метилсерина и аминоизомасляной кислоты. В другом варианте осуществления настоящего изобретения, положение 2 в пептидном аналоге замещено аминокислотой, выбранной из группы, состоящей D-серина, глицина и аминоизомасляной кислоты.

В тех случаях, когда замещение или модификация, или дериватизация по положениям 1 или 2 снижает активность по рецептору глюкагона, внутримолекулярный мостик в С-концевой части (аминокислоты 12-29) пептида (например, лактамный мостик между боковыми цепями аминокислот в положениях «i» и «i+4», где i равно от 12 до 25) может повысить активность глюкагона по рецептору глюкагона.

Добавление гидрофильных фрагментов

Гидрофильные фрагменты, такие как ПЭГ группы, могут быть присоединены к пептидам глюкагона в любых подходящих условиях, применяемых для взаимодействия пептида с активированной полимерной молекулой. При этом могут использоваться любые известные в данной области способы, включающие присоединение за счет ацилирования, восстановительного алкилирования, по реакции сочетания Михаэля, в ходе тиол-зависимого алкилирования или других химиоселективных методов конъюгирования/лигирования реакционной группы на ПЭГ фрагменте (например, альдегидной, амино, сложноэфирной, тиоловой, α-галогенацетильной, малеимидо или гидразино группы) с реакционной группой на целевом соединении (например, альдегидной, амино, сложноэфирной, тиоловой, α-галогенацетильной, малеимидо или гидразино группы). Активирующие группы, которые могут использоваться для соединения водорастворимого полимера с одним или несколькими белками, включают, без ограничения, сульфоновую, малеимидную, сульфгидрильную, тиоловую, трифлатную, трезилатную, азидириновую, оксирановую, 5-пиридильную и альфа-галогенированную ацильную группу (например, альфа-йодуксусную кислоту, альфа-бромуксусную кислоту, альфа-хлоруксусную кислоту). Если присоединение к пептиду осуществляется посредством восстановительного алкилирования, выбранный полимер должен иметь один реакционноспособный альдегид, так чтобы степень полимеризации могла контролироваться. См., например, Kinstler et al., Adv. Drug. Delivery Rev. 54: 477-485 (2002); Roberts et al., Adv. Drug Delivery Rev. 54: 459-476 (2002); и Zalipsky et al., Adv. Drug Delivery Rev. 16: 157-182 (1995).

В конкретном аспекте настоящего изобретения, аминокислотный остаток на пептиде глюкагона, содержащий тиол, модифицируют гидрофильным фрагментом, таким как ПЭГ. В некоторых вариантах тиол модифицируют малеимид-активированным ПЭГ в реакции сочетания Михаэля с получением ПЭГилированного пептида, включающего тиоэфирную связь, как показано ниже:

В некоторых вариантах, указанный тиол модифицируют галогенацетил-активированным ПЭГ в реакции нуклеофильного замещения, которая приводит к получению ПЭГилированного пептида, включающего тиоэфирную связь, как показано ниже:

Подходящие нуклеофильные фрагменты включают полиэтиленгликоль (ПЭГ), полипропиленгликоль, полиоксиэтилированные полиолы (например, POG), полиоксиэтилированный сорбит, полиоксиэтилированную глюкозу, полиоксиэтилированный глицерин (ПОГ), полиоксиалкилены, полиэтиленгликольпропиональдегид, сополимеры этиленгликоля/пропиленгликоля, монометоксиполиэтиленгликоль, моно-(C1-C10)алкокси- или арилоксиполиэтиленгликоль, карбоксиметилцеллюлозу, полиацетали, поливиниловый спирт (PVA), поливинилпирролидон, поли-1,3-диоксалан, поли-1,3,6-триоксан, сополимер этилена/малеинового ангидрида, поли(β-аминокислоты), (гомополимеры или неупорядоченные сополимеры), поли(н-винилпирролидон)полиэтиленгликоль, гомополимеры пропропиленгликоля (ППГ) и другие полиалкиленоксиды, сополимеры полипропиленоксида/этиленоксида, колоновые кислоты или другие полимеры полисахаридов, фиколл или декстран и их смеси.

Согласно некоторым вариантам осуществления настоящего изобретения, полиэтиленгликолевая цепь имеет молекулярную массу, выбранную из диапазона от примерно 500 до примерно 40000 дальтон. В одном варианте, полиэтиленгликолевая цепь имеет молекулярную массу, выбранную из диапазона от примерно 500 до примерно 5000 дальтон или от примерно 1000 до примерно 5000 дальтон. В другом варианте, указанная полиэтиленгликолевая цепь имеет молекулярную массу, составляющую от примерно 10000 до примерно 20000 дальтон. В еще других репрезентативных вариантах, указанная полиэтиленгликолевая цепь имеет молекулярную массу от примерно 20000 до примерно 40000 дальтон.

Декстраны представляют собой полимеры полисахаридов, состоящие из глюкозных субъединиц, преимущественно соединенных α1-6 связями. Декстран доступен в виде молекул с различным молекулярным весом, варьирующим в диапазоне от примерно 1 кДа до примерно 100 кДа или от примерно 5, 10, 15 или 20 кДа до примерно 20, 30, 40, 50, 60, 70, 80 или 90 кДа.

В настоящем изобретении рассматриваются линейные или разветвленные полимеры. Получаемые препараты конъюгатов могут быть по существу монодисперсными или полидисперсными и могут содержать примерно 0,5, 0,7, 1, 1,2, 1,5 или 2 полимерных фрагмента на пептид.

Ацилирование

Согласно одному из вариантов осуществления настоящего изобретения, пептид глюкагона модифицируют таким образом, чтобы он включал ацильную группу, например, ацильную группу, которая не присутствует в естественном состоянии в данной аминокислоте (например, ацильную группу, которая является ненативной для природной аминокислоты). Добавление ацильной группы приводит к тому, что пептид будет характеризоваться следующими свойства, одним или несколькими, из числа перечисленных ниже: увеличенный период полувыведения из кровотока, задержка начала действия, более длительное действие, повышенная устойчивость к протеазам, таким как DPP-IV, и повышенная активность по рецепторам GLP-1 и глюкагона. Как показано в настоящем описании, ацилирование пептида глюкагона не ведет к снижению активности по рецепторам глюкагона и GLP-1. Скорее, в некоторых случаях ацилирование фактически повышает активность по рецепторам GLP-1 и глюкагона. Соответственно, эффективность ацилированных аналогов сравнима с неацилированными вариантами аналогов ко-агонистов глюкагона, если указанная эффективность не повышается.

Согласно одному из вариантов осуществления настоящего изобретения, пептид глюкагона модифицируют таким образом, чтобы он включал ацильную группу, присоединенную к пептиду глюкагона через сложноэфирную, тиоэфирную или амидную связь для целей удлинения периодов полувыведения из кровотока или задержки начала действия и/или продления действия, и/или повышения устойчивости к протеазам, таким как DPP-IV.

Ацилирование может быть осуществлено по любой из позиций в пептиде глюкагона, включая любую из позиций в диапазоне 1-29, положения внутри С-концевого расширения или по С-концевой аминокислоте, при условии, что сохраняется активность глюкагона и/или GLP-1, если не повышается. Соответствующие неограничивающие примеры включают положения 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27, 28 или 29. В конкретных вариантах осуществления настоящего изобретения, ацилирование осуществляют в положении 10 пептида глюкагона, так что пептид глюкагона теряет внутримолекулярный мостик, например, ковалентный внутримолекулярный мостик (в частности, лактамный мостик). Такие ацилированные пептиды, не содержащие внутримолекулярный мостик, характеризуются повышенной активностью по рецептору GLP-1 и глюкагона в сравнении с соответствующими неацилированными пептидами, которые не содержат ковалентный внутримолекулярный мостик, а также в сравнении с соответствующими пептидами без внутримолекулярного мостика, ацилированными в положении, отличном от положения 10. Как показано в настоящем описании, ацилирование в положении 10 может даже трансформировать аналог глюкагона, обладающий малой активностью по рецептору глюкагона, с образованием аналога глюкагона, обладающего активностью как по рецептору глюкагона, так и по рецептору GLP-1. Соответственно, положение, по которому происходит ацилирование, может менять общий профиль активности аналога глюкагона.

Пептиды глюкагона могут быть ацилированы по положению той же аминокислоты, к которой был присоединен гидрофильный фрагмент, или по аминокислоте в другом положении. Неограничивающие примеры включают ацилирование в положении 10 и ПЭГилирование в одном или нескольких положениях в С-концевой части пептида глюкагона, например, в положениях 24, 28 или 29, на участке С0-концевого расширения или по С-концу (например, за счет добавления С-концевого Cys).

Ацильная группа может быть ковалентно присоединена непосредственно к аминокислоте в пептиде глюкагона или она может быть присоединена опосредовано к аминокислоте в пептиде глюкагона через спейсер, где указанный спейсер будет находиться между аминокислотой в пептиде глюкагона и ацильной группой.

В конкретном аспекте настоящего изобретения, указанный пептид глюкагона модифицируют таким образом, чтобы он включал ацильную группу, присоединенную за счет непосредственного ацилирования аминогруппы, гидроксильной или тиололовой группы в боковой цепи аминокислоты в пептиде глюкагона. В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона подвергают непосредственному ацилированию по аминогруппе, гидроксильной или тиололовой группе в боковой цепи аминокислоты. В некоторых вариантах, ацилирование происходит в положении 10, 20, 24 или 29. В этой связи, ацилированный пептид глюкагона может включать аминокислотную последовательность SEQ ID NO: 1 или модифицированную на ее основе аминокислотною последовательность, которая включает одну или несколько из описанных модификаций аминокислоты, при этом по меньшей мере одна из аминокислот в положениях 10, 20, 24 и 29 модифицируется до любой аминокислоты, включающей аминогруппу, гидроксильную или тиололовую группу в боковой цепи. В некоторых конкретных вариантах осуществления настоящего изобретения, непосредственное ацилирование пептида глюкагона происходит по аминогруппе, гидроксильной или тиололовой группе в боковой цепи аминокислоты в положении 10.

В некоторых вариантах осуществления настоящего изобретения, аминокислота, включающая аминогруппу в боковой цепи, представляет собой аминокислоту формулы I:

где n=1-4

[Формула I])

В некоторых репрезентативных вариантах осуществления настоящего изобретения, аминокислота формулы I представляет собой аминокислоту, в которой n=4 (Lys) или n=3 (Orn).

В других вариантах осуществления настоящего изобретения, аминокислота, включающая гидроксил в боковой цепи, представляет собой аминокислоту формулы II:

где n=1-4

[Формула II])

В некоторых репрезентативных вариантах осуществления настоящего изобретения, аминокислота формулы II представляет собой такую аминокислоту, в которой n обозначает 1 (Ser).

В еще других вариантах осуществления настоящего изобретения, аминокислота, включающая тиоловую группу в боковой цепи, представляет собой аминокислоту формулы III:

где n=1-4

[Формула III])

В некоторых репрезентативных вариантах осуществления настоящего изобретения, аминокислота формулы III представляет собой аминокислоту, где n=1 (Cys).

В еще других вариантах осуществления настоящего изобретения, аминокислота, включающая аминогруппу, гидроксильную или тиоловую группу в боковой цепи, представляет собой двузамещенную аминокислоту, имеющую ту же структуру формулы I, формулы II или формулы III, за исключением того, что водород, связанный с альфа-углеродом аминокислоты формулы I, формулы II или формулы III, замещен второй боковой цепью. В одном варианте осуществления настоящего изобретения, ацилированный пептид глюкагона включает спейсер, расположенный между пептидом и ацильной группой. В некоторых вариантах, пептид глюкагона ковалентно связан со спейсером, который ковалентно связан с ацильной группой.

Аминокислота, к которой спейсер присоединяется, может представлять собой любую кислоту (например, альфа-замещенную по одному положению аминокислоту или альфа,альфа-двузамещенную аминокислоту, включающую фрагмент, которая позволяет осуществить связывание со спейсером. Например, в этом случае приемлемой будет аминокислота, включающая в боковой цепи NH2, -OH или -COOH (например, Lys, Orn, Ser, Asp или Glu). Соответственно, ацилированный пептид глюкагона может включать аминокислотную последовательность SEQ ID NO: 1 или модифицированную на ее основе аминокислотную последовательность, включающую одну или несколько модифицированных аминокислотных последовательностей по настоящему описанию, при этом по меньшей мере одна из аминокислот в положениях 10, 20, 24 и 29 модифицирована до любой из аминокислот, которая включает в боковой цепи аминогруппу, гидроксильную группу или карбоксилат.

В некоторых вариантах осуществления настоящего изобретения, указанный спейсер представляет собой аминокислоту, включающую аминогруппу, гидроксильную или тиоловую группу в боковой цепи, или дипептид, или трипептид, включающий аминокислоту, которая содержит в боковой цепи аминогруппу, гидроксильную или тиоловую группу.

В том случае, когда ацилирование осуществляется через аминогруппу спейсера, такое ацилирование может проходить через атом альфа-аминогруппы аминокислоты боковой цепи. В том случае, когда альфа-аминогруппа ацилирована, аминокислота спейсера может быть любой аминокислотой. Например, аминокислота спейсера может представлять гидрофобную аминокислоту, такую как Gly, Ala, Val, Leu, Ile, Trp, Met, Phe, Tyr, 6-аминогексановая кислота, 5-аминовалериановая кислота, 7-аминогептановая кислота, 8-аминооктановая кислота. Альтернативно, аминокислота спейсера может представлять собой кислотный остаток, например, Asp и Glu.

В том случае, когда аминогруппа в боковой цепи аминокислоты спейсера ацилирована, указанная аминокислота спейсера представляет собой такую аминокислоту, которая включает аминогруппу боковой цепи, например, аминокислоту формулы I (например, Lys или Orn). В этом случае, возможно ацилирование и альфа-аминогруппы и аминогруппы в боковой цепи аминокислоты спейсера, так что пептид глюкагона будет представлять собой диацилированную молекулу. Некоторые варианты настоящего изобретения включают такие диацилированные молекулы.

В том случае, когда ацилирование осуществляется через гидроксильную группу спейсера, аминокислота или одна из аминокислот дипептида или трипептида могут представлять собой аминокислоту формулы II. В конкретном репрезентативном варианте, указанной аминокислотой является Ser.

В том случае, когда ацилирование осуществляется через тиоловую группу спейсера, указанная аминокислота или одна из аминокислот в дипептиде или трипептиде может представлять собой аминокислоту формулы III. В конкретном репрезентативном варианте, указанная аминокислота представляет собой Cys.

В некоторых вариантах осуществления настоящего изобретения, указанный спейсер представляет собой гидрофильный бифункциональный спейсер. В некоторых вариантах, указанный гидрофильный бифункциональный спейсер включает две или большее количество реакционноспособных групп, например, аминогруппу, гидроксильную, тиоловую и карбоксильную группу или любые их сочетания. В некоторых вариантах осуществления настоящего изобретения, указанный гидрофильный бифункциональный спейсер включает гидроксильную группу и карбоксилат. В других вариантах, указанный гидрофильный бифункциональный спейсер включает аминогруппу и карбоксилат. В других вариантах, указанный гидрофильный бифункциональный спейсер включает тиоловую группу и карбоксилат. В конкретных вариантах осуществления настоящего изобретения, указанный спейсер включает амино-поли(алкилокси)карбоксилат. В этой связи, указанный спейсер может включать, например, NH2(CH2CH2O)n(CH2)mCOOH, где m равно любому целому числу от 1 до 6 и n равно любому целому числу от 2 до 12, и может представлять собой, например, 8-амино-3,6-диоксаоктановую кислоту, которая коммерчески доступна от компании Peptides International, Inc. (Louisville, KY).

В некоторых вариантах осуществления настоящего изобретения, указанный спейсер представляет собой гидрофобный бифункциональный спейсер. В настоящей области известны гидрофобные бифункциональные спейсеры. См., например, Bioconjugate Techniques, G. T. Hermanson (Academic Press, San Diego, CA, 1996), где указанная работа включена в настоящее описание полностью в качестве ссылки. В некоторых вариантах осуществления настоящего изобретения, указанный гидрофобный бифункциональный спейсер включает две или большее число реакционноспособных групп, например, аминогруппу, гидроксильную группу, тиоловую группу или карбоксильную группу или любые их сочетания. В некоторых вариантах осуществления настоящего изобретения, указанный гидрофобный бифункциональный спейсер включает гидроксильную группу и карбоксилат. В других вариантах, указанный гидрофобный бифункциональный спейсер включает аминогруппу и карбоксилат. В других вариантах осуществления настоящего изобретения, указанный гидрофобный бифункциональный спейсер включает тиоловую группу и карбоксилат. Подходящие гидрофобные бифункциональные спейсеры, включающие карбоксилат и гидроксильную группу или тиоловую группу, известны в данной области и включают, например, 8-гидроксиоктановую кислоту и 8-меркаптооктановую кислоту.

В некоторых вариантах осуществления настоящего изобретения указанный гидрофобный бифункциональный спейсер не является дикарбоновой кислотой, включающий неразветвленный метилен, состоящий из 1-7 атомов углерода, расположенных между карбоксилатными группами. В некоторых вариантах осуществления настоящего изобретения, указанный гидрофобный бифункциональный спейсер представляет собой дикарбоновую кислоту, включающую неразветвленный метилен, состоящий из 1-7 атомов углерода, расположенных между карбоксилатными группами.

Указанный спейсер (например, аминокислотный, дипептидный, трипептидный, гидрофильный или гидрофобный бифункциональный спейсер) в конкретных вариантах осуществления настоящего изобретения включает от 3 до 10 атомов (например, от 6 до 10 атомов, например, 6, 7, 8, 9 или 10 атомов) в длину. В более конкретных вариантах, указанный спейсер включает от 3 до 10 атомов (например, 6-10 атомов) в длину и ацильная группа представляет собой C12-C18 жирноацильную группу, например, C14 жирноацильную группу, С16 жирноацильную группу, так что общая длина спейсера и ацильной группы составляет от 14 до 28 атомов, то есть составляет примерно от 14 до 28 атомов, в частности, составляет примерно 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 или 28 атомов. В некоторых вариантах осуществления настоящего изобретения, длина спейсера и ацильной группы составляет от 17 до 28 (например, 19-26, 19-21) атомов.

Согласно некоторым указанным выше вариантам осуществления настоящего изобретения, бифункциональный спейсер может представлять собой синтетическую или природную аминокислоту (включающую, без ограничения, любую из указанных здесь аминокислот) с аминокислотным скелетом, имеющим длину от 3 до 10 атомов углерода (например, 6-аминогексановую кислоту, 5-аминовалериановую кислоту, 7-аминогептановую кислоту и 8-аминооктановую кислоту). Альтернативно, указанный спейсер может представлять собой дипептидный или трипептидный спейсер, имеющий пептидный скелет из 3-10 атомов (например, от 6 до 10 атомов). Каждая из аминокислот в дипептидном или трипептидном спейсере может отличаться или не отличаться от других аминокислот дипептида и трипептида и может быть независимо выбрана из группы, состоящей из природных и/или неприродных аминокислот, которые включают любой из D или L изомеров природных аминокислот (Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Arg, Ser, Thr, Val, Tyr) или любые D или L изомеры неприродных аминокислот, выбранных из группы, состоящей из: β-аланина (β Ala), N-α-метилаланина (Me-Ala), аминомасляной кислоты (Abu), γ-аминомасляной кислоты (γ-Abu), аминогексановой кислоты (ε-Ahs), аминоизомасляной кислоты (Aib), аминометилпироллкарбоновой кислоты, аминопипиридинкарбоновой кислоты, аминосерина (Ams), аминотетрагидропиран-4-карбоновой кислоты, N-метокси-N-метиламида аргинина, β-аспарагиновой кислоты (β-Asp), азетидинкарбоновой кислоты, 3-(2-бензотиазолил)аланина, α-трет-бутилглицина, 2-амино-5-уреидо-н-валериановой кислоты (цитрулина, Cit), β-циклогексилаланина (Cha), ацетамидометилцистеина, диаминобутановой кислоты (Dab), диаминопропионовой кислоты (Dpr), дигидроксифенилаланина (DOPA), диметилтиазолидина (DMTA), γ-глютаминовой кислоты (γ-Glu), гомосерина (Hse), гидроксипролина (Hyp), N-метокси-N-метиламида изолейцина, метилизолейцина (MeIle), изонипекотиновой кислоты (Isn), метиллейцина (MeLeu), метиллизина, диметиллизина, триметиллизина, метанопролина, метионинсульфоксида (Met(O)), метионинсульфона ((Met(O2)), норлейцина (Nle), метилнорлейцина (Me-Nle), норвалина (Nva), орнитина (Orn), пара-аминобензойной кислоты (РАВА), пиницилламина (Pen), метилфенилаланина (Me-Phe), 4-хлорфенилаланина (Phe(4-Cl)), 4-фторфенилаланина (Phe(4-F)), 4-нитрофенилаланина (Phe(4-NO2)), 4-цианофенилаланина ((Phe(4-CN)), фенилглицина (Phg), пиперидиналанина, пиперидинглицина, 3,4-дигидропролина, пирролидинилаланина, саркозина (Sar), селеноцистеина (Sec), О-бензилфосфосерина, 4-амино-гидрокси-6-метилгептановой кислоты (Sta), 4-амино-5-циклогексил-3-гидроксипентановой кислоты (ACHPA), 4-амино-3-гидрокси-5-фенилпентановой кислоты (AHPPA), 1,2,3,4-тетрагидроизохинолин-3-карбоновой кислоты (Tic), тетрагидропиранглицина, тиенилаланина (Thi), О-бензилфосфотирозина, O-фосфотирозина, метокситирозина, этокситирозина, О-(бис-диметиламинофосфоно)тирозина, тетрабутиламина тирозинсульфата, метилвалина (MeVal) и алкилированной 3-меркаптопропионовой кислоты.

В некоторых вариантах осуществления настоящего изобретения, указанный спейсер имеет суммарный отрицательный заряд, например, включают одну или две отрицательно заряженных аминокислоты. В некоторых вариантах осуществления настоящего изобретения, указанный дипептид не относится ни к одному из дипептидов общей структуры А-B, где А выбирают из группы, состоящей из Gly, Gln, Ala, Arg, Asp, Asn, He, Leu, Val, Phe и Pro, и где B выбирают из группы, состоящей из Lys, His, Trp. В некоторых вариантах осуществления настоящего изобретения, указанный дипептидный спейсер выбирают из группы, состоящей из Ala-Ala, β-Ala-β-Ala, Leu-Leu, Pro-Pro, γ-аминомасляной кислоты-γ-аминомасляной кислоты и γ-Glu-γ-Glu.

В некоторых репрезентативных вариантах осуществления настоящего изобретения, указанный пептид глюкагона модифицируют таким образом, чтобы он включал ацильную группу, вводимую за счет метилирования аминогруппы, гидроксильной группы или тиоловой группы спейсера, где указанный спейсер присоединяют к боковой цепи аминокислоты в положении 10, 20, 24 или 29, или по С-концевой аминокислоте в пептиде глюкагона.

В других, более специфических вариантах осуществления настоящего изобретения, указанную ацильную группу присоединяют к аминокислоте в положении 10 пептида глюкагона, и длина спейсера и ацильной группы составляет от 14 до 28 атомов. В некоторых аспектах, аминокислота в положении 10 представляет собой аминокислоту формулы I, например, Lys или двузамещенную аминокислоту, соответствующую формуле I. В более конкретных вариантах, указанный пептид глюкагона не содержит внутримолекулярный мостик, например, ковалентный внутримолекулярный мостик. Пептид глюкагона может представлять собой, например, пептид, включающий одну или несколько альфа,альфа-двузамещенных аминокислот, например, AIB, для целей стабилизации альфа-спиральной структуры пептида. Как показано в настоящем описании, такие пептиды, включающие ацилированный спейсер, ковалентно присоединенный к боковой цепи аминокислоты в положении 10, демонстрируют повышенную эффективность, как по GLP-1 рецептору, так и по рецептору глюкагона.

Подходящие способы ацилирования пептидов через амины, гидроксилы и тиолы, известны в данной области. См., например, пример 19 (где описаны способы ацилирования через амин), Miller, Biochem Biophys Res Commun 218: 377-382 (1996); Shimohigashi and Stammer, Int J Pept Protein Res 19: 54-62 (1982); и Previero et al., Biochim Biophys Acta 263: 7-13 (1972) (где описаны способы ацилирования через гидроксил) и San and Silvius, J Pept Res 66: 169-180 (2005) (где описаны способы ацилирования через тиол); Bioconjugate Chem. "Chemical Modifications of Proteins: History и Applications" pages 1, 2-12 (1990); Hashimoto et al., Pharmacuetical Res. "Synthesis of Palmitoyl Derivatives of Insulin and their Biological Activity" Vol. 6, No: 2 рр.171-176(1989).

Ацильная группа в ацилированном пептиде глюкагона может иметь любой размер, например, может включать любое число атомов углерода в цепи и может представлять собой линейную или разветвленную молекулу. В некоторых конкретных вариантах осуществления настоящего изобретения, указанная ацильная группа представляет собой C4-C30 жирную кислоту. Например, ацильная группа может представлять собой C4 жирную кислоту, C6 жирную кислоту, C8 жирную кислоту, C10 жирную кислоту, C12 жирную кислоту, C14 жирную кислоту, C16 жирную кислоту, C18 жирную кислоту, C20 жирную кислоту, C22 жирную кислоту, C24 жирную кислоту, C26 жирную кислоту, C28 жирную кислоту или C30 жирную кислоту. В некоторых вариантах осуществления настоящего изобретения, ацильная группа представляет собой C8-C20 жирную кислоту, например, C14 жирную кислоту или C16 жирную кислоту.

В альтернативном варианте, указанная ацильная группа представляет собой желчную кислоту. Желчная кислота может представлять собой любую подходящую желчную кислоту, включающую, без ограничения, холевую кислоту, хенодезоксихолевую кислоту, дезоксихолевую кислоту, литохолевую кислоту, таурохолевую кислоту, гликохолевую кислоту и холестериновую кислоту.

В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона модифицируют таким образом, чтобы он включал ацильную группу, с использованием длинноцепочечного алкана для ацилирования пептидом глюкагона. В конкретных аспектах, длинноцепочечный алкан включает аминогруппу, гидроксильную или тиоловую группу (например, октадециламин, тетрадеканол и гексадекантиол), которые взаимодействуют с карбоксильной группой или ее активированной формой в пептиде глюкагона. Карбоксильная группа или ее активированная формы в пептиде глюкагона может представлять собой часть боковой цепи аминокислоты (например, глютаминовой кислоты, аспарагиновой кислоты) в пептиде глюкагона или может представлять собой часть пептидного скелета.

В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона модифицируют таким образом, чтобы он включал ацильную группу, за счет ацилирования длинноцепочечного алкана спейсером, который присоединен к пептиду глюкагона. В конкретных вариантах, длинноцепочечный алкан включает аминогруппу, гидроксильную или тиоловую группы, которая взаимодействует с карбоксильной группой или ее активированной формой в спейсере. Подходящие спейсеры, включающие карбоксильную группу или ее активированную форму, приведены в настоящем описании и включают, например, аминокислоты, дипептиды, трипептиды, гидрофильные бифункциональные спейсеры, гидрофобные бифункциональные спейсеры.

В контексте настоящего описания, термин «активированная форма карбоксильной группы» относится к карбоксильной группе общей формулы R(C=0)X, где X обозначает удаляемую группу и R обозначает пептид глюкагона или спейсер. Например, активированные формы карбоксильной группы могут включать, без ограничения, ацилхлориды, ангидриды и их сложные эфиры. В некоторых вариантах осуществления настоящего изобретения, активированная карбоксильная группа представляет собой сложный эфир с удаляемой группой в виде сложного эфира N-гидроксисукцинимида (NHS).

Относительно тех аспектов настоящего изобретения, в которых длинноцепочечный алкан ацилирован пептидом глюкагона или спейсером, следует отметить, что длинноцепочечный алкан может иметь любой размер и может иметь длину из любого числа атомов углерода. Длинноцепочечный алкан может быть линейным или разветвленным. В некоторых аспектах, указанный длинноцепочечный алкан представляет собой C4-C30алкан. Так, например, длинноцепочечный алкан может представлять собой любой из указанных ниже алканов: C4алкан, C6алкан, C8алкан, C10алкан, C12алкан, C14алкан, C16алкан, C18алкан, C20алкан, C22алкан, C24алкан, C26алкан, C28алкан или C30алкан. В некоторых вариантах осуществления настоящего изобретения, указанный длинноцепочечный алкан включает C8-C20алкан, например, представляет собой С14алкан, C16алкан или С18алкан.

Кроме того, в некоторых вариантах осуществления настоящего изобретения, аминогруппа, гидроксильная и тиоловая группы в пептиде глюкагона ацилированы холестериновой кислотой. В конкретном варианте, пептид глюкагона присоединен к холестериновой кислоте через алкилированный дезамино-Cys спейсер, например, через спейсер, представляющий собой алкилированную 3-меркаптопропионовую кислоту.

Приведенные в настоящем описании ацилированные пептиды глюкагона могут быть дополнительно модифицированы таким образом, чтобы включать гидрофильный фрагмент. В некоторых конкретных вариантах осуществления настоящего изобретения, указанный гидрофильный фрагмент может включать полиэтиленгликолевую (ПЭГ) цепь. Включение гидрофильного фрагмента может быть осуществлено за счет подходящих способов, в частности, с использованием тех процедур, которые приведены в настоящем описании. Соответственно, ацилированный пептид глюкагона может включать последовательность SEQ ID NO: 1, включающую любую из описанных модификаций, где по меньшей мере одна из аминокислот в положениях 10, 20, 24 и 29 включает ацильную группу и по меньшей мере одна из аминокислот в положениях 16, 17, 21, 24 или 29, в положении внутри С-концевого расширения или С-концевая аминокислота модифицирована до Cys, Lys, Orn, гомо-Cys или Ac-Phe, и боковая цепь аминокислоты ковалентно присоединена к гидрофильной фрагменту (например, ПЭГ). В некоторых вариантах осуществления настоящего изобретения, указанная ацильная группа присоединяется в положении 10, необязательно через спейсер, включающий Cys, Lys, Orn, гомо-Cys или Ac-Phc, и гидрофильный фрагмент включается в Cys остаток в положении 24.

Альтернативно, ацилированный пептид глюкагона может включать спейсер, где указанный спейсер и ацилирован, и модифицирован таким образом, чтобы он включал гидрофильный фрагмент. Неограничивающие примеры подходящих спейсеров включают спейсеры, включающие одно или несколько аминокислот, выбранных из группы, состоящей из Cys, Lys, Orn, гомо-Cys и Ac-Phe.

Алкилирование

В соответствии с некоторыми вариантами осуществления настоящего изобретения, пептид глюкагона модифицируют таким образом, чтобы он включал алкильную группу, например, алкильную группу, которая не является природной для аминокислоты (например, алкильную группу, которая является ненативной для природной аминокислоты). Без ограничения рамками какой-либо конкретной теории, следует полагать, что алкилирование пептидов глюкагона приведет к достижению близких, если не тех же самых эффектов, что и ацилирование пептидов глюкагона, например, к увеличению периода полувыведения из кровотока, к задержке начала действия, к более продолжительному действию, к повышенной чувствительности к протеазам, таким как DPP-IV, и к более высокой эффективности по рецепторам GLP-1 и глюкагона.

Алкилирование может проводиться по любому положению в пептиде глюкагона, включая любое из положений 1-29, положения внутри С-концевого расширения или С-концевой аминокислоты, при условии, что сохраняется активность глюкагона. Неограничивающие примеры включают положения 5, 7,10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27, 28 или 29. Алкильная группа может быть ковалентно присоединена непосредственно к аминокислоте пептида глюкагона или опосредованно к аминокислоте пептида глюкагона через спейсер, где указанный спейсер находится между аминокислотой в пептиде глюкагона и алкильной группой. Пептиды глюкагона могут быть алкилированы по аминокислоте в том же положении, к которому присоединен гидрофильный фрагмент, или по положению другой аминокислоты. Неограничивающие примеры включают алкилирование в положении 10 и ПЭГилирование по одному или нескольким положениям в С-концевой части пептида глюкагона, например, в положении 24, 28 или 29, в пределах С-концевого расширения или по С-концу (например, за счет добавления С-концевого Cys остатка).

В конкретном аспекте настоящего изобретения, пептид глюкагона модифицируют таким образом, чтобы он включал алкильную группу, за счет непосредственного алкилирования аминогруппы, гидроксильной или тиоловой группы в боковой цепи аминокислоты в пептиде глюкагона. В некоторых вариантах осуществления настоящего изобретении, алкилирование проводят в положении 10, 20, 24 или 29. Соответственно, алкилированный пептид глюкагона может включать аминокислотную последовательность SEQ ID NO: 1 или модифицированную на ее основе аминокислотную последовательность, включающую одну или несколько модификаций аминокислот по настоящему описанию, при этом по меньшей мере одна из аминокислот в положениях 10, 20, 24 и 29 модифицируются до любой аминокислоты, включающей аминогруппу, гидроксил или тиол в боковой цепи. В некоторых вариантах осуществления настоящего изобретения, непосредственное алкилирование пептида глюкагона проводят по аминогруппе, гидроксилу или тиолу аминокислоты в боковой цепи в положении 10.

В некоторых вариантах осуществления настоящего изобретения, указанная аминокислота, включающая аминогруппу боковой цепи, представляет собой аминокислоту формулы I. В некоторых репрезентативных вариантах, указанная аминокислота формулы I представляет собой аминокислоту, в которой n равно 4 (Lys) или n равно 3 (Orn).

В других вариантах осуществления настоящего изобретения, указанная аминокислота, включающая гидроксил в боковой цепи, представляет собой аминокислоту формулы II. В некоторых репрезентативных вариантах, указанная аминокислота формулы II представляет собой аминокислоту, в которой n равно 1 (Ser).

В еще других вариантах осуществления настоящего изобретения, указанная аминокислота, включающая тиол в боковой цепи, представляет собой аминокислоту формулы III. В некоторых репрезентативных вариантах, указанная аминокислота формулы III представляет собой аминокислоту, в которой n равно 1 (Cys).

В еще других вариантах, указанная аминокислота, включающая в боковой цепи амин, гидроксил или тиол, представляет собой двузамещенную аминокислоту, включающую структуру, описываемую формулой I, II или III, за исключением того, что водород, связанный с атомом альфа-углерода в аминокислоте формулы I, II или III, замещен второй боковой цепью.

В одном варианте осуществления настоящего изобретения, указанный алкилированный пептид глюкагона включает спейсер, расположенный между пептидом и алкильной группой. В некоторых вариантах, указанный пептид глюкагона ковалентно присоединен к спейсеру, который ковалентно присоединен к алкильной группе. В некоторых репрезентативных вариантах, указанный пептид глюкагона модифицируют таким образом, чтобы он включал алкильную группу, за счет алкилирования амина, гидроксила или тиола в спейсере, где указанный спейсер присоединяют к боковой цепи аминокислоты в положении 10, 20, 24 или 29 в пептиде глюкагона. Аминокислота, к которой присоединяют спейсеру, может быть любой аминокислотой (например, однократно альфа-замещенной аминокислотой или альфа,альфа-двузамещенной аминокислотой), которая включает фрагмент, позволяющий осуществить связывание со спейсером. Так, например, приемлемой в этом случае является аминокислота, включающая в боковой цепи NH2, -OH или -COOH (например, Lys, Orn, Ser, Asp или Glu). Соответственно, алкилированный пептид глюкагона может включать аминокислотную последовательность SEQ ED NO: 1 или модифицированный вариант этой аминокислотной последовательности, включающий одну или несколько аминокислотных модификаций по настоящему изобретению, где по меньшей мере одна из аминокислот в положениях 10, 20, 24 и 29 модифицирована до аминокислоты, включающей амин, гидроксил или карбоксилат в боковой цепи.

В некоторых вариантах осуществления настоящего изобретения, указанный спейсер представляет собой аминокислоту, включающую в боковой цепи амин, гидроксил или тиол, или дипептид или трипептид, включающий аминокислоту, которая содержит в боковой цепи амин, гидроксил или тиол.

В том случае, когда алкилирование осуществляется через аминогруппу спейсера, указанное алкилирование может быть осуществлено через альфа-аминогруппу аминокислоты или через амин боковой цепи. В случае, когда альфа-амин алкилирован, аминокислота спейсера может представлять собой любую аминокислоту. Так, например, аминокислота спейсера может представлять собой гидрофобную аминокислоту, такую как Gly, Ala, Val, Leu, Ile, Trp, Met, Phe, Tyr, 6-аминогексановую кислоту, 5-аминовалериановую кислоту, 7-аминогептановую кислоту, 8-аминооктановую кислоту. Альтернативно, аминокислота спейсера может представлять собой кислый остаток, например, Asp или Glu, при условии, что алкилирование осуществляется по альфа-амину кислого остатка. В том случае, когда алкилируется амин в боковой цепи аминокислоты спейсера, указанная аминокислота спейсера представляет собой аминокислоту, включающую амин в боковой цепи, например аминокислоту формулы I (например, Lys или Orn). В этом случае возможно алкилирование и альфа-амина, и амина в боковой цепи аминокислоты спейсера, так что получаемый при этом пептид глюкагона будет диалкилированным. Варианты осуществления настоящего изобретения включают такие диалкилированные молекулы.

В том случае, когда алкилирование осуществляется через гидроксильную группу спейсера, указанная аминокислота или одна из аминокислот в дипептиде или трипептиде может представлять собой аминокислоту формулы II. В конкретном репрезентативном варианте, указанная аминокислота представляет собой Ser.

В том случае, когда алкилирование осуществляется через тиоловую группу спейсера, указанная аминокислота или одна из аминокислот в дипептиде или трипептиде может представлять собой аминокислоту формулы III. В конкретном репрезентативном варианте, указанная аминокислота представляет собой Cys.

В некоторых вариантах осуществления настоящего изобретения, указанный спейсер представляет собой гидрофильный бифункциональный спейсер. В некоторых вариантах, указанный гидрофильный бифункциональный спейсер включает две реактивных группы или еще большее число реактивных групп, например, аминогруппу, гидроксильную группу, тиоловую группу и карбоксильную группу или любые их сочетания. В некоторых вариантах осуществления настоящего изобретения, указанный гидрофильный бифункциональный спейсер включает гидроксильную группу и карбоксилат. В других вариантах, указанный гидрофильный бифункциональный спейсер включает аминогруппу и карбоксилат. В других вариантах осуществления настоящего изобретения, указанный гидрофильный бифункциональный спейсер включает тиоловую группу и карбоксилат. В конкретном варианте, указанный спейсер включает амино-поли(алкилокси)карбоксилат. Соответственно, указанный спейсер может включать, например, NH2(CH2CH2)n(CH2)mCOOH, где m равно целому числу от 1 до 6 и n равно целому числу от 2 до 12, например, включает 8-амино-3,6-диоксаоктановую кислоту, которая коммерчески доступна от компании Peptides International, Inc. (Louisville, KY).

В некоторых вариантах осуществления настоящего изобретения, указанный спейсер представляет собой гидрофобный бифункциональный спейсер. В некоторых вариантах, указанный гидрофобный бифункциональный спейсер включает две реактивных группы или еще большее число реактивных групп, например, аминогруппу, гидроксильную группу, тиоловую группу и карбоксильную группу или любые их сочетания. В некоторых вариантах осуществления настоящего изобретения, указанный гидрофобный бифункциональный спейсер включает гидроксильную группу и карбоксилат. В других вариантах осуществления настоящего изобретения, указанный гидрофобный бифункциональный спейсер включает аминогруппу и карбоксилат. В других вариантах осуществления настоящего изобретения, указанный гидрофобный бифункциональный спейсер включает тиоловую группу и карбоксилат. Подходящие гидрофобные бифункциональные спейсеры, включающие карбоксилат и гидрофильную группу или тиоловую группу, известны в данной области и включают, например, 8-гидроксиоктановую кислоту, 8-меркаптооктановую кислоту.

В конкретных вариантах осуществления настоящего изобретения, спейсер (например, аминокислотный, дипептидный, трипептидный, гидрофильный или гидрофобный бифункциональный спейсер) имеет длину от 3 до 10 атомов (например, от 6 до 10 атомов, например, 6, 7, 8, 9 или 10 атомов)). В более конкретных вариантах, указанный спейсер имеет длину от 3 до 10 атомов (например, от 6 до 10 атомов) и алкил представляет собой C12-C18 алкильную группу; например, C14 алкильную группу, C16 алкильную группу, так что суммарная длина спейсера алкильной группы составляет 14-28 атомов, в частности, примерно 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 или 28 атомов. В некоторых вариантах осуществления настоящего изобретения, длина спейсера и алкила составляет 17-28 (например, 19-26, 19-21) атомов.

Согласно некоторым описанным выше вариантам осуществления настоящего изобретения, указанный бифункциональный спейсер может представлять собой синтетическую или неприродную аминокислоту, включающую аминокислотный скелет с длиной от 3 до 10 атомов (например, 6-аминогексановую кислоту, 5-аминовалериановую кислоту, 7-аминогептановую кислоту, 8-аминооктановую кислоту). Альтернативно, указанный спейсер может представлять собой дипептидный или трипептидный спейсер, имеющий пептидный скелет длиной от 3 до 10 атомов (например, 6-10 атомов). Дипептидный или трипептидный спейсер может состоять из природных и/или неприродных аминокислот, включающих, например, любую из приведенных в настоящем описании аминокислот. В некоторых вариантах осуществления настоящего изобретения, указанный спейсер имеет суммарный отрицательный заряд, например, включает одну или две отрицательно заряженных аминокислот. В некоторых вариантах, указанный дипептидный спейсер выбирают из группы, состоящей из: Ala-Ala, β-Ala-β-Ala, Leu-Leu, Pro-Pro, γ-аминомасляной кислоты-γ-аминомасляной кислоты и γ-Glu-γ-Glu.

Подходящие способы алкилирования пептидов через амины, гидроксилы и тиолы известны в данной области. Например, может использоваться реакция синтеза эфира Вильямсона (Williamson) для образования эфирной связи между гидроксильной группой пептида глюкагона и алкильной группой. Кроме того, реакция нуклеофильного замещения пептида алкилгалогенидом может приводить к образованию эфирной, тиоэфирной или амино связи.

Алкильная группа в алкилированном пептиде глюкагона может иметь любой размер, например, включать в длину любое число атомов углерода, а также может быть линейной или разветвленной. В некоторых вариантах осуществления настоящего изобретения, указанная алкильная группа представляет собой C4-C30алкил. Так, например, алкильная группа может представлять собой любой из указанных алкилов: C4алкил, C6алкил, C8алкил, C10алкил, C12алкил, C14алкил, C16алкил, C18алкил, C20алкил, C22алкил, C24алкил, C26алкил, C28алкил или C30алкил. В некоторых вариантах осуществления настоящего изобретения, указанная алкильная группа представляет собой C8-C20алкил, например, C14алкил или C16алкил.

В некоторых конкретных вариантах осуществления настоящего изобретения, указанная алкильная группа включает стероидный фрагмент желчной кислоты, например, холевой кислоты, хенодезоксихолевой кислоты, дезоксихолевой кислоты, литохолевой кислоты, таурохолевой кислоты, гликохолевой кислоты и холестериновой кислоты.

В некоторых вариантах осуществления настоящего изобретения указанный пептид глюкагона модифицируют таким образом, чтобы он включал алкильную группу, за счет реакции нуклеофильного длинноцепочечного алкана с пептидом глюкагона, где указанный пептид глюкагона включает удаляемую группу, подходящую для нуклеофильного замещения. В некоторых аспектах, указанная нуклеофильная группа длинноцепочечного алкана включает амин, гидроксильную или тиоловую группу (например, октадециламин, тетрадеканол и гексадекантиол). Удаляемая группа пептида глюкагона может представлять собой часть боковой цепи аминокислоты или может быть частью пептидного скелета. Подходящая удаляемая группа включает, например, N-гидроксисукцинимид, галогены и сульфонатные сложные эфиры.

В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона модифицируют таким образом, чтобы он включал алкильную группу, за счет реакции нуклеофильного длинноцепочечного алкана со спейсером, который присоединен к пептиду глюкагона, где указанный спейсер включает удаляемую группу. В конкретных аспектах, указанный длинноцепочечный алкан включает аминогруппу, гидроксильную группу или тиоловую группу. В некоторых вариантах, указанный спейсер, включающий удаляемую группу, может представлять собой любой спейсер по настоящему описанию, например, аминокислоты, дипептиды, трипептиды, гидрофильные бифункциональные спейсеры и гидрофобные бифункциональные спейсеры, которые дополнительно включают подходящую удаляемую группу.

Что касается тех аспектов осуществления настоящего изобретения, где длинноцепочечный алкан алкилируется пептидом глюкагона или спейсером, следует отметить, что указанный длинноцепочечный алкан может иметь любую длину и может включать цепь с любым числом углеродов. Длинноцепочечный алкан может быть линейным или разветвленным. В некоторых аспектах, длинноцепочечный алкан представляет собой C4-C30алкан. Так, например, длинноцепочечный алкан может представлять собой любой из указанных ниже алканов: C4алкан, C6алкан, C8алкан, C10алкан, C12алкан, C14алкан, C16алкан, C18алкан, C20алкан, C22алкан, C24алкан, C26алкан, C28алкан или C30алкан. В некоторых вариантах осуществления настоящего изобретения, указанный длинноцепочечный алкан включает C8-C20 алкан, например, C14алкан, C16алкан или С18алкан.

Кроме того, в некоторых вариантах осуществления настоящего изобретения, алкилирование может осуществляться между пептидом глюкагона и холестериновым фрагментом. Так, например, гидроксильная группа холестерина может замещать удаляемую группу на длинноцепочечном алкане с образованием холестерин-глюкагонового пептидного продукта.

Алкилированные пептиды глюкагона по настоящему изобретению могут быть дополнительно модифицированы, с тем чтобы они включали гидрофильную фрагмент. В некоторых конкретных вариантах, указанный гидрофильный фрагмент может включать полиэтиленгликолевую (ПЭГ) цепь. Включение гидрофильного фрагмента может быть осуществлено любыми подходящими способами, такими как приведенные в настоящем описании. Соответственно, алкилированный пептид глюкагона может включать SEQ ID NO: 1 или модифицированный вариант указанной аминокислотной последовательности, включающий одну или несколько аминокислотных модификаций по настоящему изобретению, где по меньшей мере одна из аминокислот в положениях 10, 20, 24 и 29 включает алкильную группу и по меньшей мере одна из аминокислот в положении 16, 17, 21, 24 и 29, внутри С-концевого расширения или С-концевая аминокислота модифицированы до Cys, Lys, Orn, гомо-Cys или Ac-Phe, и боковая цепь аминокислоты ковалентно присоединена к гидрофильной фрагменту (например, ПЭГ). В некоторых вариантах осуществления настоящего изобретения, указанную алкильную группу присоединяют в положении 10, необязательно через спейсер, включающий Cys, Lys, Orn, гомо-Cys или Ac-Phe, и гидрофильный фрагмент включается в Cys остаток в положении 24.

Альтернативно, алкилированный пептид глюкагона может включать спейсер, где указанный спейсер алкилируется и модифицируется таким образом, чтобы он включал гидрофильный фрагмент. Неограничивающие примеры подходящих спейсеров включают спейсеры, содержащие одну или несколько аминокислот, выбранных из группы, состоящей из: Cys, Lys, Orn, гомо-Cys и Ac-Phe.

Модификации, которые снижают активность по GLP-1

В некоторых вариантах осуществления настоящего изобретения, пептид глюкагона или его аналог включают модификацию аминокислоты, где указанная модификация селективно снижает активность по GLP-1. Так, например, ацилированный или алкилированный пептид глюкагона или его аналог включает С-концевую альфа-карбоксилатную группу; замещение Thr в положении 7 аминокислотой, не содержащей гидроксильную группу, например, Abu или Ile, делецию одной или нескольких аминокислот на участке от С-концевой аминокислоты до аминокислоты в положении 27-28 (например, делецию аминокислоты в положении 28, делецию аминокислоты в положении 28 или 29), что приводит к получению пептида длиной 27 или 28 аминокислот, или их комбинацию.

Конъюгаты

Настоящее описание включает другие конъюгаты, в составе которых пептиды глюкагона по настоящему изобретению связаны необязательно через ковалентную связь и необязательно через линкер с конъюгируемым фрагментом. Связывание может быть достигнута за счет ковалентных химических связей, физических сил, таких как электростатическое взаимодействие, водородные связи, ионные взаимодействия, силы Ван дер Вальса или гидрофобные или гидрофильные взаимодействия. При этом может использоваться множество нековалентных связующих систем могут, которые включают такие их виды, как взаимодействие по типу биотин/авидин, лиганд/рецептор, фермент/субстрат, белки, связывающиеся с нуклеиновой кислотой/нуклеиновая кислота, белки связывающиеся с липидом/липид, молекулы-партнеры по клеточной адгезии; или любые партнеры или фрагменты для осуществления указанных выше вариантов связывания, которые характеризуются наличием сродства друг к другу.

Пептид может быть присоединен к конъюгируемым фрагментам посредством направленной ковалентной связи, образуемой за счет взаимодействия целевых аминокислотных остатков пептида с органическим дериватизирующим агентом, который способен взаимодействовать с выбранными боковыми цепями или N- или C-концевыми остатками указанных целевых аминокислот. Реактивные группы на пептиде или конъюгируемом фрагменте включают, например, альдегидную группу, аминогруппу, сложноэфирную, тиоловую, α-галогенацетильную, малеимидную группу или гидразиногруппу. Дериватизирующие агенты включат, например, малеимидобензоилсульфосукцинимидный сложный эфир (конъюгация происходит через цистеиновые остатки), N-гидроксисукцинимид (конъюгация происходит через лизиновые остатки), глютаральдегид, янтарный ангидрид или другие вещества, известные в данной области. Альтернативно, конъюгируемые фрагменты могут быть присоединены к пептиду опосредованно через промежуточные носители, такие как полисахаридные или полипепидные носители. Примеры полисахаридных носителей включают аминодекстран. Примеры подходящих полипептидных носителей включают полилизин, полиглютаминовую кислоту, полиаспарагиновую кислоту, их сополимеры и смешанные полимеры указанных асминокислот и других аминокислот, таких как серин, для придания желательной растворимости полученному в результате такой нагрузки носителю.

Цистеинильные остатки чаще всего используются для взаимодействия с α-галогенацеталями (и соответствующими аминами), такими как хлоруксусная кислота, хлорацетамид, с получением карбоксиметильных или карбоксиамидометильных производных. Цистеинильные остатки также подвергают дериватизации в результате их реакции с бромтрифторацетоном, α-бром-β-(5-имидозоил)пропионовой кислотой, хлорацетилфосфатом, N-алкилмалеимидами, 3-нитро-2-пиридилдисульфидом, метил-2-пиридилдисульфидом, п-хлормеркурибензоатом, 2-хлормеркури-4-нитрофенолом или хлор-7-нитробензо-2-окса-1,3-диазолом.

Гистидильные остатки подвергают дериватизации в ходе их реакции с диэтилпирокарбонатом при pH 5,5-7,0, поскольку данный агент является относительно специфичным для гистидильной боковой цепи. Используется также пара-бромфенацилбромид, указанная реакция проводится предпочтительно в 0,1 М какодилате натрия при pH 6,0.

Лизинильные остатки на амино-конце взаимодействуют с ангидридами янтарной или другой карбоновой кислоты. Дериватизация с помощью этих агентов проводит к изменению заряда лизинильных остатков. Другие подходящие для дериватизации альфа-амино-содержащих остатков агенты включают имидоэфиры, такие как метилпиколинимидат, пиридоксальфосфат, пиридоксаль, хлорборгидрид, тринитробензолсульфоновую кислоту, О-метилизомочевину, 2,4-пентандион и продукты реакции с глиоксилатом, катализируемой трансаминазой.

Аргинильные остатки модифицируют при проведении реакции с одним или несколькими стандартными реагентами, включающими, в частности, фенилглиоксаль, 2,3-бутандион, 1,2-циклогександион и нингидрин. Для дериватизации аргининовых остатков необходимо, чтобы реакция проводилась в щелочных условиях, в связи с высоким значением pKa гуанидиновой функциональной группы. Кроме того, указанные реагенты могут взаимодействовать с группами лизина, а также с эпсилон-аминогруппой аргинина.

Может быть проведена специфическая модификация тирозильных остатков, при этом особый интерес вызывает возможность введения спектральных меток в тирозильные остатки за счет реакции с ароматическими диазониевыми соединениями или тетранитрометаном. Чаще всего используют N-ацетилимидазол и тетранитрометан с образованием О-ацетилтирозильных молекул и 3-нитро-производныъх, соответственно.

Карбоксильные боковые группы (аспартил или глютамил) селективно модифицируют в ходе их реакции с карбодиимидами (R-N=C=N-R'), где R и R' представляют собой разные алкильные группы, такие как l-циклогексил-3-(2-морфолинил-4-этил)карбодиимид или 1-этил-3-(4-азоний-4,4-диметилпентил)карбодиимид. Кроме того, аспартильные и глютамильные остатки превращаются в аспарагинильные и аспарагинильные остатки в ходе реакции с ионами аммония.

Другие модификации включают гидроксилирование пролина и лизина, фосфорилирование гидроксильных групп серильных или треонильных остатков, метилирование альфа-аминогрупп лизина, аргинина и гистидина в боковых цепях (Т. Е. Creighton, Proteins: Structure and Molecular Properties, W.H. Freeman & Co., San Francisco, pp. 79-86 (1983)), дезамидирование аспарагина или глютамина, ацетилирование N-концевого амина и/или амидирование или этерификацию С-концевой карбоксильной группы.

Другой тип ковалентной модификации вовлекает химическое или энзиматическое связывание гликозидов с пептидом. В этом случае, один ил несколько сахаров могут быть присоединены к (a) аргинину и гистидину, (b) свободным карбоксильным группам, (c) свободным сульфгидрильным группам, таким как группы цистеина, (d) свободным гидроксильным группам, таким как группы серина, треонина или гидросипролина, (e) ароматическим остаткам, таким как остатки тирозина или триптофана, или (f) амидной группе глютамина. Соответствующие процедуры модификаций описаны в WO87/05330, опубликованном 11 сентября 1987 года, и в работе Aplin and Wriston, CRC Crit. Rev. Biochem., pp. 259-306(1981).

Репрезентативные конъюгируемые фрагменты, которые могут быть присоединены к любому из пептидов глюкагона по настоящему описанию, включают, без ограничения, гетерологичный пептид или полипептид (включающий, например, белок плазмы), нацеливающий агент, иммуноглобулин или его часть (например, вариабельный участок, например CDR, или Fc участок), диагностическую метку, такую как радиоизотопная метка, флуорофор или энзиматическая метка, полимер, включающий водорастворимый полимер, или другие терапевтические или диагностические вещества. Согласно одному варианту, получают конъюгат, который включает пептид глюкагона по настоящему изобретению и белок плазмы, где указанный белок плазмы выбирают из группы, состоящей из альбумина, трансферина, фибриногена и глобулинов. В одном варианте осуществления настоящего изобретения, фрагмент белка плазмы в конъюгате представляет собой альбумин или трансферин. В некоторых вариантах осуществления настоящего изобретения, указанный линкер включает цепь с длиной примерно от 1 до 60 атомов или 1-30 атомов или более, с длиной от 2 до атомов, 2-10 атомов, 5-10 атомов или 10-20 атомов в длину. В некоторых вариантах осуществления настоящего изобретения, вес атомы в цепи представляют собой атомы углерода. В некоторых вариантах, атомы цепи в скелете линкера выбирают из группы, состоящей из C, O, N и S. Атомы цепи и линкеры могут быть выбраны с учетом их ожидаемой растворимости (гидрофильности), с тем чтобы получить более растворимый конъюгат. В некоторых вариантах осуществления настоящего изобретения, указанный линкер обеспечивает наличие функциональных групп, которые далее подвергают расщеплению ферментом или другим катализатором, или расщепления в условиях гидролиза, характерных для целевой ткани, или органа или клетки. В некоторых вариантах, длина линкера является достаточной для снижения возможности стерических препятствий. Если линкер представляет собой ковалентную связь или пептидную связь и конъюгат представляет собой полипептид, полный конъюгат может представлять собой слитый белок. Такие пептидильные линкеры могут иметь любую длину. Репрезентативные линкеры имеют длину от 1 до 50 аминокислот, от 5 до 50, от 3 до 5, от 5 до 10, от 5 до 15 или от 10 до 30 аминокислот. В альтернативном варианте, такие слитые белки могут быть получены методами рекомбинантных генетических манипуляций, известных специалистам в данной области.

Как указывалось выше, согласно некоторым вариантам осуществления настоящего изобретения, осуществляют конъюгирование пептидов глюкагона, например, путем слияния с иммуноглобулином или его частью (например, с вариабельным участком, CDR или Fc). Известные типы иммуноглобулинов ((Ig) включают IgG, IgA, IgE, IgD или IgM. Fc участок представляет собой С-концевой участок тяжелой цепи Ig, который отвечает за связывание с Fc рецепторами, осуществляющими такие функции, как рециклинг (который приводит к увеличению периода полувыведения) антитело-обусловленная клеточнозависимая цитотоксичность (ADCC), и комплемент-зависимая цитотоксичность (CDC).

Так, например, согласно некоторым определениям, Fc участок тяжелой цепи человеческого IgG локализован на участке от Cys226 до С-конца тяжелой цепи. «Шарнирная область» обычно охватывает участок от Glu216 до Pro230 в человеческом IgG1 (шарнирные области других изотипов IgG можно сравнивать с последовательностью IgG1 при сопоставлении цистеинов, вовлекаемых в образование цистеновых связей). Fc участок IgG включает два константных домена, CH2 и CH3. Домен CH2 на Fc участке человеческого IgG простирается от аминокислоты 231 до аминокислоты 341. Домен CH3 на Fc участке человеческого IgG обычно охватывает область молекулы от аминокислоты 342 до аминокислоты 447. При этом нумерация аминокислот в иммуноглобулинах или фрагментах иммуноглобулинов или их участках приводится в соответствии с классификацией Kabat et al. 1991, Sequences of Proteins of Immunological Interest, U.S. Department of Public Health, Bethesda, Md. В родственных вариантах, Fc участок может включать один или несколько нативных или модифицированных константных участков из тяжелой цепи иммуноглобулина, отличных от CH1, например, CH2 и CH3 участки из IgG и IgA, или CH3 и CH4 участки из IgE.

Подходящие конъюгируемые фрагменты включают части иммуноглобулиновой последовательности, которые включают сайт связывания FcRn. FcRn представляет собой salvage-рецептор, отвечающий за рециклинг иммуноглобулинов и их возвращение в кровоток. Fc участок IgG, который связывается с рецептором FcRn, был описан на основе результатов анализов методом рентгеновской кристаллографии (Burmeister et al. 1994, Nature 372:379). Основная контактная зона Fc участка с FcRn локализована рядом с областью соединения CH2 и CH3 доменов. Все Fc-FcRn контакты находятся внутри одной тяжелой цепи Ig. Основные сайты контакта включают аминокислотные остатки 248, 250-257, 272, 285, 288, 290-291, 308-311 и 314 из CH2 домена и аминокислотные остатки 385-387, 428 и 433-436 из CH3 домена.

Некоторые конъюгируемые фрагменты могут включать один или несколько сайтов связывания FcγR, но могут и не включать их. FcγR отвечает за ADCC и CDC функции. Примеры положений внутри Fc участка, которые позволяют осуществлять прямой контакт с FcγR, включают аминокислоты 234-239 (нижняя зона шарнирной области), аминокислоты 265-269 (B/C петля), аминокислоты 297-299 (C/E петля) и аминокислоты 327-332 (F/G петля) (Sondermann et al., Nature 406: 267-273, 2000). Было показано, что нижняя зона шарнирной области IgE вовлекается в связывание с FcRI (Henry, et al., Biochemistry 36, 15568-15578, 1997). Остатки, вовлекаемые в связывание IgA рецептора, описаны Lewis et al. (J Immunol. 175:6694-701, 2005). Аминокислотные остатки, вовлекаемые в связывание IgE рецептора, описаны в работе Sayers et al. (J Biol Chem. 279(34):35320-5, 2004).

В аминокислоты на Fc участке иммуноглобулина могут быть введены модификации. Такие вариантные Fc участки включают по меньшей мере одну аминокислотную модификацию в CH3 домене Fc участка (остатки 342-447) и/или по меньшей мере одну аминокислотную модификацию в CH2 домене Fc участка (остатки 231-341). Мутации, которые, как считается, способствуют повышению аффинности по FcRn, включают T256A, T307A, E380A и N434A (Shields et al. 2001, J. Biol. Chem. 276:6591). Другие мутации могут ослаблять связывание Fc участка с FcγRI, FcγRIIA, FcγRIIB и/или FcγRIIIA, без значительного снижения аффинности по FcRn. Так, например, замещение Asn в положении 297 на Fc участке Ala или другой аминокислотой удаляет высоко консервативный сайт N-гликозилирования и может приводить к снижению иммуногенности при соответствующем пролонгировании периода полувыведения для Fc участка, а также при сопутствующем снижении связывающей способности с FcγR (Routledge et al. 1995, Transplantation 60:847; Friend et al. 1999, Transplantation 68:1632; Shields et al. 1995, J. Biol. Chem. 276:6591). В аминокислоты в положениях 233-236 в IgG1 были введены модификации, которые снижают связывание с FcγR (Ward and Ghetie 1995, Therapeutic Immunology 2:77 и Armour et al. 1999, Eur. J. Immunol. 29:2613). Некоторые репрезентативные аминокислотные замещения описаны в патентах США 7355008 и 7381408, каждый из которых включают в настоящее описание полностью в качестве ссылки.

В настоящей заявке описываются пептиды слияния или белки слияния с глюкагоном, где второй пептид или полипептид был слит с концом, например, с карбоксильным концом пептида глюкагона. Репрезентативные варианты для такого С-концевого слияния включают SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенные к аминокислоте 29 в пептиде глюкагона.

Стабилизация альфа-спиральной структуры

Снижение активности глюкагона в результате модификации аминокислот в положении 1 и/или в положении 2 в пептиде глюкагона может быть восстановлено путем стабилизации альфа-спиральной структуры в С-концевой части пептида глюкагона (в области аминокислот 12-29). Альфа-спиральная структура может быть стабилизирована, например, за счет создания ковалентного или нековалентного внутримолекулярного мостика, замещения и/или вставки аминокислот в положениях 12-29 с помощью аминокислоты, стабилизующей альфа-спираль (например, альфа,альфа-двузамещенной аминокислоты).

В некоторых вариантах осуществления настоящего изобретения, внутримолекулярный мостик создают между двумя боковыми цепями двух аминокислот при стабилизации трех двухмерных структур в карбокси-концевой части (например, аминокислот 12-29) в пептиде глюкагона. Боковые цепи двух аминокислот могут быть соединены друг с другом через нековалентные связи, например, с помощью водородных связей, ионных взаимодействий, таких как образование солевых мостиков, или с помощью ковалентных связей. В том случае, когда боковые цепи двух аминокислот соединяют друг с другом через одно или большее число ковалентных связей, полученный пептид рассматривается как пептид, включающий ковалентный внутримолекулярный мостик. В том случае, когда боковые цепи двух аминокислот соединяют друг с другом через нековалентные связи, например, с помощью водородных связей, ионных взаимодействий, то полученный пептид рассматривается в контексте настоящего описания, как включающий нековалентный внутримолекулярный мостик.

В некоторых вариантах осуществления настоящего изобретения, указанный внутримолекулярный мостик образуется между двумя аминокислотами, которые разделены 3 аминокислотами, например, между аминокислотами, расположенными в положениях «i» и «i+4», где i равно любому целому числу от 12 до 25 (например, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 и 25). Более конкретно, соединяют попарно боковые цепи аминокислот в положениях 12 и 16, 16 и 20, 20 и 24 или 24 и 28 (пары аминокислот, где i=12, 16, 20 или 24), и это приводит к стабилизации альфа-спиральной структуры глюкагона. Альтернативно, i может быть равен 17.

В некоторых конкретных вариантах осуществления настоящего изобретения, где аминокислоты в положениях «i» и «i+4» соединяются внутримолекулярным мостиком, размер линкера составляет примерно 8 атомов или примерно 7-9 атомов.

В других вариантах осуществления настоящего изобретения, указанный внутримолекулярный мостик образуется между двумя аминокислотами, которые разделяются двумя другими аминокислотами, то есть образуются между аминокислотами в положениях «j» и «j+3», где «j» равен любому числу от 12 до 26 (например, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 и 26). В некоторых конкретных вариантах «j» равен 17.

В некоторых вариантах осуществления настоящего изобретения, где аминокислоты в положениях «j» и «j+3» соединяются внутримолекулярным мостиком, размер линкера составляет примерно 6 атомов или примерно 5-7 атомов.

В еще других вариантах осуществления настоящего изобретения, указанный внутримолекулярный мостик образуется между двумя аминокислотами, которые разделяются между собой шестью аминокислотами, то есть это могут быть аминокислоты в положениях «к» and «k+7», где к равно любому целому числу от 12 до 22 (например, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 и 22). В некоторых конкретных вариантах «к» равно 12, 13 или 17. В одном репрезентативном варианте «к» равен 17.

Примеры аминокислотных пар, которые способны ковалентно соединяться с образованием шестиатомного связующего мостика, включают Orn и Asp, Glu и аминокислоту формулы I, где n равен 2, и гомоглютаминовую кислоту и аминокислоту формулы I, где n равен 1, а формула I показана ниже:

где n=1-4

[Формула I])

Примеры аминокислотных пар, которые способны ковалентно связываться с образованием семиатомного связующего мостика, включают Orn-Glu (лактамное кольцо); Lys-Asp (лактам) или Homoser-Homoglu (лактон). Примеры аминокислотных пар, которые могут образовать восьмиатомный линкер, включают: Lys-Glu (лактам); Homolys-Asp (лактам); Orn-Homoglu (лактам); 4-аминоPhe-Asp (лактам); или Tyr-Asp (лактон). Примеры аминокислотных пар, которые могут образовать девятиатомный линкер, включают Homolys-Glu (лактам); Lys-Homoglu (лактам); 4-аминоPhe-Glu (лактам) или Tyr-Glu (лактон). Любая из боковых цепей в данных аминокислотах может быть дополнительно замещена другими химическим группами, при условии, что не будет нарушаться трехмерная структура альфа-спирали.

Любой специалист со средним уровнем знаний в данной области может оценить возможность альтернативного спаривания или наличие альтернативных аналогов аминокислот, включая химически модифицированные производные, использование которых позволит создать стабилизированную структуру аналогичного размера, оказывающую желательный эффект. Например, гомоцистеин-гомоцистеиновый дисульфидный мостик включает 6 атомов в длину и может быть дополнительно модифицирован с достижением желательного эффекта. Даже без наличия ковалентного связывания, описанное выше аминокислотное спаривание или аналогичный вариант спаривания, приемлемость которых может оценить любой специалист в данной области, могут также обеспечивать дополнительную стабильность альфа-спиральной структуре за счет нековалентных связей, например, через образование солевых мостиков или взаимодействие за счет водородных связей.

Размер лактамного кольца может варьировать, в зависимости от длины боковых цепей аминокислот, и в одном варианте осуществления настоящего изобретения, указанное лактамное кольцо образуется при соединении боковых цепей лизина с боковой цепью глютаминовой кислоты. Другие репрезентативные варианты осуществления настоящего изобретения включают следующие варианты спаривания, необязательно при наличии лактамного мостика: Glu в положении 12 с Lys в положении 16; нативный Lys в положении 12 с Glu в положении 16; Glu в положении 16 с Lys в положении 20; Lys в положении 16 с Glu в положении 20; Glu в положении 20 с Lys в положении 24; Lys в положении 20 с Glu в положении 24; Glu в положении 24 с Lys в положении 28; Lys в положении 24 с Glu в положении 28. Альтернативно, порядок амидной связи в лактановом кольце может быть обратным (например, лактамное кольцо может быть образовано между боковыми цепями Lys12 и Glu16 или альтернативно, между Glu12 и Lys16).

Внутримолекулярные мостики, отличные от лактамного мостика, могут использоваться для стабилизации альфа-спирали пептидных аналогов гликогона. В одном варианте осуществления настоящего изобретения, внутримолекулярный мостик представляет собой гидрофобный мостик. В этом случае, внутримолекулярный мостик необязательно создается между боковыми цепями двух аминокислот, которые являются частью гидрофобной стороны альфа-спирали пептидного аналога глюкагона. Например, одна из аминокислот, соединенных гидрофобным мостиком, может представлять собой аминокислоту в положении 10, 14 и 18.

В одном конкретном аспекте, используют олефиновый метатезис для кросс-сшивки одного или нескольких витков альфа-спирали в пептиде глюкагона с использованием системы, позволяющей осуществлять кросс-сшивку всех углеводородов. В этом случае, пептид глюкагона может включать α-метилированные аминокислоты, содержащие олефиновые боковые цепи различной длины и имеющие либо R, либо S стереохимию в «i» и «i+4» или «i+7» положениях. Так, например, олефиновая боковая цепь может включать (СН2)n, где n равен любому целому числу от 1 до 6. В одном варианте, n равен 3 для кросс-сшивки молекул длиной в 8 атомов. Подходящие способы создания таких внутримолекулярных мостиков известны в данной области. См., например, Schafmeister et al., J Am. Chem. Soc. 122: 5891-5892 (2000) и Walensky et al., Science 305: 1466-1470 (2004). Альтернативно, пептид глюкагона может включать содержащие О-алкильные группы Ser остатки, локализованные на соседних витках спирали, которые соединены друг с другом мостиком через метатезис, направленный на закрытие кольца, катализируемый рутением. Такие процедуры кросс-сшивки описаны, например, в работе Blackwell et al., Angew, Chem., Int. Ed. 37: 3281-3284 (1998).

В другом конкретном аспекте, используют неприродную аминокислоту тиодиаланин, лантионин, который широко применяется как пептидомиметик цистеина, для целей кросс-сшивки в пределах одного витка альфа-спирали. Подходящие способы циклизации на основе лантионина в настоящей области. См., например, Matteucci et al., Tetrahedron Letters 45: 1399-1401 (2004); Mayer ct al., J. Peptide Res. 51: 432-436 (1998); Polinsky et al., J. Med. Chem. 35: 4185-4194 (1992); Osapay et al., J. Med. Chem. 40: 2241-2251 (1997); Fukase et al., Bull. Chem. Soc. Jpn. 65: 2227-2240 (1992); Harpp et al., J. Org. Chem. 36: 73-80 (1971); Goodman и Shao, Pure Appl. Chem. 68: 1303-1308 (1996); и Osapay и Goodman, J. Chem. Soc. Chem. Commun. 1599-1600 (1993).

В некоторых вариантах осуществления настоящего изобретения, используют α,ω-диаминоалкановые связки (например, 1,4-диаминопропановую и 1,5-диаминопентановую) между двумя Glu остатками в положениях «i» и «i+7» для стабилизации альфа-спирали пептида глюкагона. Такие связки ведут к образованию мостика из 9-атомов или еще большей длины, в зависимости от длины диаминоалкановой связки. Подходящие способы получения кросс-сшитых пептидов с такими связками известны в данной области. См., например, Phelan et al., J. Am. Chem. Soc. 119: 455-460 (1997).

В еще одном варианте осуществления настоящего изобретения, используют дисульфидный мостик для кросс-сшивки одного или двух витков альфа-спирали в пептиде глюкагона. Альтернативно, используют модифицированный дисульфидный мостик, в котором один или два атома серы замещены метиленовой группой, что приводит к изостерической макроциклизации, для целей стабилизации альфа-спирали пептида глюкагона. Соответствующие способы модификации пептидов дисульфидными мостиками или с помощью серной циклизации описаны в работах Jackson et al., J. Am. Chem. Soc. 113: 9391-9392 (1991) и Rudingor и Jost, Experientia 20: 570-571 (1964).

В еще одном варианте осуществления настоящего изобретения, альфа-спираль пептида глюкагона стабилизируют путем связывания атома металла двумя His остатками или парой His и Cys, расположенной в положениях i и i+4. Указанный атом металла может представлять собой, например, Ru(III), Cu(II), Zn(II) или Cd(II). Такие способы стабилизации альфа-спирали с помощью атомов металла известны в данной области. См., например, Andrews and Tabor, Tetrahedron 55: 11711-11743 (1999); Ghadiri et al., J. Am. Chem. Soc. 112: 1630-1632 (1990); и Ghadiri et al., J Am. Chem. Soc. 119: 9063-9064 (1997).

Альфа-спираль пептида глюкагона в альтернативном варианте может быть стабилизирована с использованием других способов циклизации пептида и эти способы описаны в обзоре Davics, J. Peptide. Sci. 9: 471-501 (2003). Альфа-спираль может быть стабилизирована за счет образования амидного мостика, тиоэфирного мостика, мостика на основе сложной тиоэфирной связи, мочевинного мостика, карбаматного мостика, сульфонамидного мостика и т.п. Например, мостик на основе сложной тиоэфирной связи может быть создан между С-концом и боковой цепью Cys остатка. Альтернативно, сложный тиоэфирный мостик может быть создан за счет взаимодействия боковых цепей аминокислот, содержащих тиоловую группу (Cys) и карбоксильную группу (например, Asp, Glu). Согласно другому способу, используют кросс-сшивающий агент, такой как дикарбоновая кислота, например, субериновая кислоты (октандиоевая кислота) и т.п., который способен формировать связь между функциональными группами на боковой цепи аминокислоты, такими как свободная аминогруппа, гидроксильная группа, тиоловая группа и их сочетания.

Согласно одному варианту осуществления настоящего изобретения, альфа-спираль пептида глюкагона стабилизируют за счет включения гидрофобных аминокислот в положениях i и i+4. Например, i может представлять собой Tyr, а i+4 может быть либо Val, либо Leu; i может быть Phe, i+4 может быть Cys или Met; i может быть Cys и i+4 может быть Met; или i может быть Phe и i+4 can be Ile. Следует понимать, что с учетом целей настоящего описания, указанные пары аминокислот могут меняться местами, так что, альтернативном варианте, указанная аминокислота в положении i может в быть перемещена в положение i+4, тогда как аминокислота из положения i+4 может перейти в положении i.

Согласно другим вариантам осуществления настоящего изобретения, альфа-спираль стабилизируют за счет включения (путем либо замещения, либо вставки аминокислоты) одной или нескольких стабилизирующих альфа-спираль аминокислот в С-концевой части пептида глюкагона (в области аминокислот 12-29). В конкретном варианте, стабилизирующая альфа-спираль аминокислота представляет собой α,α-двузамещенную аминокислоту, которая включает, без ограничения, аминоизомасляную кислоту (AIB), аминокислоту, которая в двух положениях замещена одной и той же или разными группами, выбранными из метила, этила, пропила и н-бутила, или циклооктаном или циклогептаном (например, при использовании 1-аминоциклооктан-1-карбоновой кислоты). В некоторых вариантах осуществления настоящего изобретения, одно, два, три, четыре или большее число положений из указанных ниже положений: 16, 17, 18, 19, 20, 21, 24 или 29 в пептиде глюкагона замещают α,α-двузамещенной аминокислотой. В конкретном варианте, одно, два, три или все положения из положений 16, 20, 21 и 24 замещают AIB. Например, пептид глюкагона может включать замещение AIB по положению 16, без внутримолекулярного мостика например, нековалентного внутримолекулярного мостика (например, солевого мостика) или ковалентного внутримолекулярного мостика (например, лактама). Такие пептиды без внутримолекулярного мостика имеют преимущество, определяемое легкостью их получения.

Согласно некоторым вариантам осуществления настоящего изобретения, пептид глюкагона без внутримолекулярного мостика включает одно или несколько замещений на участке аминокислот 12-29 α,α-двузамещенной аминокислотой или ацильной или алкильной группой, которые ковалентно присоединяют к боковой цепи аминокислоты в пептиде глюкагона, например, аминокислоты в положении 10 в пептиде глюкагона. В конкретных вариантах, ацильная или алкильная группы является ненативной для природной аминокислоты. Согласно некоторым аспектам, указанная ацильная или алкильная группы является ненативной для аминокислоты в положении 10. Такие ацилированные или алкилированные пептиды глюкагона без внутримолекулярного мостика обладают повышенной активностью по рецепторам GLP-1 и глюкагона в сравнении с соответствующими неацилированными вариантами пептида. Дополнительное повышение активности по рецепторам GLP-1 и глюкагона может быть достигнуто за счет использования ацилированных пептидов глюкагона без внутримолекулярного мостика, которые получают путем включения спейсера между ацильной или алкильной группой и боковой цепью аминокислоты в положении 10 пептида. Ниже описывается более подробно ацилирование и алкилирование, при наличии или отсутствие включаемого спейсера.

В конкретных вариантах осуществления настоящего изобретения, ацилированный или алкилированный пептид глюкагона или их аналог включает дополнительную модификацию, которая селективно снижает активность по рецептору GLP-1. Так, например, ацилированный или алкилированный пептид глюкагона или их аналог имеет, по отдельности или в сочетании, следующие характерные особенности: С-концевой альфа-карбоксилат, делецию аминокислот от С-конца до аминокислоты в положении 27 или 28 (например, делецию аминокислоты в положении 29, делецию аминокислоты в положениях 28 и 29), замещение Thr в положении 7 аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile.

Примеры различных вариантов осуществления настоящего изобретения

Согласно одному из вариантов осуществления настоящего изобретения, нативный пептид глюкагона SEQ ID NO: 1 модифицируют путем замещения нативной аминокислоты в положении 28 и/или 29 отрицательно заряженной аминокислотой (например, аспарагиновой кислотой или глютаминовой кислотой) и необязательно путем добавления отрицательно заряженной аминокислоты (например, аспарагиновой кислоты или глютаминовой кислоты) на карбокси-конце пептида. В альтернативном варианте осуществления настоящего изобретения, нативный пептид SEQ ID NO: 1 модифицируют путем замещения нативной аминокислоты в положении 29 положительно заряженной аминокислотой (например, лизином, аргинином или гистидином) и необязательно путем добавления одной или двух положительно заряженных аминокислот (например, лизина, аргинина или гистидина) на карбокси-конце пептида. Согласно одному варианту осуществления настоящего изобретения, получают аналог глюкагона, характеризующийся улучшенной растворимостью и стабильностью, где указанный аналог включает аминокислотную последовательность SEQ ID NO: 34, при условии, что по меньшей мере одна из аминокислот в положениях 28 или 29 замещена кислой аминокислотой и/или добавлена дополнительная кислая аминокислота на карбокси-конце SEQ ID NO: 34. В одном варианте осуществления настоящего изобретения, указанные кислые аминокислоты независимо выбирают из группы, состоящей из Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты.

Согласно одному варианту осуществления настоящего изобретения, получают агонист глюкагона, обладающий улучшенной растворимостью и стабильностью, где указанный агонист включает аминокислотную последовательность SEQ ID NO: 33, где по меньшей мере одна из аминокислот в положениях 27, 28 и 29 замещена остатком ненативной аминокислоты (то есть, по меньшей мере одна из аминокислот в положениях 27, 28 и 29 аналога представляет собой аминокислоту, отличную от аминокислоты, присутствующей в соответствующем положении в последовательности SEQ ED NO: 1). Согласно одному варианту осуществления настоящего изобретения, получают агонист глюкагона, включающий последовательность SEQ ID NO: 33, при условии, что, когда аминокислота в положении 28 представляет собой аспарагин, а аминокислота в положении 29 представляет собой треонин, пептид дополнительно включает одну или две аминокислоты, независимо выбранные из группы, состоящей из Lys, Arg, His, Asp или Glu, которая добавлена к карбокси-концу пептида глюкагона.

Было показано, что некоторые положения в нативном пептиде глюкагона могут быть модифицированы при сохранении по меньшей мере частично активности исходного пептида. Соответственно, авторы полагали, что одна или несколько аминокислот в положениях 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27, 28 или 29 в пептиде SEQ ED NO: 11 могут быть замещены аминокислотой, отличной от той аминокислоты, которая присутствует в нативном пептиде глюкагона, при сохранении все еще высокой эффективности, стабильности при физиологических значениях pH и биологической активности исходного пептида глюкагона. Например, согласно одному варианту осуществления настоящего изобретения, остаток метионина, присутствующий в положении 27 в нативном пептиде, меняют до лейцина или норлейцина для предупреждения окислительного разложения пептида.

В рамках одного варианта осуществления настоящего изобретения, получают аналог глюкагона с последовательностью SEQ ID NO: 33, где от 1 до 6 аминокислот, выбранных из положений 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 или 24 аналога, отличаются от соответствующей аминокислоты в SEQ ID NO: 1. Согласно другому варианту, получают аналог глюкагона SEQ ID NO: 33, где от 1 до 3 аминокислот, выбранных из положений 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 или 24 аналога, отличаются от соответствующей аминокислоты в SEQ ID NO: 1. В рамках другого варианта, получают аналог глюкагона с последовательностями SEQ ID NO: 7, SEQ ID NO: 8 или SEQ ID NO: 34, где 1-2 аминокислоты, выбранные из положений 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 или 24 аналога, отличаются от соответствующей аминокислоты в SEQ ID NO: 1, и в другом варианте, указанные одна или две отличающихся аминокислоты соответствуют консервативным замещениям аминокислот относительно аминокислоты, присутствующей в нативной последовательности (SEQ ID NO: 1). В одном варианте осуществления настоящего изобретения, получают пептид глюкагона с последовательностью SEQ ID NO: 11 или SEQ ID NO: 13, где пептид глюкагона также включает одно, два или три замещения аминокислот, которые находятся в положениях, выбранных из 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27 или 29. В одном варианте, указанные замещения в положениях 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 27 или 29 являются консервативными аминокислотными замещениями.

В одном варианте осуществления настоящего изобретения, получают агонист глюкагона, включающий аналог пептида с последовательностью SEQ ID NO: 1, где указанный аналог отличается от SEQ ED NO: 1 по аминокислоте, отличной от серина, имеющегося в положении 2, и за счет наличия кислой аминокислоты, которая замещает нативную аминокислоту в положении 28 или 29, или за счет наличии кислой аминокислоты, добавленной к карбокси-концу пептида SEQ ID NO: 1. В одном варианте осуществления настоящего изобретения, указанная кислая аминокислота является аспарагиновой кислотой или глютаминовой кислотой. В одном варианте, получают аналог глюкагона с последовательностью SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 13 или SEQ ID NO: 32, где указанный аналог отличается от исходной молекулы наличием замещения в положении 2. Более конкретно, положение 2 в аналоге пептида замещают аминокислотой, выбранной из группы, состоящей из D-серина, аланина, D-аланина, глицина, н-метилсерина и аминоизомасляной кислоты.

В другом варианте осуществления настоящего изобретения, получают агонист глюкагона, включающий аналог пептида с последовательностью SEQ ID NO: 1, где указанный аналог отличается от SEQ ID NO: 1 за счет наличия аминокислоты, отличной от гистидина в положении 1, и за счет наличия кислой аминокислоты, которая замещает нативную аминокислоту в положениях 28 или 29, или за счет наличия кислой аминокислоты, добавленной к карбокси-концу пептида SEQ ID NO: 1. В одном варианте осуществления настоящего изобретения, указанная кислая аминокислота представляет собой аспарагиновую кислоту или глютаминовую кислоту. В одном варианте осуществления настоящего изобретения, получают аналог глюкагона с последовательностью SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 13 или SEQ ID NO: 32, где указанный аналог отличается от исходной молекулы наличием замещения в положении 1. Более конкретно, положение 1 в аналоге пептида замещают аминокислотой, выбранной из группы, состоящей из DMIA, D-гистидина, дезаминогистидина, гидроксилгистидина, ацетилгистидина и гомогистидина.

Согласно одному варианту осуществления настоящего изобретения, пептид глюкагона включает последовательность, выбранную из группы, состоящей SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 13 и SEQ ED NO: 32. В другом варианте, получают пептид глюкагона, включающий последовательность SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 13 или SEQ ID NO: 32, которая также содержит одну-две аминокислоты, добавленные к С-концу SEQ ID NO: 9, SEQ ID NO: 12, SEQ ED NO: 13 или SEQ ID NO: 32, где указанные аминокислоты независимо выбраны из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты. В одном варианте, дополнительные аминокислоты, добавленные к карбокси-концу, выбраны из группы, состоящей из Lys, Arg, His, Asp или Glu, или, в другом варианте, указанные дополнительные аминокислоты представляют собой Asp или Glu.

В другом варианте осуществления настоящего изобретения, указанный пептид глюкагона включает последовательность SEQ ID NO: 7 или аналог агониста глюкагона. В одном варианте, указанный пептид включает последовательность, выбранную из группы, состоящей из SEQ ED NO: 8, SEQ ED NO: 10, SEQ ID NO: 11, SEQ ED NO: 12 и SEQ ID NO: 13. В другом варианте, указанный пептид включает последовательность, выбранную из группы, состоящей из SEQ ED NO: 8, SEQ ED NO: 10 и SEQ ED NO: 11. В одном варианте осуществления настоящего изобретения указанный пептид глюкагона включает последовательность SEQ ID NO: 8, SEQ ID NO: 10 и SEQ ID NO: 11, а также включает дополнительную аминокислоту, выбранную из группы, состоящей из Asp и Glu, которая добавлена к С-концу пептида глюкагона. В одном варианте осуществления настоящего изобретения, указанный пептид включает последовательность SEQ ED NO: 11 или SEQ ID NO: 13, а в другом варианте указанный пептид глюкагона включает последовательность SEQ ID NO: 11.

Согласно одному варианту осуществления настоящего изобретения, получают агонист глюкагона, включающий модифицированный пептид глюкагона, выбранный из группы, состоящей из:

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Xaa-Xaa-Xaa-R (SEQ ID NO: 34);

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asp-Thr-R (SEQ ID NO: 13);

где Xaa в положении 15 обозначает Asp, Glu, цистеиновую кислоту, гомоглютаминовую кислоту или гомоцистеиновую кислоту, Xaa в положении 28 обозначает Asn или кислую аминокислоту и Xaa в положении 29 обозначает Thr или кислую аминокислоту и R представляет собой кислую аминокислоту, -COOH или CONH2, при условии, что указанный остаток кислой аминокислоты присутствует в одном из положений 28, 29 или 30. В одном варианте R обозначает COOH R и в другом варианте R обозначает CONH2.

Настоящее описание также относится к слитым пептидам глюкагона, где второй пептид был присоединен к С-концу пептида глюкагона для повышения стабильности и растворимости пептида глюкагона. Более конкретно, слитый пептид глюкагона может включать аналог агониста глюкагона, включающий пептид глюкагона NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Xaa-Xaa-Xaa-R (SEQ ID NO: 34), где R обозначает кислую аминокислоту или связь, и аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенную к карбокси-концу С-концевой аминокислоты в пептиде глюкагона. В одном варианте осуществления настоящего изобретения, указанный пептид глюкагона выбирают из группы, состоящей из SEQ ID NO: 33, SEQ ID NO: 7, SEQ ID NO: 8, а также включающей аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенную к карбокси-концу С-концевой аминокислоты в пептиде глюкагона. В одном варианте, указанный слитый пептид глюкагона включает SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 и SEQ ID NO: 6 или соответствующие аналог агониста глюкагона, также включающий аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенную к аминокислоте 29 в пептиде глюкагона. Согласно одному варианту осуществления настоящего изобретения, указанный слитый пептид также включает ПЭГ цепь, присоединенную к аминокислоте в положении 16, 17, 21, 24, 29 в пределах С-концевого расширения или к С-концевой аминокислоте, где указанную ПЭГ цепь выбирают из цепей, имеющих массу в диапазоне от 500 до 40000 дальтон. В одном варианте осуществления настоящего изобретения, аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR) присоединяют к аминокислоте 29 в пептиде глюкагона через пептидную связь. В одном варианте, пептидная часть глюкагона в слитом пептиде глюкагона включает последовательность, выбранную из группы, состоящей из SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 13. В одном варианте, пептидная часть глюкагона в слитом пептиде глюкагона включает последовательность SEQ ID NO: 11 или SEQ ID NO: 13, где указанную ПЭГ цепь присоединяют в положении 21, 24, 29 в пределах С-концевого расширения или к С-концевой аминокислоте, соответственно.

Согласно другому варианту осуществления настоящего изобретения, последовательность пептида глюкагона в слитом пептиде включает последовательность SEQ ID NO: 11, которая также включает аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенную к аминокислоте 29 в пептиде глюкагона. В одном варианте, указанный слитый пептид глюкагона включает последовательность, выбранную из группы, состоящей из группы, состоящей из SEQ ID NO: 24, SEQ ID NO: 25 и SEQ ID NO: 26. В типичном случае, слитые пептиды по настоящему изобретению будут иметь С-концевую кислоту со стандартной карбоксильной группой. Однако, аналоги тех последовательностей, где С-концевая аминокислота содержит амид, замещающий карбоновую кислоту, также входят в область настоящего изобретения. Согласно одному варианту осуществления настоящего изобретения, слитый пептид глюкагона включает аналог агониста глюкагона, выбранный из группы, состоящей из SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 13, также включающий аминокислотную последовательность SEQ ID NO: 23 (GPSSGAPPPS-CONH2), присоединенную к аминокислоте 29 в пептиде глюкагона.

Агонисты глюкагона по настоящему изобретению могут быть далее модифицированы с целью повышения растворимости и стабильности пептида в водных растворах при сохранении биологической активности пептида глюкагона. Согласно одному варианту, введение гидрофильных групп в одном или нескольких положениях, выбранных из положений 16, 17, 20, 21, 24 и 29, в пептиде с последовательностью SEQ ID NO: 11, или в соответствующем аналоге агониста глюкагона будет, как ожидается, повышать растворимость и стабильность аналога глюкагона за счет стабилизации при соответствующем pH. Более конкретно, в одном варианте, пептид глюкагона с последовательностью SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 13 или SEQ ID NO: 32 модифицируют таким образом, чтобы он включал одну или несколько гидрофильных групп, ковалентно присоединенных к боковым цепям аминокислот, присутствующих в положениях 21 и 24 в пептиде глюкагона.

Согласно одному варианту осуществления настоящего изобретения, указанный пептид глюкагона с последовательностью SEQ ID NO: 11 модифицируют таким образом, чтобы он содержал одно или несколько замещений аминокислот в положениях 16, 17, 20, 21, 24 и/или 29, где нативную аминокислоту замещают аминокислотой, имеющей боковую цепь, подходящую для перекрестного сшивания с гидрофильными фрагментами, включающими, например, ПЭГ. Нативный пептид может быть замещен природной аминокислотой или синтетической (неприродной) аминокислотой. Синтетические или неприродные аминокислоты относятся к тем аминокислотам, которые в естественном состоянии не встречаются in vivo, но которые, тем не менее, могут быть включены в структуры описанных выше пептидов.

В одном варианте осуществления настоящего изобретения, получают агонист глюкагона с последовательностью SEQ ID NO: 10, SEQ ID NO: 11 или SEQ ID NO: 13, где нативная пептидная последовательность глюкагона была модифицирована таким образом, чтобы она содержала природную или синтетическую аминокислоту по меньшей мере в одном из положений 16, 17, 21, 24, 29, в пределах С-концевого расширения или по С-концевой аминокислоте в нативной последовательности, где замещающая аминокислота также включала бы гидрофильный фрагмент. В одном варианте, указанное замещение происходит в положениях 21 или 24, и в другом варианте указанный фрагмент представляет собой ПЭГ цепь. В одном варианте осуществления настоящего изобретения, пептид глюкагона с последовательностью SEQ ID NO: 11 замещают по меньшей мере одним цистеиновым остатком, где боковую цепь цистеинового остатка дополнительно модифицируют реакционноспособным с тиолом реагентом, включающим, например, малеимидо, винилсульфон, 2-пиридилтио, галогеналкил и галогенацил. Указанные реакционноспособные с тиолом реагенты могут содержать карбокси, кето, гидроксильные и эфирные группы, а также другие гидрофильные фрагменты, такие как полиэтиленгликолевые единицы. В альтернативном варианте осуществления настоящего изобретения, нативный пептид глюкагона замещают лизином, а боковую цепь замещающего лизинового остатка далее модифицируют с использованием реакционнноспособных с амином реагентов, таких как активные сложные эфиры (сукцинимидо, ангидрид и т п.) карбоновых кислот или альдегиды гидрофильных групп, таких как полиэтиленгликоль. В одном варианте осуществления настоящего изобретения, указанный пептид глюкагона выбирают из группы, состоящей из SEQ ED NO: 14, SEQ ID NO: 15, SEQ ED NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 и SEQ ID NO: 19.

Согласно одному варианту осуществления настоящего изобретения, ПЭГилированный пептид глюкагона включает две или более полиэтиленовые цепи, ковалентно присоединенные к пептиду глюкагона, где общая молекулярная масса цепей глюкагона составляет от примерно 1000 до примерно 5000 дальтон. В одном варианте осуществления настоящего изобретения, указанный ПЭГилированный агонист глюкагона включает пептиды с последовательностью SEQ ID NO: 6, где ПЭГ цепь ковалентно присоединена к аминокислотному остатку в положении 21 и в положении 24 и где общая молекулярная масса двух ПЭГ цепей составляет от примерно 1000 до примерно 5000 дальтон. В другом варианте осуществления настоящего изобретения, ПЭГилированный агонист глюкагона включает пептид с последовательностью SEQ ID NO: 6, где ПЭГ цепь ковалентно присоединена к аминокислотному остатку в положениях 21 и 24 и где общая молекулярная масса двух ПЭГ цепей составляет от примерно 5000 до примерно 20000 дальтон.

Полиэтиленгликолевая цепь может быть представлена в виде линейной цепи или может быть разветвленной. Согласно одному варианту осуществления настоящего изобретения, указанная полиэтиленгликолевая цепь имеет среднюю молекулярную массу, выбранную из диапазона от примерно 500 до примерно 40000 дальтон. В одном варианте, указанная полиэтиленгликолевая цепь имеет молекулярную массу, выбранную из диапазона от примерно 500 до примерно 5000 дальтон. В другом варианте, указанная полиэтиленгликолевая цепь имеет молекулярную массу от примерно 20000 до примерно 40000 дальтон.

Любой из описанных выше пептидов глюкагона может быть дополнительно модифицирован за счет включения в него ковалентного или нековалентного внутримолекулярного мостика или аминокислоты, стабилизирующей альфа-спираль, в пределах С-концевой части пептида глюкагона (аминокислоты в положениях 12-29). Согласно одному варианту осуществления настоящего изобретения, пептид глюкагона включает одну или несколько модификаций, любую из числа описанных выше, в дополнение к замещению аминокислоты в положениях 16, 20, 21, или 24 (или их сочетания) α,α-двузамещенной аминокислотой, например, AIB. Согласно другому варианту осуществления настоящего изобретения, указанный пептид глюкагона включает одну или несколько модификаций из числа описанных выше в дополнение к введению внутримолекулярного мостика, например, введение лактама между боковыми цепями аминокислот в положениях 16 и 20 в пептиде глюкагона.

Согласно одному варианту осуществления настоящего изобретения, указанный пептид глюкагона включает аминокислотную последовательность SEQ ID NO: 77, где Xaa в положении 3 представляет собой аминокислоту, включающую боковую цепь со структурой I, II и III:

Структура I

Структура II

Структура III

где R1 обозначает C0-3алкил или С0-3гетероалкил; R2 обозначает NHR4 или C1-3алкил; R3 обозначает C1-3алкил; R4 обозначает H или C1-3алкил; X обозначает NH, О или S; и Y обозначает NHR4, SR3 или OR3. В некоторых вариантах X обозначает NH или Y обозначает NHR4. В некоторых вариантах R1 обозначает C0-2алкил или С1гетероалкил. В некоторых вариантах R2 обозначает NHR4 или C1алкил. В некоторых вариантах R4 обозначает H или C1 алкил. В репрезентативных вариантах получают аминокислоту, включающую боковую цепь структуры I, где R1 обозначает CH2-S, X обозначает NH и R2 обозначает CH3 (ацетамидометилцистеин, C(Acm)); R1 обозначает CH2, X обозначает NH и R2 обозначает CH3 (ацетилдиаминобутановая кислота, Dab(Ac)); R1 is C0алкил, X обозначает NH, R2 обозначает NHR4 и R4 обозначает H (карбамоилдиаминопропановая кислота, Dap(мочевина)); или R1 обозначает CH2-CH2, X обозначает NH и R2 обозначает CH3 (ацетилорнитин, Orn(Ac)). В репрезентативных вариантах получают аминокислоту, включающую боковую цепь структуры II, где R1 обозначает CH2, Y обозначает NHR4 и R4 обозначает CH3 (метилглютамин, Q(Me)). В репрезентативных вариантах получают аминокислоту, включающую боковую цепь структуры III, где R1 обозначает CH2 и R4 обозначает H (метионинсульфоксид, M(O)). В конкретных вариантах аминокислоту в положении 3 замещают Dab(Ac). Например, агонисты глюкагона могут включать аминокислотные последовательности SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73 и SEQ ID NO: 74.

В некоторых вариантах осуществления настоящего изобретения, указанный пептид глюкагона представляет собой аналог пептида глюкагона с последовательностью SEQ ID NO: 77. В конкретных аспектах указанный аналог включает любую из аминокислотных модификаций согласно настоящему описанию, включая, без ограничения, замещение Asn в положении 28 заряженной аминокислотой; замещение Asn в положении 28 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замещение в положении 28 Asn, Asp или Glu; замещение в положении 28 Asp, замещение в положении 28 Glu; замещение Thr в положении 29 заряженной аминокислотой; замещение Thr в положении 29 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замещение в положении 29 Asp, Glu или Lys; замещение в положении 29 Glu; вставку 1-3 заряженных аминокислот после положения 29; вставку после положения 29 Glu или Lys; вставку после положения 29 Gly-Lys или Lys-Lys; и их сочетания.

В некоторых вариантах осуществления настоящего изобретения, указанный аналог пептида глюкагона с последовательностью SEQ ID NO: 77 включает α,α-двузамещенную аминокислоту, такую как AIB, в одном, двух, трех или всех положениях: 16, 20, 21 и 2.

В некоторых вариантах осуществления настоящего изобретения аналог пептида глюкагона с последовательностью SEQ ID NO: 77 включает одну или несколько из указанных ниже модификаций: замещение His в положении 1 ненативной аминокислотой, которая снижает чувствительность пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV), замещение Ser в положении 2 ненативной аминокислотой, которая снижает чувствительность пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV), замещение; Thr в положении 7 аминокислотой, не содержащей гидроксильную группу, например, Abu или ILe; замещение Tyr в положении 10 Phe или Val; замещение Lys в положении 12 Arg; замещение Asp в положении 15 Glu, замещение Ser в положении 16 Thr или AIB; замещение Gln в положении 20 Ala или AIB; замещение Asp в положении 21 Glu; замещение Gln в положении 24 Ala или AIB; замещение Met в положении 27 Leu или Nle; делецию аминокислот в положениях 27-29; делецию аминокислот в положениях 28-29; делецию аминокислоты в положении 29; добавление аминокислотной последовательности SEQ ID NO: 20 к С-концу, где аминокислота в положении 29 представляет собой Thr или Gly, или их комбинацию.

В соответствии с конкретными вариантами осуществления настоящего изобретения, указанный пептид глюкагона включает любую из аминокислотных последовательностей SEQ ID NoNo: 62-67 и 69-74.

В конкретных вариантах осуществления настоящего изобретения, указанный аналог пептида глюкагона, включающий SEQ ID NO: 77, включает гидрофильный фрагмент, например, ПЭГ, ковалентно присоединенный к аминокислоте в любом из положений: 16, 17, 20, 21, 24 и 29, или к С-концевой аминокислоте.

В некоторых вариантах осуществления настоящего изобретения, указанный аналог пептида глюкагона, включающий SEQ ID NO: 77, включает аминокислоту, содержащую боковую цепь, которая ковалентно присоединена, необязательно через спейсер, к ацильной группе или к алкильной группе, где указанная ацильная группа или алкильная группа является ненативной природной аминокислоты. В некоторых вариантах ацильная группа представляет собой C4-C30 жирноацильную группу. В других вариантах, указанная алкильная группа представляет собой C4-C30 алкил. В некоторых вариантах, указанная ацильная группа или алкильная группа ковалентно присоединена к боковой цепи аминокислоты в положении 10. В некоторых вариантах, аминокислота в положении 7 представляет собой Ile или Abu.

Применение

Как будет более подробно описано в разделе «Примеры», агонисты глюкагона по настоящему изобретению обладают повышенной биофизической стабильностью и растворимостью в водных растворах при физиологических значениях pH, и при этом сохраняют имеющуюся биологическую активность или демонстрируют даже более высокую биологическую активность в сравнении с нативным пептидом. Соответственно, считается, что агонисты глюкагона по настоящему изобретению будут приемлемы для любого варианта их использования, ранее описанного применительно к нативному пептиду глюкагона. В этой связи, модифицированные пептиды глюкагона по настоящему описанию могут использоваться для лечения гипогликемии, для повышения уровня глюкозы в крови, для индукции временного паралича кишки с целью радиологического исследования, для снижения и поддержания веса тела, в качестве дополнительной терапии в сочетании с инсулином или для лечения других метаболических нарушений, которые являются результатом низких уровней глюкагона в крови.

Как ожидается, пептиды глюкагона по настоящему описанию также будут применимы для снижения или поддержания веса тела, или для лечения гипергликемии, или для снижения уровня глюкозы в крови, или для нормализации уровня глюкозы в крови и/или для стабилизации уровня глюкозы в крови. Термин «нормализация» применительно к уровню глюкозы в крови означает, что уровень глюкозы в крови возвращается к нормальному значению (то есть, понижается уровень глюкозы в крови, если он был выше нормального, и повышается уровень глюкозы в крови, если он был ниже нормального значения). Термин «стабилизация» применительно к уровню глюкозы в крови означает снижение максимальных вариаций в уровне глюкозы в крови в течение определенного периода времени, например, в течение 8 часов, 16 часов, 24 часов, 2 дней, 3 дней, 4 дней, 5 дней, 6 дней или 1 недели. Так, например, введение пептида глюкагона приводит, с течением времени, к поддержанию такого уровня глюкозы в крови, которое ближе к нормальному диапазону показателей глюкозы, чем те уровни, которые имеются без введения пептида глюкагона.

Пептиды глюкагона по настоящему изобретению могут вводиться отдельно или в сочетании с другими антидиабетическими средствами или средствами, применяемыми при лечении ожирения. Известные в данной области или находящиеся на стадии испытания антидиабетические средства включают инсулин, сульфонилмочевинные препараты, такие как толбутамид (Ориназа (Orinase)), ацетогексамид (Димелор (Dymelor)), толазамид (Толиназа (Tolinase)), хлорпропамид (Диабинез (Diabinese)), глипизид (Глукотрол (Glucotrol)), глибурид (Диабета, Микроназа, Глиназа (Diabeta, Micronase, Glynase)), глимепирид (Амирил (Amaryl)) или гликлазид (диамикрон (Diamicron)); меглитиниды, такие как репаглинид (Прандин (Prandin)) или натеглинид (Старликс (Starlix)); бигуаниды, такие как метформин (Глюкофаж (Glucophage)) или фенформин; тиазолидиндионы, такие как розиглитазон (Авандия (Avandia)), пиоглитазон (Актоз (Actos)), или троглитазон (Резулин (Rezulin)) или другие ингибиторы PPARγ; ингибиторы альфа-глюкозидазы, которые ингибируют расщепление углеводов, такие как миглитол (Глизет (Glyset)), акарбоза (Прекоза/Глюкобай (Precose/Glucobay); эксенатид (Биэтта (Byetta)) или прамлинтид; ингибиторы дипептидилпептидазы-4 (DPP-4), такие как вилдаглиптин или ситаглиптин; ингибиторы SGLT (переносчик натрий-зависимой глюкозы 1); активаторы глюкокиназы (GKA); антагонисты рецептора глюкагона (GRA); или ингибиторы EBPазы (фруктозо-1,6-бифосфатазы).

Известные в данной области средства, применяемые для лечения ожирения, или находящиеся на стадии испытания средства соответствующего действия включают супрессоры аппетита, включающие стимуляторы фенетиламинового типа, фентермин (необязательно в сочетании с фенфлурамином или дексфенфлурамином), диэтилпропион (Тенуат® Tenuate®)), фендиметразин (Прелу-2®, Бонтрил® (Prelu-2®, Bontril®)), бензфетамин (Дидрекс® (Didrex®)), сибутрамин (Меридиа®, Редуктил® (Meridia®, Reductil®)); римонабант (Акомплиа® (Acomplia®)), другие антагонисты каннабиноидного рецептора; оксинтомодулин; гидрохлорид флуоксетина (Прозак (Prozac)); Кунекса (Qnexa) (топирамат и фентермин), Экскалия (Excalia) (бупропион и зонизамид) или Контрав (Contrave) (бупропион и налтрексон); или ингибиторы липазы, аналогичные ксениксалу (Орлистат (Orlistat)) или Цетилистату (Cetilistat) (также известный как ATL-962) или GT 389-255.

Один аспект настоящего изобретения относится к предварительно изготовленной композиции водного раствора агониста глюкагона по настоящему изобретению для применения его при лечении гипогликемии. Достигаемые при этом повышенная стабильность и/или растворимость водной композиции по настоящему описанию, позволяют делать уже готовую композицию водных растворов глюкагона для быстрого введения и лечения гипогликемии. Соответственно, согласно одному варианту, получают раствор, включающий агонист глюкагона по настоящему изобретению для введения пациенту с гипогликемией. В одном варианте, получают раствор, включающий ПЭГилированный агонист глюкагона по настоящему изобретению, для введения пациенту с гипогликемией, где общая молекулярная масса ПЭГ цепей, присоединенных к ПЭГилированному агонисту глюкагона, составляет от примерно 500 до примерно 5000 дальтон. В одном варианте осуществления настоящего изобретения, указанный ПЭГилированный агонист глюкагона включает пептид, выбранный из группы, состоящей из SEQ ED NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 и SEQ ID NO: 19 и соответствующих аналогов агониста глюкагона, где боковая цепь аминокислотного остатка в положении 16, 17, 21, 24 или 29, в пределах С-концевого расширения или по С-концевой аминокислоте в указанном пептиде глюкагона ковалентно присоединена к полиэтиленгликолевой цепи. В одном варианте, указанный ПЭГилированный агонист глюкагона включает пептид SEQ ID NO: 16, где аминокислотный остаток в положении 21 ковалентно присоединен к полиэтиленгликолю. В одном варианте, указанный ПЭГилированный агонист глюкагона включает пептид SEQ ID NO: 17, где аминокислотный остаток в положении 24 пептида ковалентно присоединен к полиэтиленгликолю.

Способы лечения по настоящему изобретению, применимые, без ограничения, к лечению гипогликемии, могут включать стадии введения описываемых в настоящей заявке агонистов глюкагона пациенту с использованием при этом любого стандартного режима введения, включая парентеральное введение, такое как внутривенное, внутрибрюшинное, подкожное или внутримышечное введение, интратекальное введение, трансдермальное введение, ректальное введение, пероральное введение, назальное введение или введение путем ингаляции. В одном варианте осуществления настоящего изобретения, указанную композицию вводят подкожно или внутримышечно. В одном варианте осуществления настоящего изобретения, указанную композицию вводят парентерально, при этом указанная композиция глюкагона была введена в шприц-тюбик. В другом варианте осуществления настоящего изобретения, композицию упаковывают в состав ингалятора или другого устройства, позволяющего доставлять аэрозольную форму лекарственного вещества. Преимуществом является тот факт, что в водной среде стабильные аналоги глюкагона по настоящему изобретению, в сравнении с нативным глюкагоном, обладают более высокой стабильностью и растворимостью в водных буферах в широком диапазоне значений pH, используемых для фармацевтических целей. Использование стабилизированных аналогов глюкагона по настоящему изобретению позволяет получать и хранить растворы агонистов глюкагона при физиологических значениях pH в течение длительного периода времени.

Авторы настоящего изобретения обнаружили, что возможно получение ПЭГилированных пептидов глюкагона, которые сохраняют биологическую активность и специфичность исходного пептида. Однако, увеличение длины ПЭГ цепи или присоединение множества цепей ПЭГ к пептиду, до достижения общей молекулярной массы присоединенного ПЭГ более чем 5000 дальтон, приводит к задержке начала действия модифицированного глюкагона. Согласно одному варианту осуществления настоящего изобретения, получают пептид глюкагона с последовательностью , SEQ ID NO: 11 или SEQ ID NO: 13 или соответствующий аналог указанного агониста глюкагона, где такой пептид включает одну или несколько полиэтиленгликолевых цепей, и при этом общая молекулярная масса присоединенного пептида превышает 5000 дальтон, а в одном варианте осуществления изобретения она становится более чем 10000 дальтон, но менее чем 40000 дальтон. Такие модифицированные пептиды глюкагона характеризуются задержкой начала активности, но не теряют при этом биологической активности. Соответственно, такие соединения могут вводиться с профилактической целью для пролонгирования периода действия введенного пептида глюкагона.

Пептиды глюкагона, которые были модифицированы за счет ковалентного присоединения ПЭГ цепи и которые имеют молекулярную массу более 10000 дальтон, могут вводиться в сочетании с инсулином для забуферивания активности инсулина, а также с целью поддержания стабильных уровней глюкозы в крови у диабетиков. Модифицированные пептиды глюкагона по настоящему изобретению могут вводиться совместно с инсулином в виде одной композиции, могут вводиться одновременно в виде отдельных растворов или, в альтернативном варианте, инсулин и модифицированный пептид могут вводиться в разное время относительно друг друга. В одном варианте осуществления настоящего изобретения, композиция, включающая инсулин, и композиция, включающая модифицированный пептид глюкагона, вводятся с интервалом 12 часов между введениями. Точное соотношение модифицированного пептида глюкагона к вводимому инсулину будет зависеть частично от уровня, определяемого у пациента глюкагона, и может быть оценена при проведении несложных экспериментальных процедур.

Согласно одному варианту осуществления настоящего изобретения, получают композицию, которая включает инсулин и модифицированный пептид глюкагона, выбранный из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 и соответствующих аналогов агонистов глюкагона, где указанный модифицированный пептид глюкагон также включает полиэтиленгликолевую цепь, ковалентно связанную с боковой цепью аминокислоты в положении 16, 17, 21, 24, 29, в пределах С-концевого расширения или по С-концевой аминокислоте. В одном варианте осуществления настоящего изобретения, указанная композиция представляет собой водный раствор, включающий инсулин и аналог глюкагона. В тех вариантах, где указанный пептид глюкагона включает последовательность SEQ ID NO: 11 или SEQ ID NO: 13, указанный пептид может также включать полиэтиленгликолевую цепь, ковалентно присоединенную к боковой цепи аминокислоты в положении 16, 17, 21, 24, 29, в пределах С-концевого расширения или по С-концевой аминокислоте. В одном варианте, молекулярная масса ПЭГ цепи в модифицированном пептиде глюкагона превышает 10000 дальтон. В одном варианте осуществления настоящего изобретения, ПЭГилированные пептид глюкагона включает пептид, выбранный из группы, состоящей из SEQ ID NO: 11 и SEQ ID NO: 13, где боковая цепь аминокислотного остатка в положении 21 или 24 указанного пептида глюкагона ковалентно присоединена к полиэтиленгликолевой цепи. В одном варианте, указанная полиэтиленгликолевая цепь имеет молекулярную массу от примерно 10000 до примерно 40000 дальтон.

В соответствии с одним вариантом осуществления настоящего изобретения, модифицированные пептиды глюкагон по настоящему изобретению используются для индукции временного паралича кишечного тракта. Этот способ применяется при радиологическом исследовании и включает стадии введения эффективного количества фармацевтической композиции, включающей ПЭГилированный пептид глюкагона, ПЭГилированный пептид глюкагона, включающий С-концевое расширение, или димер таких пептидов. В одном варианте, указанный пептид глюкагона включает последовательность, выбранную из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 и SEQ ID NO: 13. В одном варианте осуществления настоящего изобретения, указанный пептид глюкагона также включает ПЭГ цепь с массой от примерно 1000 до примерно 40000 дальтон, которая ковалентно присоединена к аминокислотному остатку в положении 21, 24 или 29, в пределах С-концевого расширения или по С-концевой аминокислоте. В одном варианте, указанный пептид глюкагона выбирают из группы, состоящей SEQ ED NO: 14, SEQ ID NO: 15, SEQ ID NO: 16 и SEQ ID NO: 17. В одном варианте осуществления настоящего изобретения, указанная ПЭГ цепь имеет молекулярную массу от примерно 500 до примерно 5000 дальтон.

В другом варианте осуществления настоящего изобретения, композиция, используемая для индукции временного паралича кишечного тракта, включает первый модифицированный пептид глюкагона и второй модифицированный пептид глюкагона, где первый модифицированный пептид включает последовательность, выбранную из группы, состоящей из SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 13, необязательно присоединенную к ПЭГ цепи с массой от примерно 500 до примерно 5000 дальтон, а второй пептид включает ковалентно присоединенную ПЭГ цепь с массой от примерно 10000 до примерно 40000 дальтон. В этом варианте, ПЭГ цепь каждого пептида ковалентно присоединена к аминокислотному остатку в положении 21, 24 или 29, в пределах С-концевого расширения или по С-концевой аминокислоте в соответствующем пептиде, и эти модификации не зависят друг от друга.

Было показано, что оксинтомодулин, природный пищеварительный гормон, обнаруженный в тонком кишечнике, вызывает потерю веса при введении крысам или человеку (см., Diabetes 2005; 54:2390-2395). Оксинтомодулин представляет собой пептид из 37 аминокислот, который содержит последовательность глюкагона из 20 аминокислот (т.е. SEQ ID NO: 1), за которой следует карбокси-концевое расширение из 8 аминокислот с последовательностью SEQ ID NO: 23 (KRNRNNIA). Соответственно, авторы полагают, что биологическая активность оксинтомодулина будет сохраняться (то есть останется его активность по подавлению аппетита и активность по индукции потери веса/поддержанию веса) при сопутствующем повышении растворимости и стабильности соединения и улучшении его фармокинетики, после замещения глюкагоновой части оксинтомодулина модифицированными пептидами глюкагона по настоящему изобретению. Дополнительно, авторы изобретения также считают, что усеченная молекула оксинтомодулина, включающая пептид глюкагона по настоящему изобретению, в котором удалены четыре концевые аминокислоты оксинтомодулина, будет также эффективна в направлении подавления аппетита и индукции потери веса/поддержания веса.

Соответственно, настоящее изобретение также относится к модифицированным пептидам глюкагона по настоящему изобретению, которые содержат карбокси-концевое расширение SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22. Согласно одному варианту осуществления настоящего изобретения, аналог агониста глюкагона с последовательностью SEQ ID NO: 33, также включающий аминокислотную последовательность SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22, присоединенную к аминокислоте 29 в пептиде глюкагона, вводят индивидуумам для индукции потери веса или для предупреждения набора веса. Согласно одному варианту осуществления настоящего изобретения, аналог агониста глюкагона с последовательностью SEQ ID NO: 11 или SEQ ID NO: 13, также включающий аминокислотную последовательность SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22, присоединенную к аминокислоте 29 в пептиде глюкагона, вводят индивидуумам для индукции потери веса или для предупреждения набора веса. В другом варианте, способ снижения набора веса или индукции потери веса у индивидуума включает введение эффективного количества композиции, содержащей агонист глюкагона, включающий пептид глюкагона, выбранный из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 или SEQ ID NO: 5, где аминокислота 29 в пептиде глюкагона присоединена ко второму пептиду через пептидную связь, второй пептид включает последовательность SEQ ID NO: 24 (KRNRNNIA) или SEQ ID NO: 25 и где ПЭГ цепь с массой от примерно 1000 до 40000 дальтон ковалентно присоединена к аминокислотному остатку в положении 21 и/или 24. В одном варианте, указанный сегмент пептида глюкагона в агонисте глюкагона выбирают из группы, состоящей из SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 и SEQ ID NO: 19, где ПЭГ цепь с массой от примерно 1000 до примерно 40000 дальтон ковалентно присоединена к аминокислотному остатку в положении 16, 17, 21, 24 или 29, в пределах С-концевого расширения или по С-концевой аминокислоте.

Эксендин-4 представляет собой пептид, состоящий из 39 аминокислот. Он является мощным стимулятором рецептора, известного как GLP-1. Сообщалось также, что данный пептид также подавляет аппетит и индуцирует снижение веса. Авторы настоящего изобретения обнаружили, что концевая последовательность эксендина-4, при введении ее на карбокси-конец глюкагона, повышает растворимость и стабильность глюкагона, не оказывая неблагоприятный эффект на биоактивность глюкагона. В одном варианте, десять концевых аминокислот эксендина-4 (то есть, последовательность SEQ ID NO: 20 (GPSSGAPPPS)) присоединяют к карбокси-концу пептида глюкагона по настоящему изобретению. В конкретных аспектах, последовательность SEQ ID NO: 20 присоединяют к С-концу пептида глюкагона, и аминокислота в положении 29 представляет собой Thr или Gly. Указанные слитые белки, как ожидается, будут обладать фармакологической активностью, направленной на подавление аппетита и индукцию потери веса/поддержание веса. В одном варианте осуществления настоящего изобретения, концевая аминокислота в расширении с последовательностью SEQ ID NO: 20 включает амидную группу вместо карбоксильной группы (то есть, SEQ ID NO: 23), и эту последовательность присоединяют к карбокси-концу пептида глюкагона по настоящему изобретению.

В одном варианте осуществления настоящего изобретения, способ снижения веса или индукции потери веса у индивидуума, включает введение эффективного количества композиции, включающей агонист глюкагона, содержащий пептид глюкагона с последовательностью SEQ ID NO: 33, где аминокислота 29 в пептиде глюкагона соединена со вторым пептидом через пептидную связь и указанный второй пептид включает последовательность SEQ ED NO: 20 (GPSSGAPPPS) или SEQ ID NO: 23. В одном варианте осуществления настоящего изобретения, указанный пептид глюкагона выбирают из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 и SEQ ID NO: 13, где аминокислота 29 в пептиде глюкагона связана со вторым пептидом через пептидную связь и где второй пептид включает последовательность SEQ ID NO: 20 (GPSSGAPPPS) или SEQ ID NO: 23. В одном варианте осуществления настоящего изобретения, указанный пептид глюкагона в агонисте глюкагона выбирают из группы, состоящей из SEQ ID NO: 11 и SEQ ID NO: 13. В одном варианте, указанный сегмент пептида глюкагона в слитом пептиде выбирают из группы, состоящей из SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16 и SEQ ID NO: 17, где ПЭГ цепь выбирают из ПЭГ цепей с молекулярной массой от 500 до 40000 дальтон. Более конкретно, в одном варианте, указанный пептид глюкагона в слитом пептиде выбирают из группы, состоящей из SEQ ID NO: 16 и SEQ ID NO: 17, где молекулярная масса выбранной ПЭГ цепи находится в диапазоне от 1000 до 5000 дальтон.

В другом варианте осуществления настоящего изобретения, композицию вводят пациенту для подавления аппетита, предупреждения набора веса и/или для индукции потери веса посредством введения фармацевтической композиции, включающей первый ПЭГилированный пептид глюкагона и второй ПЭГилированный пептид глюкагона, где первый и второй пептиды представляют собой слитые пептиды, включающие С-концевое расширение пептида, содержащее SEQ ID NO: 20 (GPSSGAPPPS) или SEQ ID NO: 23. Первый ПЭГилированный пептид глюкагона включает ковалентно присоединенную ПЭГ цепь массой от примерно 500 до примерно 10000 дальтон и второй ПЭГилированный пептид глюкагона включает ковалентно присоединенную ПЭГ цепь с массой от примерно 10000 до примерно 40000 дальтон.

Настоящее изобретение также относится к мультимерам модифицированных пептидов глюкагона по настоящему описания. Два или более модифицированных пептидов глюкагона могут быть связаны друг с другом с использованием стандартных связующих агентов, в рамках процедур, известных специалистам в данной области. Так, например, могут быть получены димеры из двух модифицированных пептидов глюкагона при использовании бифункциональных тиол-содержащих кросс-линкеров и бифункциональных содержащих аминогруппу кросс-линкеров, в особенности в случае пептидов глюкагона, которые имеют замещение остатками цестеина, лизина, орнитина, гимоцистеина или ацетилфенилаланина (например, SEQ ID NO: 4 и SEQ ID NO: 5). Указанный димер может представлять собой гомодимер или, в альтернативном варианте, это может быть гетеродимер. В одном варианте, указанный димер включает гомодимер в виде слитого пептида глюкагона, где пептидная часть глюкагона включает аналог агониста SEQ ID NO: 11 и аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенную к аминокислоте 29 в пептиде глюкагона. В другом варианте, указанный димер включает гомодимер в виде аналога агониста глюкагона с последовательностью SEQ ID NO: 11, где указанный пептид глюкагона также включает полиэтиленгликолевую цепь, ковалентно связанную с положением 21, 24 и 29, в пределах С-концевого расширения или по С-концевой аминокислоте в пептиде глюкагона.

Согласно одному варианту осуществления настоящего изобретения, получают димер, включающий первый пептид глюкагона, связанный со вторым пептидом глюкагона через линкер, где первый пептид глюкагона включает пептид, выбранный из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 и SEQ ID NO: 11, и где второй пептид глюкагона включает SEQ ID NO: 33. А что касается второго пептида глюкагона, то когда аминокислота в положении 28 представляет собой аспарагин, и аминокислота в положении 29 является треонином, второй пептид глюкагона также включает одну-две аминокислоты (независимо выбранные из группы, состоящей Lys, Arg, His, Asp или Glu), которые были добавлены к карбокси-концу второго пептида глюкагона, а также включает фармацевтически приемлемые соли указанных полипептидов глюкагона.

Согласно другому варианту осуществления настоящего изобретения, получают димер, включающий первый пептид глюкагона, связанный со вторым пептидом глюкагона через линкер, где указанный первый пептид глюкагона выбирают из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO:10, SEQ ID NO: 11, SEQ ID NO: 12 и SEQ ID NO: 13, а второй пептид глюкагона независимо выбирают из группы, состоящей из SEQ ID NO: 11 и SEQ ID NO: 13, а также включает фармацевтически приемлемые соли указанных полипептидов глюкагона. В одном варианте осуществления настоящего изобретения, первый пептид глюкагона выбирают из группы, состоящей из SEQ ID NO: 7, а второй пептид глюкагона независимо выбирают из группы, состоящей SEQ ID NO: 11, SEQ ID NO: 12 и SEQ ID NO: 13. В одном варианте, указанный димер получают из двух пептидов, где каждый пептид включает аминокислотную последовательность SEQ ID NO: 11.

Согласно одному варианту осуществления настоящего изобретения, получают фармацевтическую композицию, где указанная композиция включает аналог агониста глюкагона по настоящему изобретению или его фармацевтически приемлемую соль, а также фармацевтически приемлемый носитель. Указанная фармацевтическая композиция может включать любой фармацевтически приемлемый ингредиент, включающий, например, подкислители, добавки, адсорбенты, аэрозольные пропелленты, средства, вытесняющие воздух, подщелачивающие средства, ингибиторы слеживания, антикоагулянты, противомикробные консерванты, антиоксиданты, антисептические средства, основы, связующие вещества, забуферивающие средства, хелатирующие средства, средства, применяемые для нанесения покрытия, красящие вещества, осушители, детергенты, разбавители, дезинфицирующие средства, средства, способствующие разложению, диспергирующие агенты, средства, улучшающие растворение, красители, смягчители, эмульгаторы, стабилизаторы эмульсии, наполнители, пленкообразующие агенты, усилители вкуса, вкусовые вещества, средства, повышающие текучесть композиции, желирующие вещества, гранулирующие вещества, увлажнители, замасливатели, мукоадгезивные средства, основы для мазей, мази, маслянистые носители, органические основы, основы для пастилок, пигменты, пластификаторы, глянцующие средства, консерванты, секвестранты, усилители проникновения в кожу, солюбилизирующие средства, растворители, стабилизаторы, основы для суппозиториев, поверхностно-активные вещества, сурфактанты, суспендирующие средства, подсластители, терапевтические средства, загустители, тонизирующие вещества, токсичные агенты, усилители вязкости, водоабсорбирующие агенты, сорастворители, смешивающиеся с водой, смягчители воды или увлажняющие средства.

В некоторых вариантах осуществления настоящего изобретения, указанная фармацевтическая композиция включает следующие компоненты, один или несколько: аравийскую камедь, калий-ацесульфан, ацетилтрибутилцитрат, ацетилтриэтилцитрат, агар-агар, альбумин, спирт, дегидратированный спирт, денатурированный спирт, разбавленный спирт, алейретиновую кислоту, альгиновую кислоту, алифатические полиэфиры, глинозем, гидроксид алюминия, стеарат алюминия, аминопектин, α-амилозу, аскорбиновую кислоту, аскорбилпальмитат, аспартам, бактериостатическую воду для инъекций, бентонит, бентонитовую глину, хлорид бензалкония, хлорид бензетония, бензойную кислоту, бензиловый спирт, бензилбензоат, бронопол, бутилированный гидроксианизол, бутилированный гидрокситолуол, бутилпарабен, натрий-бутилпарабен, альгинат кальция, аскорбат кальция, карбонат кальция, цикламат кальция, двухосновный безводный фосфат кальция, двухосновный дегидратированный фосфат кальция, трехосновный фосфат кальция, пропионат кальция, силикат кальция, сорбат кальция, стеарат кальция, сульфат кальция, полугидрат сульфата кальция, масло канолы, карбомер, диоксид углерода, кальций-карбоксиметилцеллюлозу, натрий-карбоксиметилцеллюлозу, β-каротин, каррагенан, касторовое масло, гидрогенизированное касторовое масло, катионный эмульгирующий воск, ацетат целлюлозы, ацетат-фталат целлюлозы, этилцеллюлозу, микрокристаллическую целлюлозу, порошковую целлюлозу, кремний-содержащую микрокристаллическую целлюлозу, натрий-карбоксиметилцеллюлозу, цетостеариловый спирт, цетримид, цетиловый спирт, хлоргексидин, хлорбутанол, хлоркрезол, холестерин, ацетат хлоргексина, глюконат хлоргексина, гидрохлорид хлоргексина, хлордифторэтан (HCFC), хлордифторметан, хлорфторуглероды (CFC), хлорфеноксиэтанол, хлороксиленол, твердые компоненты кукурузного сиропа, безводную лимонную кислоту, моногидрат лимонной кислоты, какао-масло, красители, кукурузное масло, хлопковое масло, крезол, м-крезол, о-крезол, п-крезол, натрий-кроскармеллозу, кросповидон, цикламовую кислоту, циклодекстрины, декстраты, декстрин, декстрозу, безводную декстрозу, диазолидинил-мочевину, дибутилфталат, дибутилсебакат, диэтаноламин, диэтилфталат, дифторэтан (HFC), диметил-β-циклодекстрин, соединения циклодекстринового типа, такие как Каптизол® (Captisol®), диметиловый эфир, диметилфталат, эдентат дикалия, эдентат динатрия, гидрофосфат динатрия, докузат кальция, докузат калия, докузат натрия, додецилгаллат, бромид додецилтриметиламмония, эдентат кальция-динатрия, эдтиновую кислоту, эглумин, этиловый спирт, этилцеллюлозу, этилгаллат, этиллаурат, эталмальтол, этилолеат, этилпарабен, калий-этилпарабен, натрий-этилпарабен, этилванилин, фруктозу, жидкую фруктозу, измельченную фруктозу, беспирогенную фруктозу, порошковую фруктозу, фумаровую кислоту, желатин, глюкозу, жидкую глюкозу, смеси глицеридов насыщенных жирных кислот овощей, глицерин, глицерилбегенат, глицерилмоноолеат, глицерилмоностеарат, самоэмульгирующийся глицерилмоностеарат, глицерилпальмитостеарат, глицин, гликоли, гликофурол, гуаровую камедь, гептафторпропан (HFC), бромид гексадецилтриметиламмония, сироп фруктозы высокой вязкости, человеческий сывороточный альбумин, углеводороды (HC), разбавленную хлористоводородную кислоту, гидрогенизированное растительное масло типа II, гидроксиэтилцеллюлозу, 2-гидроксиэтил-β-циклодекстрин, гидроксипропилцеллюлозу, низкозамещенную гидроксипропилцеллюлозу, 2-гидроксипропил-β-циклодекстрин, гидроксипропилметилцеллюлозу, фталат гидроксипропилметилцеллюлозы, имидомочевину, индигокармин, ионообменники, оксиды железа, изопропиловый спирт, изопропилмиристат, изопропилпальмитат, изотонический солевой раствор, каолин, молочную кислоту, лактит, лактозу, ланолин, ланолиновые спирты, безводный ланолин, лецитин, силикат магния-алюминия, карбонат магния, нормальный карбонат магния, безводный карбонат магния, гидроксид карбоната магния, гидроксид магния, лаурилсульфат магния, оксид магния, силикат магния, стеарат магния, трисиликат магния, безводный трисиликат магния, яблочную кислоту, солод, мальтит, раствор мальтита, мальтодекстрин, мальтол, мальтозу, маннит, триглицериды со средней длиной цепи, меглумин, ментол, метилцеллюлозу, метилметакрилат, метилолеат, метилпарабен, калий-метилпарабен, натрий-метилпарабен, микрокристаллическую целлюлозу и натрий-карбоксиметилцеллюлозу, минеральное масло, легкое минеральное масло, минеральное масло и ланолиновые спирты, масло, оливковое масло, моноэтаноламин, монтмориллонит, октилгаллат, олеиновую кислоту, пальмитиновую кислоту, парафин, арахисовое масло, вазелин, вазелин и ланолиновые спирты, фармацевтическую глазурь, фенол, сжиженный фенол, феноксиэтанол, феноксипропанол, фенилэтиловый спирт, фенилмеркуриацетата, фенилмеркуриборат, фенилмеркуринитрат, полакрилин, калий-полакрилин, полоксамер, полидекстрозу, полиэтиленгликоль, полиэтиленоксид, полиакрилаты, блок-сополимеры полиэтилена-полиоксипропилена, полиметакрилаты, полиоксиэтиленалкиловые эфиры, полиоксиэтиленовые производные касторового масла, сложные эфиры полиоксиэтиленсорбита и жирной кислоты, стеараты полиоксиэтилена, поливиниловый спирт, поливинилпирролидон, альгинат калия, бензоат калия, бикарбонат калия, бисульфит калия, хлорид калия, цитрат калия, безводный цитрат калия, гидрофосфат калия, метабисульфит калия, одноосновный фосфат калия, пропионат калия, сорбат калия, повидон, пропанол, пропионовую кислоту, пропиленкарбонат, пропиленгликоль, альгинат пропиленгликоля, пропилгаллат, пропилпарабен, калий-пропилпарабен, натрий-пропилпарабен, протаминсульфат, рапсовое масло, раствор Рингера, сахарин, сахарин-аммоний, кальций-сахарин, натрий-сахарин, сафлоровое масло, сапонит, сывороточные белки, кунжутное масло, коллоидный силикагель, коллоидный диоксид кремния, альгинат натрия, аскорбат натрия, бензоат натрия, бикарбонат натрия, бисульфит натрия, хлорид натрия, безводный цитрат натрия, дегидрат цитрата натрия, хлорид натрия, цикламат натрия, эдентат натрия, додецилсульфат натрия, лаурилсульфат натрия, метабисульфит натрия, фосфат натрия двухосновный, фосфат натрия одноосновный, фосфат натрия трехосновный, безводный пропионат натрия, пропионат натрия, сорбат натрия, натрий-крахмал-гликолят, стеарилфумарат натрия, сульфит натрия, сорбиновую кислоту, сложные эфир сорбитана (сложные эфиры сорбитана и жирной кислоты), сорбит, 70% раствор сорбита, соевое масло, спермацетовый воск, крахмал, кукурузный крахмал, картофельный крахмал, предварительно желированный крахмал, стерилизуемый кукурузный крахмал, стеариновую кислоту, очищенную стеариновую кислоту, стеариловый спирт, сахарозу, сахара, прессованный сахар, кондитерский сахар, сферы кристаллов сахара, инвертированный сахар, Sugartab, желтый краситель Sunset Yellow FCF, синтетический парафин, тальк, винную кислоту, тартразин, тетрафторэтан (HFC), какао-масло, тимеросал, диоксид титана, альфа-токоферол, токоферилацетат, сукцинат альфа-токофериловой кислоты, бета-токоферол, дельта-токоферол, гамма-токоферол, трагакант, триацетин, трибутилцитрат, триэтаноламин, триэтилцитрат, триметил-β-циклодекстрин, бромид триметилтетрадециламмония, трис-буфер, эдентат тринатрия, ванилин, гидрогенизированное растительное масло типа I, воду, мягкую воду, жесткую воду, воду, не содержащую диоксид углерода, беспирогенную воду, воду для инъекций, стерильную воду, воду для ингаляций, стерильную воду для инъекций, стерильную воду для орошения, воски, анионный и эмульгирующий воск, карнаубский воск, катионный эмульгирующий воск, воск, сложный цетиловый эфир воска, микрокристаллический воск, неионный эмульгирующий воск, воск для суппозиториев, белый воск, желтый воск, белый вазелин, ланолин, ксантановую камедь, ксилит, зеин, пропионат цинка, соли цинка, стеарат цинка или любые эксципиенты, описанные в руководстве Handbook of Pharmaceutical Excipients, Third Edition, A. H. Kibbe (Pharmaceutical Press, London, UK, 2000), включенном в настоящее описание полностью в качестве ссылки, где приведены различные компоненты, используемые при изготовлении фармацевтически приемлемых композиций, а также известные известные методики их получения. Рассматривается применение любого стандартного средства в составе фармацевтических композиций, за исключением средств, которые несовместимы с фармацевтическими композициями. В рассматриваемые композиции могут быть также включены добавочные активные ингредиенты.

Фармацевтические композиции по настоящему изобретению могут быть изготовлены в форме композиций короткого действия, композиций с быстрым высвобождением, длительно действующих композиций или композиций с пролонгированным высвобождением, как будет описано ниже. Фармацевтические композиции могут быть также изготовлены для целей быстрого высвобождения, контролируемого высвобождения или для целей медленного высвобождения. Фармацевтические композиции по настоящему изобретению могут также включать, например, мицеллы или липосомы, или другую инкапсулированную форму, или могут быть введены в форме композиции с длительным высвобождением, с тем чтобы обеспечить пролонгированное хранение и/или пролонгированный эффект доставки. Рассматриваемые фармацевтические композиции могут вводиться в рамках любого режима введения, включающего, например, ежедневное введение (1 раз в день, 2 раза в день, 3 раза в день, 4 раза в день, 5 раз в день, 6 раз в день), введение каждые два дня, каждые три дня, каждые четыре дня, каждые пять дней, каждые шесть дней, еженедельное введение, введение каждые две недели, каждые три недели, ежемесячное введение или введение каждые два месяца.

В некоторых вариантах осуществления настоящего изобретения, указанные выше один или несколько компонентов могут присутствовать в фармацевтической композиции в любой концентрации, такой как примерно, по меньшей мере А, где А равно 0,0001% (вес/объем), 0,001% (вес/объем), 0,01% (вес/объем), 0,1% (вес/объем), 1% (вес/объем), 2% (вес/объем) , 5% (вес/объем), 10% (вес/объем), 20% (вес/объем), 30% (вес/объем), 40% (вес/объем), 50% (вес/объем), 60% (вес/объем), 70% (вес/объем), 80% (вес/объем) или 90% (вес/объем). В некоторых вариантах осуществления настоящего изобретения, указанные выше один или несколько компонентов могут присутствовать в составе фармацевтической композиции в любой концентрации, такой, как например, максимальная концентрация B, где B составляет 90% (вес/объем), 80% (вес/объем), 70% (вес/объем), 60% (вес/объем), 50% (вес/объем), 40% (вес/объем), 30% (вес/объем), 20% (вес/объем), 10% (вес/объем), 5% (вес/объем), 2% (вес/объем), 1% (вес/объем), 0,1% (вес/объем), 0,001% (вес/объем) или 0,0001% (вес/объем). В некоторых вариантах, один или несколько указанных выше компонентов могут присутствовать в составе фармацевтической композиции в любом диапазоне концентраций, таком как, например, от примерно А до примерно B. В некоторых вариантах, А равно 0,0001% и B равно 90%.

Фармацевтические композиции могут быть изготовлены с целью достижения в них физиологически приемлемого значения pH. В некоторых вариантах осуществления настоящего изобретения, pH данной фармацевтической композиции может составлять по меньшей мере 5, по меньшей мере 5,5, по меньшей мере 6, по меньшей мере 6,5, по меньшей мере 7, по меньшей мере 7,5, по меньшей мере 8, по меньшей мере 8,5, по меньшей мере 9, по меньшей мере 9,5, по меньшей мере 10 или по меньшей мере 10,5, вплоть до pH 11, в зависимости от особенностей такой композиции и способа введения. В некоторых вариантах осуществления настоящего изобретения, указанные фармацевтические композиции могут включать один или несколько забуферивающих агентов для достижения физиологически приемлемого pH. Указанные забуферивающие средства могут включать любые соединения, способные поддерживать буферный эффект при желательном значении pH, такие как, например, фосфатные буферы (например, ФБР), буферы на основе триэтаноламина, Трис-буфер, бицина, TAPS буфер, трицина, HEPES, TES, MOPS, PIPES, какодилатный буфер, MES и другие. В некоторых вариантах осуществления настоящего изобретения, концентрация буфера составляет по меньшей мере 0,5 мМ, по меньшей мере 1 мМ, по меньшей мере 10 мМ, по меньшей мере 20 мМ, по меньшей мере 30 мМ, по меньшей мере 40 мМ, по меньшей мере 50 мМ, по меньшей мере 60 мМ, по меньшей мере 70 мМ, по меньшей мере 80 мМ, по меньшей мере 90 мМ, по меньшей мере 100 мМ, по меньшей мере 120 мМ, по меньшей мере 150 мМ или по меньшей мере 200 мМ. В некоторых вариантах, сила указанного буфера не превышает 300 мМ (например, составляет максимум 200 мМ, максимум 100 мМ, максимум 90 мМ, максимум 80 мМ, максимум 70 мМ, максимум 60 мМ, максимум 50 мМ, максимум 40 мМ, максимум 30 мМ, максимум 20 мм, максимум 10 мМ, максимум 5 мМ, максимум 1 мМ).

В одном варианте осуществления настоящего изобретения, указанная фармацевтическая композиция включает аналог агониста глюкагона в концентрации 1 мг/мл и 10-50 мМ триэтаноламина при pH 7,0-8,5, или 6-9, или 7-9. В одном варианте осуществления настоящего изобретения, указанная фармацевтическая композиция включает аналог агониста глюкагона в концентрации 1 мг/мл и 20 мМ триэтаноламина при pH 8,5.

Согласно одному варианту, модифицированные пептиды глюкагона на настоящему изобретению могут быть получены в виде части набора. В одном варианте, изготавливают набор для введения агониста глюкагона пациенту, при необходимости такого введения, где указанный набор включает любой из пептидов глюкагона по настоящему изобретению в водном растворе. Репрезентативные пептиды глюкагона, которые могут вводиться в состав таких наборов, включают пептид глюкагона, выбранный из группы, состоящей из 1) пептида глюкагона, который включает последовательности SEQ ID NO: 7, SEQ ID NO: 10, SEQ ID NO: 11 или SEQ ID NO: 13 или SEQ ID NO: 33; 2) слитого пептида глюкагона, который включает аналог агониста глюкагона с последовательностью SEQ ID NO: 11 или SEQ ID NO: 13 или SEQ ID NO: 33, и аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенную к аминокислоте 29 в пептиде глюкагона; и 3) ПЭГилированный пептид глюкагона с последовательностью SEQ ID NO: 11 или SEQ ID NO: 13 или SEQ ID NO: 33, который также включает аминокислотную последовательность SEQ ID NO: 20 (GPSSGAPPPS), SEQ ID NO: 21 (KRNRNNIA) или SEQ ID NO: 22 (KRNR), присоединенную к аминокислоте 29 в пептиде глюкагона, где ПЭГ цепь ковалентно присоединена к положению 16, 17, 21, 24 или 29, в пределах С-концевого расширения или по С-концевой аминокислоте и имеет молекулярную массу от примерно 500 до примерно 40000 дальтон. В одном варианте осуществления настоящего изобретения, указанный набор включает устройство, предназначенное для введения композиции глюкагона пациенту, такое как, например, шприц с иглой, шприц-тюбик, струйный инжектор или другой безыгольный инжектор. Указанный набор может включать, альтернативно или в дополнение, один или несколько контейнеров, из числа возможных, такие как, например, флаконы, пробирки, бутылки, однокамерные или многокамерные шприцы-тюбики, картриджи, насосы для инфузии (наружные или имплантированные), струйные инжекторы, заполненные шприцы-ручки и т.п., необязательно содержащие пептид глюкагона в лиофилизированной форме или в виде водного раствора. Предпочтительно, указанные наборы также включают инструкции по применению. Согласно одному варианту осуществления настоящего изобретения, указанное устройство в данном наборе представляет собой аэрозольный диспенсер, где указанная композиция введена в состав этого аэрозольного устройства. В другом варианте, указанный набор включает шприц и иглу, и в еще одном варианте стерильная композиция глюкагона предварительно вводится в шприц.

Соединения по настоящему изобретению могут быть изготовлены в рамках стандартных методов синтеза, с использованием технологии рекомбинантных ДНК или других способов получения пептидов и слитых белков. Несмотря на то, что некоторые неприродные аминокислоты не могут быть экспрессированы с использованием стандартной технологии рекомбинантных ДНК, методы их получения, тем не менее, известны в данной области. Те соединения на настоящему изобретению, которые относятся к непептидным частям, могут быть синтезированы с использованием известных реакций органической химии, в дополнение к стандартным реакциям пептидной химии, где это применимо.

ПРИМЕРЫ

Основной протокол синтеза:

Аналоги глюкагона синтезировали в реакции одностадийного сочетания с использованием HBTU-активированной «Fast Boc», начиная от 0,2 ммоль Boc Thr(OBzl)Pam смолы на модифицированном пептидном синтезаторе Applied Biosystcm 430A. Boc-модифицированные аминокислоты и HBTU получали от компании Midwest Biotech (Fishers, IN). защитные группы для боковой цепи включали следующие: Arg(Tos), Asn(Xan), Asp(OcHex), Cys(pMeBzl), His(Bom), Lys(2Cl-Z), Ser(OBzl), Thr(OBzl), Tyr(2Br-Z) и Trp(CHO). Для защита боковой цепи на N-концевой His использовали группу Boc.

Каждую готовую пептидильную смолу обрабатывали раствором 20% пиперидина в диметилформамиде для удаления формильной группы из триптофана. Проводили расщепление жидким фторидом водорода в присутствии п-крезола и диметилсульфида. Расщепление проводили в течение одного часа в ледяной бане с использованием аппарата HF (Penninsula Labs). Полученный после выпаривания HF остаток суспендировали в диэтиловом эфире и отфильтровывали твердый материал. Каждый пептид экстрагировали 30-70 мл водной уксусной кислоты и разбавленные аликвоты анализировали методом ВЭЖХ [Beckman System Gold, 0,46×5 см Zorbax C8, 1 мл/мин, 45°С, 214 нм, A буфер=0,1% ТФУ, B=0,1% ТФУ/90% ацетонитрил, градиент от 10% до 80%, B в течение 10 минут].

Очистку проводили в системе для жидкостной хроматографии с быстрым разрешением FPLC на колонке Kromasil С18 размером 2,2×25 см с мониторингом в УФ свете при длине волны 214 нм, собирая фракции в течение 5 минут. Гомогенные фракции объединяли и лиофилизировали с получением продукта с чистотой более 95%. Корректность молекулярной массы полученного продукта и его чистоту подтверждали с использованием MALDI-масс-спектрального анализа.

Основные протоколы ПЭГилирования: (Cys-малеимидо группы)

В типичном случае Cys аналог глюкагона растворяют в фосфатно-буферном растворе (5-10 мг/мл) и добавляют 0,01 М этилендиаминтетрауксусной кислоты (10-15% от общего объема). Добавляют избыток (2-кратный) малеимидометоксиПЭГ реагента (Nektar), и реакционную смесь перемешивают при комнатной температуре, проводя мониторинг реакции по результатам ВЭЖХ анализа. Через 8-24 часа реакционную смесь подкисляют и вносят в колонку для препаративной хроматографии с обращением фазы для очистки, с использованием градиента 0,1% ТФУ/ацетонитрил. Соответствующие фракции объединяют и лиофилизируют с получением желательных ПЭГилированных аналогов.

ПРИМЕР 1

Синтез глюкагона-Cys 17 (1-29) и аналогичных моноCys аналогов

В реакционный сосуд на 60 мл вносили 0,2 ммоль Boc Thr(OBzl) Pam смолы (SynChem Inc), затем указанную ниже последовательность и в модифицированном пептидном синтезаторе Applied Biosystems 430A проводили FastBoc HBTU-активизируемые одностадийные реакции сочетания.

HSQGTFTSDYSKYLDSCRAQDFVQWLMNT (SEQ ID NO: 27)

Используют указанные ниже защитные группы для боковой цепи: Arg(Tos), Asp(OcHex), Asn(Xan), Cys(pMeBzl), Glu(OcHex), His(Boc), Lys(2Cl-Z), Ser(Bzl), Thr(Bzl), Trp(CHO) и Tyr(Br-Z). Подготовленную пептидильную смолу обрабатывали 20% пиперидином/диметилформамидом для удаления Trp-формильных защитных групп и затем переносили в реакционный сосуд с HF и сушили в вакууме. Добавляли 0,1 мл п-крезола и 0,5 мл диметилсульфида с использованием для обработки магнитной мешалки. Реакционный сосуд подсоединяли к аппарату HF (Pennisula Labs), который был охлажден в бане с сухим льдом/метанолом, откачивали воздух и конденсировали примерно 10 мл жидкого фторида водорода. Реакционную смесь перемешивали в ледяной бане в течение 1 часа и затем в вакууме удаляли HF. Остаток суспендировали в этиловом эфире, твердые вещества отфильтровывали, промывали, и пептид экстрагировали 50 мл водной уксусной кислоты. Проводили аналитическую ВЭЖХ [0,46×5 см Zorbax C8, 1 мл/мин, 45°С, 214 нм, A буфер - 0,1% ТФУ, B буфер - 0,1% ТФУ/90% ацетонитрила, градиент = от 10%, B до 80% в течение 10 мин] с использованием небольшого образца расщепленного экстракта. Оставшийся экстракт наносили на препаративную колонку с обращением фазы размером 2,2×25 см Kromasil C18 и проводили элюцию градиентом ацетонитрила с использованием системы Pharmacia FPLC. Собирали фракции в течение 5 минут, отслеживая поглощение в УФ при длине волны 214 нм (2,0 A). A=0,1% ТФУ, B=0,1% ТФУ/50% ацетонитрила. Градиент = от 30% B до 100% B в течение 450 минут.

Фракции, содержащие самый чистый продукт, объединяли, с замораживанием и лиофилизировали, получая 30,1 мг продукта. Анализ данного продукта методом ВЭЖХ продемонстрировал чистоту >90%, а MALDI-масс спектральный анализ показал, что продукт имеет желательную массу, а именно: 3429,7. Аналогичным образом получают Глюкагон Cys21, Глюкагон Cys24 и Глюкагон Cys29.

ПРИМЕР 2

Синтез Глюкагон-Cex и других аналогов с С-концевым расширением

В реакционный сосуд объемом 60 мл вносили 285 мг (0,2 ммоль) метоксибензгидриламиновой смолы (Midwest Biotech) и указанную ниже последовательность и в модифицированном пептидном синтезаторе Applied Biosystems 430A проводят FastBoc HBTU-активизируемые одностадийные реакции сочетания.

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTGPSSGAPPPS (SEQ ID NO: 28)

Использовали следующие защитные группы для боковых цепей аминокислот: Arg(Tos), Asp(OcHex), Asn(Xan), Cys(pMeBzl), Glu(OcHex), His(Boc), Lys(2Cl-Z), Ser(Bzl), Thr(Bzl), Trp(CHO) и Tyr(Br-Z). Готовую пептидильную смолу обрабатывали 20% пиперидином/диметилформамидом для удаления Trp-формильных защитных групп и затем переносили в реакционный сосуд с HF и сушили в вакууме. Добавляли 0,1 мл п-крезола и 0,5 мл диметилсульфида и перемешивали на магнитной мешалке. Реакционный сосуд подсоединяли к аппарату HF (Pennisula Labs), который был охлажден в бане с сухим льдом/метанолом, откачивали воздух и конденсировали примерно 10 мл жидкого фторида водорода. Реакционную смесь перемешивали на ледяной бане в течение 1 часа и затем HF удаляли в вакууме. Остаток суспендировали в диэтиловом эфире, твердые вещества отфильтровывали, промывали эфиром и пептид экстрагировали 50 мл водной уксусной кислотой. Проводили аналитическую ВЭЖХ [0,46×5 см Zorbax C8, 1 мл/мин., 45°С, 214 нм, A буфер - 0,1% ТФУ, B буфер - 0,1% ТФУ/90% ацетонитрила, градиент = от 10%, B до 80% B в течение 10 мин] на аликвоте расщепленного экстракта. Указанный экстракт наносили на препаративную колонку с обращением фаз 2,2×25 см Kromasil C18 и проводили элюцию градиентом ацетонитрила в системе Pharmacia FPLC. Собирали фракции в течение 5 минут, отслеживая поглощение в УФ при длине волны 214 нм (2,0 A). A=0,1% ТФУ, B=0,1% ТФУ/50% ацетонитрила. Градиент = от 30% B до 100% B в течение 45 минут. Фракции 58-65 объединяли, замораживали и лиофилизировали с получением 198,1 мг продукта.

ВЭЖХ анализ полученного продукта показал чистоту более 95%. MALDI-масс-спектральный анализ показал, что продукт имеет желательную расчетную массу 4316,7, что соответствует наличию С-концевого амида. Аналогичным образом получали оксинтомодулин и оксинтомодулин-KRNR в виде С-концевых карбоновых кислот, начиная реакцию с соответствующим образом подготовленной PAM-смолы.

ПРИМЕР 3

Глюкагон Cys 17 Mal-PEG-5K

15,1 мг глюкагон-Cys17(l-29) и 27,3 мг метокси-поли(этиленгликоль)малеимида со средним значением М.в. 5000 (mPEG-Mal-5000, Nektar Therapeutics) растворяли в 3,5 мл фосфатно-буферного раствора (ФБР) и добавляли 0,5 мл 0,01M этилендиаминтетрауксусной кислоты (ЭДТА). Реакционную смесь перемешивали при комнатной температуре и отслеживали ход реакции по результатам ВЭЖХ анализа [0,46×5 см Zorbax C8, l мл/мин, 45°C, 214 нм (0,5A), A=0,1% ТФУ, B=0,1% ТФУ/90% ацетонитрил, градиент = от 10% B до 80% B в течение 10 минут].

Через 5 часов реакционную смесь наносили на препаративную колонку с обращением фаз 2,2×25 см Kromasil С18. Проводили элюцию градиентом ацетонитрила в системе Pharmacia FPLC, отслеживая поглощение в УФ области при длине волны 214 нм, и собирали фракции в течение 5 минут. A=0,1% ТФУ, B=0,1% ТФУ/90% ацетонитрил, градиент = от 10% B до 80% B в течение 450 минут. Фракции, соответствующие нужному продукту, объединяли, замораживали и лиофилизировали с получением 25,9 мг продукта.

Указанный продукт анализировали методом ВЭЖХ [0,46×5 см Zorbax C8, l мл/мин, 45°C, 214 нм (0,5A), A=0,1% ТФУ, B=0,1% ТФУ/90% ацетонитрил, градиент = от 10% B до 80% B в течение 10 минут], результаты которого показали чистоту примерно 90%. MALDI (лазерная ионизация и десорбция из матрицы) масс-спектральный анализ продемонстрировал широкий разброс масс (что типично для производных PEG), в диапазоне от 8700 до 9500. Эти данные указывают на увеличение массы исходного пептида глюкагона (3429) примерно на 5000 единиц атомной массы.

ПРИМЕР 4

Глюкагон-Cys 21 Mal-PEG-5K

21,6 мг глюкагона Cys21(l-29) и 24 мг mPRG-MAL-5000 (Nektar Therapeutics) растворяли в 3,5 мл фосфатно-буферного раствора (ФБР) и добавляли 0,5 мл 0,01M этилендиаминтетрауксусной кислоты (ЭДТА). Реакционную смесь перемешивали при комнатной температуре. Через 2 часа вносили дополнительную порцию 12,7 мг mPEG-MAL-5000. Через 8 часов реакционную смесь наносили на препаративную колонку с обращением фаз размером 2,2×25 см Vydac С18 и проводили элюцию градиентом ацетонитрила в системе Pharmacia FPLC со скоростью 4 мл/мин, собирая фракции в течение 5 минут. A=0,1% ТФУ, B=0,1% ТФУ/50% ацетонитрил, градиент = от 20% B до 80% B в течение 450 минут.

Фракции, соответствующие по виду нужному продукту, объединяли, замораживали и лиофилизировали с получением 34 мг продукта. Анализ полученного продукта методом аналитической ВЭЖХ [0,46×5 см Zorbax C8, l мл/мин, 45°C, 214 нм (0,5A), A=0,1% ТФУ, B=0,1% ТФУ/90% ацетонитрил, градиент = от 10% B до 80% B в течение 10 минут] показал наличие гомогенного продукта, который отличался от исходного пептида глюкагона. MALDI (лазерная ионизация и десорбция из матрицы) масс-спектральный анализ широкий разброс масс (что типично для производных PEG), в диапазоне от 8700 до 9700. Эти данные указывают на увеличение массы исходного пептида глюкагона (3470) примерно на 5000 единиц атомной массы.

ПРИМЕР 5

Глюкагон-Cys 24 Mal-PEG-5K

20,1 мг глюкагона C24(l-29) и 39,5 мг mPEG-Mal-5000 (Nektar Therapeutics) растворяли в 3,5 мл ФБР при перемешивании и добавляли 0,5 мл 0,01M ЭДТА. Реакционную смесь перемешивали при комнатной температуре в течение 7 часов, после чего добавляли 40 мг mPEG-Mal-5000. Примерно через 15 часов реакционную смесь наносили на препаративную колонку с обращением фаз 2,2×25 см Vydac C18 и проводили элюцию градиентом ацетонитрила в системе Pharmacia FPLC. В течение 5 минут собирали фракции, отслеживая поглощение в УФ области при длине волны 214 нм. (2,0A). A буфер = 0,1% ТФУ, B буфер -0,1% ТФУ/50% ацетонитрил, градиент = от 30% B до 100% B в течение 450 минут. Фракции, соответствующие продукту, объединяли, замораживали и лиофилизировали с получением 45,8 мг продукта. MALDI-масс-спектральный анализ продемонстрировал наличие широкого сигнала, типичного для ПЭГ с максимальным значением 9175,2, что превышало массу глюкагона-C24 (3457,8) примерно на 5000 единиц атомной массы.

ПРИМЕР 6

Глюкагон Cys 24 Mal-PEG-20K

25,7 мг глюкагона Cys24(l-29) и 40,7 мг mPEG-Mal-20K (Nektar Therapeutics) растворяли в 3,5 мл ФБР при перемешивании при комнатной температуре и добавляли 0,5 мл 0,01 M ЭДТА. Через 6 часов, по результатам ВЭЖХ анализа, соотношение исходного материалу к продукту составляло 60:40. Добавляли еще 25,1 мг mPEG-Mal-20K и реакционную смесь перемешивали еще в течение 16 часов. Поскольку доля продукта при этом существенно не возрастала, реакционную смесь наносили на препаративную колонку с обращением фаз 2,2×25 см Kromasil CI 8 и проводили очистку в системе Pharmacia FPLC с использованием градиента от 30% B до 100% B в течение 450 минут. A буфер = 0,1% ТФУ, B буфер - 0,1% ТФУ/50% ацетонитрил, скорость течения = 4 мл/мин, собирая фракции в течение 5 минут при мониторинге поглощения в УФ области при длине волны 214 нм (2,0 А). Фракции, содержащие гомогенный продукт, объединяли, замораживали и лиофилизировали с получением 25,7 мг. Чистота продукта, по результатам анализа методом аналитической ВЭЖХ, составляла примерно 90%. MALDI-масс-спектральный анализ продемонстрировал наличие широкого пика от 23000 до 27000, что соответствовало повышению массы продукта примерно на 20000 единиц атомной массы относительно массы исходного глюкагона C24 (3457,8).

ПРИМЕР 7

Глюкагон Cys 29 Mal-PEG-5K

20,0 мг глюкагона Cys29(l-29) и 24,7 мг mPEG-Mal-5000 (Nektar Therapeutics) растворяли в 3,5 мл ФБР при перемешивании при комнатной температуре и добавляли 0,5 мл 0,01M ЭДТА. Через 4 часа добавляли еще 15,6 мг mPEG-Mal-5000 для завершения реакции. Через 8 часов реакционную смесь наносили на препаративную колонку с обращением фаз размером 2,2×25 см Vydac CI8 и проводили элюцию градиентом ацетонитрила в системе Pharmacia FPLC. Собирали фракции в течение 5 минут, отслеживая поглощение в УФ области при длине волны 214 нм (2,0 А), A=0,1% ТФУ, B=0,1% ТФУ/50% ацетонитрил. Фракции, содержащие гомогенный продукт, объединяли, замораживали и лиофилизировали с получением 40,0 мг продукта, который отличался от восстановленного исходного материала, по данным ВЭЖХ анализа (фракции 58-63). Анализ продукта методом аналитической ВЭЖХ [0,46×5 см Zorbax C8, l мл/мин., 45°C, 214 нм (0,5A), A=0,1% ТФУ, B=0,1% ТФУ/90% ацетонитрил, градиент = от 10% B до 80% B в течение 10 минут] продемонстрировал чистоту свыше 95%. MALDI-масс-спектральный анализ показал наличие ПЭГ компонента с массой в диапазоне от 8000 до 10000 (максимальное значение 9025,3), что на 5540 единиц атомной массы превышало массу исходного материала (3483,8).

ПРИМЕР 8

Глюкагон Cys 24 (2-бутиролактон)

К 24,7 мг глюкагона Cys24(l-29) добавляли 4 мл 0,05 M бикарбоната аммония/50% ацетонитрила и 5,5 мкл раствора 2-бром-4-гидроксимасляной кислоты-γ-лактона (100 мкл в 900 мкл ацетонитрила). После 3 часов перемешивания при комнатной температуре добавляли еще 105 мкл раствора лактона к реакционной смеси, которую перемешивали еще 15 часов. Далее реакционную смесь разбавили до объема 10 мл 10% водной уксусной кислотой и нанесли на препаративную колонку с обращением фаз размером 2,2×25 см Kromasil C18. Провели элюцию градиентом ацетонитрила (от 20% B до 80% B в течение 450 минут) в системе Pharmacia FPLC, собирая фракции в течение 5 минут при отслеживании поглощения в УФ области при длине волны 214 нм (2,0A). Скорость течения =4 мл/мин, A=0,1% ТФУ, B=0,1% ТФУ/50% ацетонитрила. Фракции 74-77 объединяли, замораживали и лиофилизировали с получением 7,5 мг продукта. ВЭЖХ анализ продукта продемонстрировал чистоту 95%, а результаты MALDI-масс-спектрального анализа показали, что продукт имеет массу 3540,7, что на 84 единицы атомной массы было больше, чем масса исходного материала. Этот результат соответствует добавлению одного фрагмента бутилолактона.

ПРИМЕР 9

Глюкагон Cys 24 (карбоксиметил)

18,1 мг глюкагона Cys24(l-29) растворяли в 9,4 мл 0,1M натрий-фосфатного буфера (pH=9,2) и добавляли 0,6 мл раствора бромуксусной кислоты (1,3 мг/мл в ацетонитриле). Реакционную смесь перемешивали при комнатной температуре и отслеживали ход реакции по результатам аналитической ВЭЖХ. Через 1 час добавляли еще 0,1 мл раствора бромуксусной кислоты. Реакционную смесь перемешивали еще в течение 60 минут, затем подкисляли водной уксусной кислотой и наносили на препаративную колонку с обращением фаз размером 2,2×25 см Kromasil C18 для очистки. Проводили элюцию градиентом ацетонитрила в системе Pharmacia FPLC (скорость течения =4 мл/мин), собирая фракции в течение 5 минут и отслеживая поглощение в УФ области при длине волны 214 нм (2,0A). A=0,1% ТФУ, B=0,1% ТФУ/50% ацетонитрила. Фракции 26-29 объединяли, замораживали и лиофилизировали с получением нескольких мг продукта. ВЭЖХ анализ продукта показал чистоту 90%, а результаты MALDI-масс спектрального анализа подтвердили массу продукта, равную 3515, что соответствовало массе желательного продукта.

Молекулярная масса = 3515,87

Точная масса = 3512

Молекулярная формула = C153H224N42O50S2

SEQ ID NO: 30

ПРИМЕР 10

Глюкагон Cys 24 малеимидо, PEG-3,4K-димер

16 мг глюкагона Cys24 и 1,02 мг Mal-PEG-Mal-3400, поли(этиленгликоль)бис-малеимида со средним значением М.в. 3400 (Nektar Therpeutics) растворяли в 3,5 мл фосфатно-буферного раствора и добавляли 0,5 мл ЭДТА, после чего реакционную смесь перемешивали при комнатной температуре. Через 16 часов вносили еще 16 мг глюкагона-Cys24 и продолжали перемешивание. Примерно через 40 часов реакционную смесь наносили на колонку Pharmcia PepRPC 16/10 и проводили элюцию градиентом ацетонитрила в системе Pharmacia FPLC при сборе фракций в течение 2 минут и мониторинге поглощения в УФ области при длине волны 214 нм (2,0A). Скорость течения =2 мл/мин, A=0,1% ТФУ, B=0,1% ТФУ /50% ацетонитрила. Фракции 69-74 объединяли, замораживали и лиофилизировали с получением 10,4 мг продукта. Результаты аналитической ВЭЖХ продемонстрировали чистоту 90% , а MALDI-масс-спектральный анализ показал наличие компонента с массой в диапазоне 9500-11000, что соответствовало наличию желательного димера.

ПРИМЕР 11

Тесты на растворимость глюкагона

Получали раствор (l мг/мл или 3 мг/мл) глюкагона (или аналога) в 0,01н. HCl. 100 мкл концентрированного раствора разбавляли до 1 мл с использованием 0,01н. HC1 и определяли поглощение в УФ области (276 нм). Корректировали значение pH полученного раствора для хранения до pH 7 с использованием 200-250 мкл 0,1 M Na2HP04 (pH9,2). Раствор выдерживали в течение ночи при температуре 4°C и затем центрифугировали. Далее, 100 мкл разбавляли до объема 1 мл с использованием 0,01н. HC1 и определяли поглощение в УФ области (в двойном повторе).

Значение исходного поглощения компенсировали увеличением объема и использовали приведенный ниже расчет для определения процента растворимости:

Конечное поглощение/исходное поглощение×100 = процент растворимости

Полученные результаты показаны в Таблице 1, где глюкагон-Cex означает глюкагон дикого типа (SEQ ID NO: 1), плюс карбокси-концевое добавление SEQ ID NO: 20 и глюкагон-Cex R12 обозначает SEQ ID NO: 1, где остаток Lys в положении 12 замещен остатком Arg и добавлен пептид SEQ ID NO: 20 к карбокси-концу.

Таблица 1
Данные по растворимости аналогов глюкагона
Аналог Процент растворимости
Глюкагон
Глюкагон-Cex, R12
Глюкагон-Cex
Оксинтомодулин
Глюкагон Cys7PEG5K
Глюкагон Cys21PEG5K
Глюкагон Cys24PEG5K
16
104
87
104
94
105
133

Растворимость аналогов агонистов глюкагона D28, E29, E30, E15D28, D28E30 и D28E29 была исследована в рамках того же теста, что и в случае оценки соединений, перечисленных в Таблице 1. Полученные данные (показанные на фиг. 3 и 4) демонстрируют более высокую растворимость аналогов D28, E29, E30, E15D28, D28E30 и D28E29 относительно нативного глюкагона при значениях pH 5,5 и 7,0. На фиг. 3 приведенные результаты оценок через 60 часов выдерживания при температуре 25°C, тогда как данные, показанные на фиг. 4, относятся к растворимости, которую измеряли после 24 часов хранения при температуре 25°C и затем в течение 24 часов при температуре 4°C. На фиг. 5 показаны данные, относящиеся к максимальной растворимости аналогов глюкагона D28, D28E30 и E15D28.

ПРИМЕР 12

Тест на связывание рецептора глюкагона

Аффинность пептидов рецептора глюкагона оценивали в тесте на конкурентное связывание по процедуре сцинтилляционного анализа сближения. Делали серийные 3-кратные разведения пептидов в буфере для сцинтилляционного анализа сближения (0,05 M Трис-HCl, pH 7,5, 0,15 M NaCl, 0,1% (вес/объем) бычьего сывороточного альбумина) и перемешивали в 96-луночном планшете с белым/прозрачным дном (Corning Inc., Acton, MA), при добавлении в них 0,05 нМ (3-[125I]-йодотирозил) Tyr10 глюкагона (Amersham Biosciences, Piscataway, NJ), по 1-6 микрограмм на ячейку, фрагментов плазматических мембран, полученных из клеток, суперэкспрессирующих рецептор человеческого глюкагона, и 1 мг/лунку шариков, используемых в сцинтилляционном анализе на сближение, которые содержали агглютинин из зародышей пшеницы типа А, обработанных полиэитиленимином (Amersham Biosciences, Piscataway, NJ). При встряхивании в течение 5 минут со скоростью 800 об/мин в роторном шейкере, планшет инкубировали при комнатной температуре в течение 12 часов и затем определяли радиоактивность в жидкостном сцинтилляционном счетчике MicroBeta1450 (Perkin-Elmer, Wellesley, MA). Уровень радиоактивности, определяемой неспецифическим связыванием (NSB), измеряли в ячейках с 4-кратным уровнем концентрации «холодного» нативного лиганда, в сравнении с максимальной концентрацией в исследуемых образцах, и общий уровень связанной радиоактивности определяли в ячейках без конкурентного вещества. Процент специфического связывания вычисляли по следующей формуле:

Процент специфического связывания = ((связанная радиоактивность -NSB)/(общая связанная радиоактивность-NSB)) ×100. Показатели IC50 определяли с использованием программного обеспечения Origin (OriginLab, Northampton, MA).

ПРИМЕР 13

Функциональный тест - синтез цАМФ

Способность аналогов глюкагона индуцировать синтез цАМФ определяли в репортерном тесте на основе люциферазы светлячка. HEK293 клетки после совместной трансфекции рецептором глюкагона или рецептором GLP-1 и геном люциферазы, соединенные с цАМФ отзывчивым элементом, истощали по сыворотке при культивировании их в течение 16 часов в среде DMEM (Invitrogen, Carlsbad, CA) с добавкой 0,25% бычьей сыворотки (HyClone, Logan, UT) и затем инкубировали с серийными разведениями глюкагона, GLP-1 или новыми аналогами глюкагона в течение 5 часов при температуре 37°C, в атмосфере 5% CO2 в 96-луночных планшетах «Biocoat» с наслоенным поли-D-лизином (BD Biosciences, San Jose, СА). По окончании инкубации, к каждой лунке добавляли по 100 микролитров субстратного реагента для люминесцентного теста LucLite (Perkin-Elmer, Wcllesley, MA). Планшет, после краткосрочного встряхивания, инкубировали в течение 10 минут в темноте и свечение измеряли на жидкостном сцинтилляционном счетчике MicroBeta-1450 (Perkin-Elmer, Wellesley, MA). Люминесцентное свечение указывало на активацию репортерного гена люциферазы, который, в свою очередь, является мерой активации репортера. Вычисляли показатели эффективной 50% концентрации (EC50) с использованием программного обеспечения Origin (OriginLab, Northampton, MA). Результаты показаны в таблицах 2 и 3. Показатель ЕС50 представляет собой концентрацию пептида, которая вызывает ответ на уровне 50% от максимальной активации пептида для указанного репортера. Относительно меньший показатель ЕС50 указывал на то, что пептид является более мощным при данном репортере, тогда как более высокий показатель ЕС50 указывал на то, что данный пептид является менее эффективным.

Таблица 2
Индукция цАМФ аналогами глюкагона с С-концевым расширением
Пептид Индукция цАМФ
Рецептор глюкагона Рецептор GLP-1
EC50, нМ N* EC50, нМ N
Глюкагон 0,22±0,09 14 3,85±1,64 10
GLP-1 2214,00±182,43 2 0,04±0,01 14
Глюкагон Cex 0,25±0,15 6 2,75±2,03 7
Оксинтомодулин 3,25±1,65 5 2,53±1,74 5
Оксинтомодулин KRNR 2,77±1,74 4 3,21±0,49 2
Глюкагон R12 0,41±0,17 6 0,48±0,11 5
Глюкагон R12 Cex 0,35±0,23 10 1,25±0,63 10
Глюкагон R12K20 0,84±0,40 5 0,82±0,49 5
Глюкагон R12K24 1,00+0,39 4 1,25±0,97 5
Глюкагон R12K29 0,81±0,49 5 0,41±0,24 6
Амид глюкагона 0,26±0,15 3 1,90±0,35 2
Оксинтомодулин C24 2,54±0,63 2 5,27±0,26 2
Оксинтомодулин C24 PEG 20K 0,97±0,04 1 1,29±0,11 1
* - количество экспериментов
Таблица 3
Индукция цАМФ ПЭГилированными аналогами глюкагона
Пептид Индукция цАМФ
Рецептор глюкагона Рецептор GLP-1
ЕС50, нМ N* ЕС50, нМ N
Глюкагон 0,33±0,23 18 12,71±3,74 2
Глюкагон C17 PEG 5K 0,82±0,15 4 55,86±1,13 2
Глюкагон C21 PEG 5K 0,37±0,16 6 11,52±3,68 2
Глюкагон C24 PEG 5K 0,22±0,10 12 13,65±2,95 4
Глюкагон C29 PEG 5K 0,96±0,07 2 12,71±3,74 2
Глюкагон C24 PEG 20K 0,08±0,05 3 не определяли
Димер глюкагона C24 0,10±0,05 3 не определяли
GLP-1 >1000 0,05±0,02 4

* количество экспериментов

Данные по другим аналогам глюкагона показаны на фиг. 6-9 и в Таблице 4.

Таблица 4
Показатели ЕС50 (нМ), наблюдаемые в клетках, суперэкспрессирующих рецептор глюкагона
Тест 1 Тест 2 Тест 3 Тест 4
Стандарт глюкагона 0,12 0,04 0,05 0,11
K29 0,35 0,22
K30 0,22 0,06
K29, K30 0,89 0,05
K30, K31 0,12
D28 0,05 0,17
E28 0,14
E29 0,05 0,04
E30 0,04
D28, E29 0,05
D28, E30 0,15
D28, E15

На фиг. 11 проиллюстрированы данные по индукции цАМФ по рецепторам глюкагона и GLP-1 для аналога глюкагона со следующими модификациями: T16, A20, E21, A24, Nlc27, D28 и Е29 (SEQ ID NO: 56). Приведенные данные показывают, что аналог глюкагона, содержащий множественные модификации (семь замещений), сохраняет по существу активность глюкагона.

ПРИМЕР 14

Тест на стабильность Cys-малеимидо-ПЭГ-аналогов глюкагона

Каждый из анализируемых аналогов глюкагона растворяли в воде или ФБР и проводили исходный ВЭЖХ анализ. После коррекции значений pH (4, 5, 6, 7), образцы инкубировали в течение заданного периода времени при температуре 37°C и проводили повторный ВЭЖХ анализ для оценки целостности пептида. Определяли концентрацию искомого пептида и рассчитывали остаточный процент интактного пептида, в сравнении с данными исходного анализа. Результаты для глюкагона-Cys21-малеимидо PEG5K показаны на фиг. 1 и 2.

ПРИМЕР 15

Синтез лактамов глюкагона

285 мг (0,2 ммоль) метоксибензгидриламиновой смолы (Midwest Biotech) добавляли к реакционному сосуду объемом 60 мл и синтезировали указанную ниже последовательность на модифицированном пептидом синтезаторе Applied Biosystems 430A с использованием Boc DEPBT, активированного для проведения реакций одностадийного связывания.

Использовали следующие защитные группы для боковых цепей: Arg(Tos), Asp(OcHx), Asn(Xan), Glu(OFm), His(BOM), Lys(Fmoc), Ser(Bzl), Thr(Bzl), Trp(CHO), Tyr(Br-Z). В качестве репрезентативного примера, можно отметить использование Lys(Cl-Z) для защиты нативного остатка Lys в положении 12, когда лактамы конструировали на основе аминокислотных участков 16-20, 20-24 или 24-28. Полностью подготовленную пептидильную смолу обрабатывали 20% пиперидином/диметилформамидом в течение одного часа при перемешивании с вращением для удаления от Trp формильной группы, а также защитных групп Fmoc и OFm от Lys 12 и Glu16. После подтверждения, по результатам положительного нингидринового теста, удаления данных групп, смолу промывали диметилформамидом, дихлорметаном и затем снова диметилформамидом. Смолу обрабатывали 520 мг (1 ммоль) гексафторфосфата бензотриазол-1-ил-окси-трис-пирролидино-фосфония (PyBOP) в диметилформамиде и диизопропилэтиламине (DIEA). После 8-10 часов реакции проводили нингидриновый тест, отрицательный результат которого указывал на то, что циклизация была проведена. Смолу промывали диметилформамидом, затем дихлорметаном и далее обрабатывали трифторуксусной кислотой в течение 10 минут. Удаление Boc-групп подтверждали по результатам положительной нингидриновой реакции. Смолу промывали диметилформамидом и дихлорметаном и высушивали перед внесением в реакционный сосуд с фтористоводородной кислотой (HF). Добавляли 500 мкл п-крезола при перемешивании на магнитной мешалке. Реакционный сосуд подсоединяли к HF аппарату (Peninsula Labs), охлаждали на бане с сухим льдом/метанолом, откачивали воздух и конденсировали в сосуд приблизительно 10 мл жидкой фтористоводородной кислоты. Реакционную смесь перемешивали в течение 1 часа на ледяной бане и затем удаляли в вакууме HF. Остаток суспендировали в этиловом эфире, твердый материал отфильтровывали, промывали эфиром и пептид солюбилизировали с использованием 150 мл 20% ацетонитрила/1% уксусной кислоты. Методом аналитической ВЭЖХ, проводили анализ неочищенного солюбилизированного пептида в следующих условиях: [4,6×30 мм Xterra C8, 1,50 мл/мин, 220 нМ, A буфер - 0,1% ТФУ/10% ацетонитрил, B буфер - 0,1% ТФУ/100% ацетонитрил, градиент 5-95% B в течение 15 минут]. Экстракт разбавляли в два раза водой и наносили на препаративную колонку с обращением фаз 2,2×25 см Vydac C4 и проводили элюцию с использованием градиента ацетонитрила в системе Waters HPLC (A буфер - 0,1% ТФУ/10% ацетонитрил, В буфер - 0,1% ТФУ/10% ацетонитрил и градиент 0-100% В в течение 120 минут со скоростью течения 15,00 мл/мин). Результаты ВЭЖХ анализа очищенного пептида продемонстрировали более чем 95% чистоту, а результаты масс-спектрального анализа при ионизации электронапылением подтвердили массу 3506 Да, характерную для 12-16 лактама. Лактамы из 16-20, 20-24 и 24-28 готовили аналогичным образом.

ПРИМЕР 16

Репрезентативные пептиды

Пептиды глюкагона с указанными ниже последовательностями конструировали в основном так, как это было описано ранее:

XSQGTFTSDYSKYLDERRAKDFVC*WLMNT (лактам 16-20) (SEQ ID NO: 40)

где X=DMIA, C* обозначает Cys, присоединенный к ПЭГ

XSQGTFTSDYSKYLDERRAKDFVAWLMNC* (лактам 16-20) (SEQ ID NO: 41)

где X=DMIA, Q24A, C* обозначает Cys, присоединенный к ПЭГ

X1SQGTFTSDYSKYLDERRAKDFVC*WLX2NT (лактам 16-20) (SEQ ID NO: 42)

где X1=DMIA, X2 обозначает Nle или Leu, C* обозначает Cys, присоединенный к ПЭГ

X1SQGTFTSDYSKYLDERRAKDFVAWLX2NC* (лактам 16-20) (SEQ ID NO: 43)

где X1=DMIA, Q24A, X2 обозначает Nle или Leu, C* обозначает Cys, присоединенный к ПЭГ

Пептиды глюкагона с указанными ниже модификациями относительно SEQ ID NO: 1 конструировали в основном так, как это было описано ранее:

A20, A24, Nle27, D28 (SEQ ID NO: 44)

A20, A24, Nle27, D28, E29 (SEQ ID NO: 45)

A20, A24, Nle27, D28, E30 (SEQ ID NO: 46)

A20, A24, Nle27, E28, E29 (SEQ ID NO: 47)

A20, A24, Nle27, E28, E30 (SEQ ID NO: 48)

A20, A24, Nle27, E29, E30 (SEQ ID NO: 49)

A20, E21, A24, Nle27, D28 (SEQ ID NO: 50)

A20, E21, A24, Nle27, D28, E29 (SEQ ID NO: 51)

A20, E21, A24, Nle27, D28, E30 (SEQ ID NO: 52)

A20, E21, A24, Nle27, E28, E29 (SEQ ID NO: 53)

A20, E21, A24, Nle27, E28, E30 (SEQ ID NO: 54)

A20, E21, A24, Nle27, E29, E30 (SEQ ID NO: 55)

Альтернативно, любой из указанных пептидов может включать замещения AIB20 и/или AIB24 вместо A20 и/или A24.

Любой из указанных пептидов может дополнительно включать аминокислотные замещения T16 или AIB16. Например, была сконструирована последовательность T16,A20,E21,A24,Nle27, D28,E29 (SEQ ID NO: 56).

Пептид глюкагона с указанными модификациями относительно SEQ ID NO: 1 был сконструирован в основном по описанной методике: DMIA1, E16, K20-глюкагон-COOH (C24-PEG, E16 до K20 лактам) Его последовательность указана ниже: DMIA-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Cys*-Trp-Leu-Met-Asn-Thr-COOH, где Cys* в положении 24 обозначает Cys, присоединенный к ПЭГ с молекулярной массой примерно 40000 дальтон, и где Glu в положении 16 и Lys в положении 20 были связаны через лактамный мостик (SEQ ID NO: 40). Этот пептид тестировали на его активность по рецепторам глюкагона и GLP-1 в основном по методике, описанной в примере 13. Пептид продемонстрировал активность на уровне 27,7% относительно нативного глюкагона и обладал эффективностью 1,1% относительно нативного GLP-1.

ПРИМЕР 17

Получение ацилированных и/или ПЭГилированных пептидов

Ацилированные и/или ПЭГилированные пептиды получали по описанной ниже процедуре. Пептиды синтезировали на твердой подложке из смолы с использованием пептидного синтезатора CS Bio 4886 или пептидного синтезатора Applied Biosystems 430A. Использовали реакции нейтрализации in situ, в соответствии методом, описанным Schnolzer et al., Int. J. Peptide Protein Res. 40: 180-193 (1992). Для получения ацилированных пептидов, подлежащий ацилированию (например, в положении десять) целевой аминокислотный остаток замещали N-ε-FMOC-лизиновым остатком. Обработка полученного BOC-защищенного по N-концу пептида 20% пиперидином в ДМФ, в течение 30 минут, приводила к удалению FMOC/формильных групп. Связывание со свободной ε-аминогруппой Lys остатка проводили путем использования 10-кратного молярного избытка FMOC-защищенной аминокислоты спейсера (например, FMOC-(N-BOC)-триптофана-OH) или ацильной цепи (например, C17-COOH) и PyBOP или DEPBT-связывающего реагента в ДМФ/DIEA. Далее, удаляли FMOC группу от аминокислоты в спейсере и вновь проводили реакцию связывания с ацильной цепью. Окончательная обработка 100% ТФУ приводила к удалению всех использованных защитных групп для боковых цепей, а также N-концевой BOC группы. Пептидные смолы нейтрализовали 5% DIEA/DMF, высушивали и затем выщепляли из подложки с использованием HF/п-крезола, 95:5, при температуре 0°C в течение одного часа. После эфирной экстракции использовали 5% HOAc для сольватации неочищенного пептида. Методом ESI-MS, в образце полученного раствора подтверждали корректность молекулярной массы содержащегося пептида. Далее, такие проверенные пептиды очищали по процедуре ОФ-ВЭЖХ с использованием линейного градиента от 10% CH3CN/0,1% ТФУ до 0,1% ТФУ в 100% CH3CN. Использовали колонку для очистки белков Vydac С18 22 мм ×250 мм. Элюцию ацилированных аналогов пептида в основном останавливали при соотношении буферов 20:80. Полученные порции объединяли и проверяли их чистоту при проведении аналитической ОФ-ВЭЖХ. Чистые фракции лиофилизировали с получением твердых пептидов белого цвета.

Если пептид содержит лактамный мостик и нужно провести ацилирование целевого остатка, то ацилирование проводят по описанной выше процедуре при добавлении указанной аминокислоты к пептидному скелету.

Для достижения ПЭГилирования пептида, метоксиполи(этиленгликоль)малеимидо-пропионамид с массой 40 кДА (Chirotech Technology Ltd.) подвергали реакции с молярным эквивалентом пептида в 7М мочевине, в 50 мМ Tris-HCl буфере с использованием минимального количества растворителя, необходимого для растворения пептида и ПЭГ до прозрачного раствора (в основном, менее 2 мл для реакции, в которой используется 2-3 мг пептида). Реакционную смесь энергично встряхивали при комнатной температуре в течение 4-6 часов и затем анализировали методом аналитической ОФ-ВЭЖХ. Было четко видно отделение ПЭГилированных продуктов от исходного материала при снижении времени удерживания. Очистку проводили на колонке Vydac C4 в условиях, аналогичных тем, которые использовались для первичной очистки пептида. Элюцию обычно проводили при использовании буферов в соотношении 50:50. Собирали и лиофилизировали фракции чистого ПЭГилированного пептида.

Полученные пептиды тестировали на наличие биологической активности по процедуре, описанной выше в примере 13.

ПРИМЕР 18

Изменения концентрации глюкозы в сыворотке крови у собак породы бигль после введения аналогов глюкагона

Использовали здоровых собак породы бигль весом 8-12 кг в возрасте от 8 до 16 месяцев для определения фармакокинетики и фармакодинамики действия глюкагона. Животных выдерживали без пищи в течение ночи, после чего отбирали кровь для анализа в следующие временные точки после введения исследуемых доз препарата: 0 часов (до введения дозы), через 5, 10, 20, 30, 45, 60, 90, 120, 240 минут после введения дозы. Использовали по шесть животных в каждой из группах оценки исследуемых доз, у животных отбирали примерно по 1,0 мл цельной крови и добавляли в пробирки с К2-ЭДТА, содержащие достаточный объем Тразилола (апротинин) до достижения активности по меньшей мере 500 кМЕ/мл цельной крови. После центрифугирования образцов в охлаждаемой центрифуге со скоростью примерно 1500-3000×g в течение 10-15 минут, отбирали примерно 500 мкл плазмы. Образца переносили в пластиковые флаконы и хранили при замораживании при температуре -70°C или ниже. Оставшийся 1,0 мл цельной крови превращали в сыворотку при помещении образов крови в пустую пробирку и выдерживании в течение 15-20 минут при температуре окружающей среды, с последующим центрифугированием при 1500-3000×g в течение 10-15 минут в охлаждаемой центрифуге. Образцы переносили в пластиковые флаконы и хранили в замороженном состоянии при температуре -70°C или ниже. Глюкагон и аналоги растворяли в 0,01н. HC1 при концентрации 0,1667 мг/мл и животным вводили дозу 0,03 мл/кг.

Животным вводили внутримышечно дозу 0,005 мг/кг глюкагона или аналога глюкагона, включающего глюкагон с последовательностью SEQ ID NO: 31, присоединенный к карбокси-концу глюкагона (глюкагон-CEX), или аналог глюкагона, включающий замещение аспарагиновой кислотой в положении аминокислоты 28 (глюкагон-Asp28) (SEQ ID NO: 11). Полученные результаты проиллюстрированы на фиг. 10.

ПРИМЕР 19

По существу, согласно описанной ранее методике, были получены указанные ниже пептиды:

(A) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещением аминокислоты в положении 16 AIB («AIB 16 Глюкагон»);

(B) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещением аминокислоты в положении 19 AIB («AIB 19 Глюкагон»);

(C) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещением аминокислоты в положении 20 AIB («AIB 20 Глюкагон»);

(D) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещением аминокислоты в положении 21 AIB («AIB 21 Глюкагон»);

(E) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещением аминокислоты в положении 24 AIB («AIB 24 Глюкагон»);

(F) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещениями аминокислот в положениях 16 и 20 AIB («AIB 16, 20 Глюкагон»);

(G) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещениями аминокислот в положениях 16 и 24 AIB («AIB 16, 24 Глюкагон»);

(H) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещениями аминокислот в положениях 20 и 24 AIB («AIB 20, 24 Глюкагон»); и

(I) Пептид, включающий аминокислотную последовательность SEQ ID NO: 1 с замещениями аминокислот в положениях 16, 20 и 24 AIB («AIB 16, 20, 24 Глюкагон»).

Пептиды анализировали по методике, которая в общих чертах была описана в примере 13, и полученные результаты показаны в Таблице 5.

ТАБЛИЦА 5
Пептид Рецептор глюкагона Рецептор GLP-1
Среднее значение СКО n Среднее значение СКО n
GLP-1 2878,03 2510,39 7 0,05 0,02 #
Глюкагон 0,14 0,06 14 13,70 4,26 #
AIB 16 Глюкагон 0,37 0,05 2 32,43 8,63 4
AIB 19 Глюкагон 13,52 0,64 3 64,75 11,38 4
AIB 20 Глюкагон 0,32 0,14 6 7,88 0,36 2
AIB 21 Глюкагон 0,55 0,17 6 5,92 1,83 2
AIB 24 Глюкагон 0,22 0,02 3 23,92 7,20 4
AIB 16,20 Глюкагон 0,26 0,06 2 13,62 8,92 2
AIB 16,24 Глюкагон 0,18 0,01 2 31,81 - 1
AIB 20,24 Глюкагон 0,34 0,15 2 10,59 1,95 2
AIB 16,20,24 Глюкагон 0,42 0,18 2 12,15 3,77 2

ПРИМЕР 20

Приведенные ниже аналоги пептидов глюкагона получали в основном по процедуре, описанной выше.

«D28/E29 Глюкагон», включающий аминокислотную последовательность SEQ ID NO: 1, модифицированную за счет включения Asp в положении 28 и Glu в положении 29:

HSQGTFTSDYSKYLDSRRAQDFVQWLMDE (SEQ ID NO: 75); и

«AIB16/D28/E29 Глюкагон», включающий аминокислотную последовательность SEQ ID NO: 75, дополнительно модифицированную за счет включения AIB в положении 16:

HSQGTFTSDYSKYLDAibRRAQDFVQWLMDE (SEQ ID NO: 76).

Активность каждого пептида in vitro по рецептору глюкагона тестировали методом, описанному в примере 13. Значение EC50 для D28/E29 пептида глюкагона составляло 0,06 нМ, тогда как указанное значение для пептида AIB16/D28/E29 глюкагона составляла 0,08 нМ.

ПРИМЕР 21

Пептиды из набора А, где каждый из пептидов включает аминокислотную последовательность SEQ ID NO: 1 с модификациями, перечисленными в Таблице 6, получали по существу согласно описанной выше методике.

Второй набор В (Set B) включал пептиды той же структуры, что и пептиды в наборе А (Set) A, за исключением того, что пептиды в наборе B включали Cys в положении 24, где Cys остаток ковалентно присоединен к ПЭГ цепи размером 40 кДа.

Пептиды из наборов A и B тестировали на наличие активности in vitro по рецептору глюкагона согласно методике, которая была в основном описана в примере 13.

ПРИМЕР 22

Приведенные ниже аналоги пептида глюкагона, включающие скелет пептида 1

HS-X-GTFTSDYSKYLDTRRAAEFVAWL(Nle)DE

(SEQ ID NO: 59)

или пептид К

HS-X-GTFTSDYSKYLD(Aib)RRAADFVAWLMDE (SEQ ID NO: 60)

с дополнительной модификацией в положении 3 получали методом твердофазного пептидного синтеза, который в основном был описан выше. Указанные пептиды тестировали на наличие активности in vitro по рецептору глюкагона, методикой, описанной в основном в примере 13. Показатель EC50 (нМ) для каждого из пептидов показан в Таблице 7.

ТАБЛИЦА 7
Пептидный скелет Аминокислота в положении 3 SEQ ID NO: EC50 по рецептору глюкагона (нМ) % активности*
J Q 61 0,24 25%
J C(Acm) 62 0,18 33%
J Dab(Ac) 63 0,31 19%
J Dap(мочевина) 64 0,48 13%
J Q(Me) 65 0,48 13%
J M(0) 66 0,91 7%
J Orn(Ac) 67 0,92 7%
К Q 68 0,39 15%
К Dab(Ac) 69 0,07 86%
К Q(Me) 70 0,11 55%
Q = глютамин; C(Acm) = ацетамидометилцистеин; Dab(Ac) = ацетилдиаминобутановая кислота; Dap(мочевина) = карбамоилдиаминопропановая кислоты; Q(Me) = метилглютамин; M(O) = метионинсульфоксид; Orn(Ac) = ацетилорнитин.

Как показано в Таблице 7, в положение 3 может быть введено множество аминокислот без существенной потери активности по рецептору глюкагона, а в некоторых случаях такая модификация фактически повышала активность, например, в случае Dab(Ac) и Q(Me) для пептидного скелета К.

ПРИМЕР 23

Аналоги пептида глюкагона, включающие Dab(Ac) в положении 3 на различных скелетах аналога глюкагона, были изготовлены согласно методике, приведенной в настоящем описании, и тестировали их активность in vitro по рецептору глюкагона. Структура и активность для каждого из пептидов показаны в Таблице 8.

ТАБЛИЦА 8
Аминокислотная последовательность SEQ
ID
NO:
ЕС50
(нМ) по рецептору глюкагона
% актив-ности*
Глюкагон дикого типа 1 0,026 100
HSQGTFTSDYSKYLDSRRAQDFVQWLMDT 78 0,015 173
HSDab(Ac)GTFTSDYSKYLDAibRRAADFVAWLLDE 71 0,069 37
HSDab(Ac)GTFTSDYSKYLDAibRRAADFVAWLLDTGPSSGAPPPS
амид
72 0,023 113
HSDab(Ac)GTFTSDYSKYLDAibRRASDFVSWLLDE 73 0,048 54
IISDab(Ac)GTFTSDYSKYLDAibRRATDFVTWLLDE 74 0,057 46

ПРИМЕР 24

Пептиды из первого набора (набор A), включающие аминокислотную последовательность SEQ ID NO: 1 с модификациями, показанными в таблице 9, получали в основном по описанной выше методике.

Пептиды, включающие такую же структуру, что и пептиды из набора А, за исключением того, что ацильная группа представляет собой С6 или С18 жирноацильную группу, получали методом, который был в основном описан выше. Пептиды, включающие С16 жирноацильную группу, представляли пептиды из набора B, а пептиды с С18 жирноацильную группой, составляли пептиды из набора С.

Пептиды из набора D, включающие те же структуры, что и пептиды из наборов A, B и C, за исключением того, что жирноацильные группы в них ковалентно присоединены к боковой цепи Lys остатка в указанном положении через один из приведенных ниже спейсеров, получали согласно приведенному описанию: γ-Glu-γ-Glu; (3-Ala-P-Ala, Ala-Ala, 6-аминогексановая кислота, Leu-Leu, and Pro-Pro.

Пептиды из наборов A-D тестировали на активность in vitro по рецептору глюкагона согласно процедуре, описанной в примере 13, и показатели ЕС50 для каждого из них сравнивали с активностью нативного глюкагона по рецептору глюкагона.

ПРИМЕР 25

Несколько аналогов глюкагона, не содержащих ковалентный внутримолекулярный мостик и включающих AIB в положении 2, AIB в положении 16 и жирноацильную группу, присоединенную через спейсер к Lys остатку в положении 10, получали практически согласно описанной выше методике. Ацилированные аналоги глюкагона отличались по типу спейсера, наличию или отсутствию ПЭГилирования и/или по размеру ацильной группы. Ацилированные аналоги глюкагона тестировали на их активность in vitro по рецептору глюкагона и рецептору GLP-1 с использование методики, описанной в основном в примере 13. Краткий обзор структуры и активности in vitro по рецепторам глюкагона и GLP-1 для каждого из исследованных пептидов приведен в таблицах 10 и 11.

ТАБЛИЦА 10
Аминокислотная последовательность скелета аналога глюкагона: HXQGTFTSDKSKYLDXRRAQDFVQWLMNT
Обозначение пептида SEQ ID NO: Спейсер Размер жирно-ацильной группы Показатель ЕС50 по рецептору глюкагона (нМ) Показа-тель ЕС50 по рецепто-ру GLP-1 (нМ)
Глюкагон дикого типа 1 не определяли не определяли 0,031±0,014
wtGLP-1 не определяли не определяли 0,036±0,010
26 96 Отсутствует Отсутствует 0,653±0,285 0,475±
0,046
50 97 Отсутствует C16 0,572±0,084 0,291±
0,060
82 98 Ala-Ala C16 0,024±0,001 0,108±
0,018
83 99 Y-Glu- Y-G1U C16 0,014±0,002 0,043±
0,005
84 100 P-Ala-p-Ala C16 0,011 0,004
85 101 6-аминогексановая кислота C16 0,010 0,005
86 102 Leu-Leu C16 0,011 0,006
87 103 Pro-Pro C16 0,017 0,009
77* 104 Отсутствует C14 21,94±14,47 1,458±
0,132
78* 105 Y-Glu- Y-Glu C14 0,319±0,091 0,103±
0,023
81* 107 Ala-Ala C14 0,597±0,175 0,271±
0,019
79* 109 Ala-Ala C16 0,102±0,011 0,055±
0,001
80* 110 Y-Glu-Y-GLU C16 0,108+0,028 0,042±
0,008
* указывает, что пептид включает Cys остаток в положении 24 (вместо Gln), где Cys был ковалентно присоединен к ПЭГ группе размером 40 кДА)
ТАБЛИЦА 11
Аминокислотная последовательность скелета глюкагона HXQGTFTSDKSKYLDXRRAQDFVWLMNT
Обозначение пептида SEQ ID NO: Спейсер Размер жирно-ацильной группы Показатель ЕС50 по рецептору глюкагона (нМ) Показатель ЕС50 по рецептору GLP-1 (нМ)
Глюкагон дикого типа 1 не определяли не определяли 0,008±0,003
wtGLP-1 не определяли не определяли 0,004+
0,001
77** 111 отсутствует C14 0,144±0,029 0,063±
0,012
78** 112 Y-Glu- Y-G1U C14 0,009±0,001 0,008±
0,001
81** 113 Ala-Ala C14 0,027±0,006 0,018±
0,001
80** 114 y-Glu- Y-G1U C16 0,006±0,001 0,008+
0,001
79** 115 Ala-Ala C16 0,010+0,001 0,008+
0,001
** пептид, включающий Cys в положении 24 (вместо Gln), где Cys был нековалентно присоединен к ПЭГ молекуле)

Как показано в Таблицах 10 и 11, пептиды, включающие жирноацильные группы, которые были присоединены через спейсер, имеют значительно более высокую активность в сравнении с пептидами, включающими жирноацильные группы, непосредственно присоединенные к скелету.

ПРИМЕР 26

Аналоги пептидов глюкагона с последовательностями SEQ ID NONO: 71, 76 и 78 анализировали на их стабильность. Все пептиды включали Asp в положении 28, а пептиды с последовательностями SEQ ID NONO: 71 и 76 дополнительно включали Glu в положении 29. Тогда как пептид SEQ ID NO: 78 не включал никакой дополнительной модификации, оба других пептида, SEQ ID NO: 71 и 76, включали AIB в положении 16. Кроме того, пептид SEQ ID NO: 71 дополнительно включал Dab(Ac) в положении 3, Ala в положениях 20 и 24 и Leu в положении 27.

Пептиды изготавливали в виде раствора с концентрацией пептида 1 мг/мл. Шприцы заполняли одним из указанных растворов пептида и минимизировали их контакт с воздухом. Шприцы хранили при температурах 4, 25, 30 или 40 градусов Цельсия. Для мониторинга возможного химического разложения использовали аналитическую ОТ-ВЭЖХ (высокоэффективную жидкостную хроматография с обращением фазы) в точках 0, 1, 2, 4 и 6 месяцев с использованием УФ детектора при длине волны 280 нм. Использовали метод гель-фильтрации (гель-хроматографии) для оценки наличия каких-либо сформировавшихся агрегатов в точках 0, 1, 2, 4 и 6 месяцев с использованием УФ детектора при длине волны 280 нм.

Значения интегрированной площади пиков, полученные на основе поглощения в УФ области пептидов с последовательностями SEQ ID NONO: 71, 76 и 78, в виде функции времени показаны на фиг. 12-14, соответственно. Как видно из этих графиков, стабильность пептидов была наивысшей в случае пептида SEQ ID NO: 71 и минимальной в случае пептида SEQ ID NO: 78, хотя после 2 месяцев хранения при температуре 30°С выявлялось до 90% пептида. При этом не наблюдалось значительного снижения площади пика для последовательности SEQ ID NO: 71, что указывало на хорошую химическую и биофизическую стабильность данного пептида.

ПРИМЕР 27

Мышам DIO (по 8 мышей на группу), со средним весом мышей 48,7 г, в течение 7 дней ежедневно инъецировали подкожно только носитель, 30 нмоль/кг или 100 нмоль/кг ацилированного аналога пептида глюкагона или длительно действующий аналог GLP-1, Лираглютид (Liraglutide) (Novo Nordisk, Denmark). Использовали следующие ацилированные аналоги глюкагона:

«(CI6) амид глюкагона» включал аминокислотную последовательность глюкагона дикого типа (SEQ ID NO: 1) с модификацией Tyr в положении 10 до ацилированного Lys остатка, где ацилированный Lys остаток включал жирноацильную группу, и С-концевая карбоксильная группа была замещена амидной группой;

«γE-γE-C16 амид глюкагона» включал ту же структуру, что и С-16 амид глюкагона с тем исключением, что С16 жирноацильная группа была присоединена к Lys в положении 10 через гамма-Glu-гамма-Glu дипептидный спейсер (см. ниже структуру ацилированного Lys):

«AA-C16 амид глюкагона» включал ту же структуру, что и С16 амид глюкагона, с тем исключением, что С16 жирноацильная группа была присоединена к Lys остатку в положении 10 через Ala-Ala дипептидный спейсер; и

«βA-β3A-C16 амид глюкагона» включал ту же структуру, что и С16 амид глюкагона, с тем исключением, что С16 жирноацильная группа была присоединена к Lys остатку в положении 10 через β-Ala-β-Ala дипептидный спейсер.

Ежедневно оценивали вес тела мышей и обобщенные данные по изменению веса тела животных (%) проиллюстрированы на фиг. 15. Как показано на фиг.15, большая часть ацилированных пептидов глюкагона в каждой из исследованных доз, вызывала снижение веса тела. В то время как Лираглутид продемонстрировал снижение веса тела мышей в среднем на 12%, аналог пептида глюкагона γE-γE-C16 амид глюкагона продемонстрировал наивысшую способность вызывать снижение веса у мышей в исследованной дозе. Даже наименьшая исследованная доза γE-γE-C16 амида глюкагона вызывала значительное снижение веса тела.

На 7 день исследования определяли размеры жировой массы тела у мышей. Как показано на фиг.16, у мышей, которым вводили 100 нмоль/кг γE-γE-C16 амида глюкагона, отмечалась наименьшая жировая масса.

В ходе испытания отслеживали также уровни глюкозы в крови мышей. Как показано на фиг. 17, аналог пептида глюкагона, γE-γE-C16 амид глюкагона, в повышенной дозе действовал так же хорошо, как и Лираглутид, по снижению уровня глюкозы в крови у мышей.

ПРИМЕР 28

Аналоги пептидов глюкагона получали методом твердофазного пептидного синтеза, приведенного в настоящем описании, и затем ацилировали по положению 10 или 30 данного пептида. Ниже показаны пептиды и их структуры:

«Пептид dS2E16K20K30-C14 Gluc амид» включал аминокислотную последовательность HXQGTFTSDYSKYLDERRAKDFVQWLMNTK-амид (SEQ ED NO: 79), где X в положении 2 обозначает d-Ser, где Lys в положении 30 ацилирован С14 жирноацильной группой и С-концевая карбоксильная группа замещена амидом;

«Пептид dS2K10(C14)E16K20-Gluc амид» включал аминокислотную последовательность HXQGTFTSDKSKYLDERRAKDFVQWLMNT-амид (SEQ ID NO: 80); где X в положении 2 обозначает d-Ser, где Lys в положении 10 был ацилирован в положении С14 жирноацильной группой и С-концевая карбоксильная группа замещена амидом;

«Пептид dS2E16K20K30-C16 Gluc амид» включал аминокислотную последовательность IDCQGTFTSDYSKYLDERRAKDFVQWLMNTK-амид (SEQ ID NO: 81), где X в положении 2 обозначает d-Ser, где Lys в положении 30 был ацилирован в положении С14 жирноацильной группой и С-концевая карбоксильная группа замещена амидом;

«Пептид dS2K10(C16)E16K20-Gluc амид» включал аминокислотную последовательность HXQGTFTSDKSKYLDERRAKDFVQWLMNT-амид (SEQ ID NO: 82); где X в положении 2 обозначает d-Ser, где Lys в положении 10 был ацилирован в положении С14 жирноацильной группой и С-концевая карбоксильная группа замещена амидом;

«Пептид химерный 2-AIB2-K10 ацилированный» включал аминокислотную последовательность HXQGTFTSDKSKYLDEQAAKEFICWLMNT-амид (SEQ ED NO: 83); где X в положении 2 обозначает AIB, где К в положении 10 ацилирован С18 жирноацильной группой, Cys в положении 24 включает молекулу ПЭГ размером 40 кДА и С-концевая карбоксильная группа замещена амидом;

«Пептид химерный 2-AIB2-K13 ацилированный» включал аминокислотную последовательность HXQGTFTSDYSKYLDEQAAKEFICWLMNTK-амид (SEQ ID NO: 84), где X в положении 2 обозначает AIB, где К в положении 30 ацилирован С18 жирноацильной группой, Cys в положении 24 включает молекулу ПЭГ размером 40 кДа и С-концевая карбоксильная группа замещена амидом;

Активность in vitro каждого из пептидов по рецептору GLP-1 и рецептору глюкагона оценивали согласно процедуре, описанной в основном в примере 13. Полученные результаты показаны в Таблице 12.

ТАБЛИЦА 12
Название пептида Положе-ние ацильной
группы
EC50 по рецептору глюкагона (нМ) EC50 по рецептору GLP-1 (нМ)
Пептид dS2E16K20K30-C14 Glue амид 30 3,53 0,84
Пептид dS2K10(C14)E16K20-Gluc амид 10 0,155 0,041
Пептид dS2E16K20K30-C16 Glue амид 30 4,89 3,05
Пептид dS2K10(C16)E16K20-Gluc амид 10 0,076 0,041
Пептид химерный 2-AIB2-K30-ацилированный 30 не исслед. 0,465
Пептид химерный 2-AIB2-K10-ацилированный 10 не исслед. 0,007

Все ссылки, включающие публикации, заявки на патенты и патенты, процитированные в настоящем описании, включены полностью в качестве ссылок, в той мере, в какой каждая из ссылок индивидуально и специфически относятся к настоящему описанию и прилагаются в полном размере.

Использование разных видов артиклей и аналогичных форм в тексте настоящего описания (особенно в тексте прилагаемой формулы изобретения) подразумевает как форму единственного, так и множественного числа, если особо не указано иное, или четко не следует противоположное. Термины «составляющий», «имеющий», «включающий» и «содержащий» следует понимать, как открытые термины (то есть значение «включающий», но не «ограничивающий»), если особо не указано иное.

Указание диапазонов значений дано лишь для сокращения изложения и их использование подразумевает, что каждое отдельное значение, попадающее в этот диапазон, и каждое конечная точка, если особо не указано иное, а также отдельное значение конечной точки, включаются в данное определение, как если бы оно было индивидуально указано.

Все методы, приведенные в настоящем описании, могут быть осуществлены в любом порядке, если особо не указано иное, или если из контекста четко не следует противоположное. Использование любых и всех примеров или репрезентативных понятий (например, «таких как») в тексте настоящего описания служит лишь целям более детального пояснения изобретения и не налагает какие-либо ограничения на область изобретения, если особо не указано иное. Ничто в изложении описания не должно рассматриваться как указывающее на то, что имеется элемент, который конкретно не был указан, но который важен для осуществления настоящего изобретения.

В настоящем тексте приведены предпочтительные варианты осуществления настоящего изобретения, включающие наилучшие способы его осуществления, известные его авторам. Вариации указанных предпочтительных вариантов могут стать очевидными для специалистов в данной области при ознакомлении с приведенным описанием. Авторы изобретения полагают, что специалисты в данной области смогут соответствующим образом применить такие вариации и полагают, что изобретение может быть осуществлено иным способом, чем это было конкретно описано в настоящем описании. Соответственно, настоящее изобретение включает все модификации и эквиваленты предмета изобретения, указанные в формуле изобретения, прилагаемой согласно соответствующему законодательству. Кроме того, любое сочетание указанных выше элементов во всех возможных их вариациях, также охватывается областью изобретения, если особо не указано иное или явно не следует противоположное из контекста.

1. Пептид глюкагона с активностью агониста глюкагона, характеризующийся аминокислотной последовательностью SEQ ID NO: 1, содержащей вплоть до 7 аминокислотных замещений по отношению к SEQ ID NO: 1, где одно из замещений аминокислот представляет собой замещение глютамина в положении 3 последовательности SEQ ID NO: 1 на аминокислоту, содержащую боковую цепь структуры I:

где R1 обозначает СН2; R2 обозначает СН3; и X обозначает NH;
и где аминокислота в положении 16 пептида глюкагона представляет собой аминоизомасляную кислоту (AIB).

2. Пептид глюкагона по п.1, где вплоть до 7 аминокислотных замещений выбраны из группы, состоящей из:
a) замещение His в положении 1 ненативной аминокислотой, которая снижает чувствительность пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV);
b) замещение Ser в положении 2 ненативной аминокислотой, которая снижает чувствительность пептида глюкагона к расщеплению дипептидилпептидазой IV (DPP-IV);
c) замещение Thr в положении 7 на Abu или Ile;
d) замещение Tyr в положении 10 на Phe или Val;
e) замещение Lys в положении 12 на Arg;
f) замещение Asp в положении 15 на Glu;
g) замещение Gln в положении 20 на Ala или AIB;
h) замещение Asp в положении 21 на Glu;
i) замещение Gln в положении 24 на Ala или AIB;
j) замещение Met в положении 27 на Leu или Nle;
k) замещение аминокислотой, включающей боковую цепь, ковалентно присоединенную к ацильной или алкильной группе, которая является ненативной для природной аминокислоты;
l) замещение Asn в положении 28 на заряженную аминокислоту, где в случае необходимости заряженная аминокислота выбрана из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;
m) замещение Thr в положении 29 на заряженную аминокислоту, где в случае необходимости заряженная аминокислота выбрана из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;
n) или их комбинацию.

3. Пептид глюкагона по п.1 или 2, где пептид глюкагона включает аминокислотную последовательность, описываемую любой одной из SEQ ID NO: 69 и 71-74.

4. Пептид глюкагона по п.3, включающий аминокислотную последовательность SEQ ID NO: 71.

5. Пептид глюкагона по любому из пп.1-4, где ацильная группа или алкильная группа ковалентно присоединена к боковой цепи аминокислоты в положении 10 или к C-концевой аминокислоте, где, в случае необходимости, ацильная группа представляет собой С430жирноацильную группу, или алкильная группа представляет собой С430алкил, где, в случае необходимости, ацильная или алкильная группа присоединена к боковой цепи через спейсер.

6. Конъюгат с активностью агониста глюкагона, включающий пептид глюкагона по пп.1-5 и агент для нацеливания, диагностическую метку, полимер или другие терапевтические или диагностические агенты.

7. Слитый пептид с активностью агониста глюкагона, включающий пептид глюкагона по пп.1-5 и (i) гетерологичный пептид, включающий аминокислотную последовательность, описываемую любой из SEQ ID NO: 20-22, или (ii) плазменный белок или (iii) иммуноглобулин или его часть.

8. Димер с активностью агониста глюкагона, включающий два пептида, причем каждый пептид представляет собой пептид глюкагона по пп.1-5.

9. Фармацевтическая композиция для лечения гипогликемии, включающая эффективное количество пептида глюкагона по любому из пп.1-5, димера по п.8, конъюгата по п.6, слитого пептида по п.7 или их комбинации, а также фармацевтически приемлемый носитель, где, в случае необходимости, фармацевтическая композиция дополнительно включает инсулин.

10. Набор для лечения гипогликемии, включающий фармацевтическую композицию по п.9 и устройство для введения указанной фармацевтической композиции пациенту, где, в случае необходимости, устройство включает шприц и, в случае необходимости, иглу, где фармацевтическая композиция предварительно введена в шприц.

11. Применение пептида глюкагона по любому из пп.1-5 для лечения или профилактики гипогликемии у пациента.

12. Применение пептида глюкагона по любому из пп.1-5 для стабилизации уровня глюкозы в крови у пациента.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к производным аналога GLP-1, и может быть использовано в медицине. Синтезируют соединение, обладающее активностью GLP-1 и являющееся производным аналога GLP-1, где аналог имеет первый остаток K37 в позиции, соответствующей позиции 37 GLP-1 (7-37) (SEQ ID №1), второй остаток K26 в позиции, соответствующей позиции 26 GLP-1 (7-37), а также не более четырех аминокислотных модификаций по сравнению с GLP-1 (7-37), включая K37 и Q или R в позиции, соответствующей позиции 34 в GLP-1 (7-37).

Настоящее изобретение относится к новым соединениям глюкагона, содержащим три или более отрицательно заряженных фрагмента, где один из указанных отрицательно заряженных фрагментов расположен дистально от липофильного фрагмента.

Изобретение относится к области биотехнологии, конкретно к новым аналогам глюкагон-подобного пептида, и может быть использовано в медицине для активации экспрессии инсулина у млекопитающих и для лечения сахарного диабета.
Изобретение относится к области биотехнологии, конкретно к получению аналогов GLP-2, и может быть использовано в медицине для лечения расстройств, ассоциированных с GLP-2.

Изобретение относится к пролекарственным препаратам пептидов глюкагонового надсемейства, в которых пептид глюкагонового надсемейства модифицирован связыванием дипептида с пептидом глюкагонового надсемейства амидной связью.

Изобретение относится к области генной инженерии, конкретно к получению пептида GLP-1, модифицированного олигосахаридной цепью, и может быть использовано в медицине для лечения или профилактики заболеваний, ассоциированных с GLP-1.

Изобретение относится к пептидным аналогам оксинтомодулина (ОХМ, глюкагон-37), которые были модифицированы для придания устойчивости к расщеплению и инактивации дипептидилпептидазой IV (DPP-IV) и для увеличения времени полужизни in vivo пептидного аналога наряду с предоставлением возможности пептидному аналогу действовать в виде двойного агониста GLP-1/глюкагонового рецептора (GCGR).

Изобретение относится к области биотехнологии, конкретно к пептиду GLP-1 с присоединенной олигосахаридной цепью, и может быть использовано в медицине. Указанный пептид GLP-1, обладающий активностью GLP-1, имеет (а1) одну аминокислоту, дополнительно присоединенную к С-концу (позиция 37), в котором указанная присоединенная аминокислота заменена аминокислотой с присоединенной олигосахаридной цепью; или (а2) одну или две аминокислоты, замененные аминокислотой с присоединенной олигосахаридной цепью, где сайт замены выбирают из позиций 18, 20, 22, 30 и 36, а также может дополнительно включать от 1 до 5 делеций, замен или вставок аминокислот, где указанная олигосахаридная цепь содержит пять или более сахаров и представлена Формулой 1.

Настоящее изобретение относится к аналогам глюкагоноподобного пепдтида-1 (ГПП-1), представленным следующей формулой I, где X представляет собой глицин или глицинамид.

Настоящее изобретение предоставляет способ регулирования условий для сайт-специфического связывания полипептида и непептидильного полимера посредством регулирования рН и содержания спирта реакционной среды.

Изобретение относится к новому средству, обладающему антидиабетическим действием. Средство представляет собой комплексное соединение оксованадия (IV) с диметилсульфоксидом (DMSO) формулы VO(DMSO)5·(ClO4)2 - пентакис(диметилсульфоксид) оксованадия (IV) перхлорат.

Изобретение относится к области биотехнологии, конкретно к производным аналога GLP-1, и может быть использовано в медицине. Синтезируют соединение, обладающее активностью GLP-1 и являющееся производным аналога GLP-1, где аналог имеет первый остаток K37 в позиции, соответствующей позиции 37 GLP-1 (7-37) (SEQ ID №1), второй остаток K26 в позиции, соответствующей позиции 26 GLP-1 (7-37), а также не более четырех аминокислотных модификаций по сравнению с GLP-1 (7-37), включая K37 и Q или R в позиции, соответствующей позиции 34 в GLP-1 (7-37).

Настоящее изобретение относится к новым соединениям глюкагона, содержащим три или более отрицательно заряженных фрагмента, где один из указанных отрицательно заряженных фрагментов расположен дистально от липофильного фрагмента.

Предложена группа изобретений, касающаяся лечения гипергликемии у пациентов с сахарным диабетом II типа и не вызывающая увеличения веса. Предложены: состав с немедленным высвобождением в форме таблетки, исходного гранулята или капсулы, содержащий дапаглифлозин или пропилегликольгидрат дапаглифлозина (S), гидрохлорид метформина, гидроксипропилцеллюлозу, микрокристаллическую целлюлозу, натриевый гликолят крахмала или гидроксипропилцеллюлозу с низкой степенью замещения в качестве разрыхлителя и стеарат магния; комбинация указанной фармацевтической композиции с противодиабетическим средством и комбинация указанной фармацевтической композиции со средством для снижения массы тела.
Изобретение относится к медицине, а именно к восстановительной медицине, и может быть использовано для коррекции сосудистых нарушений у больных сахарным диабетом.

Изобретение относится к области биотехнологии, конкретно к новым аналогам глюкагон-подобного пептида, и может быть использовано в медицине для активации экспрессии инсулина у млекопитающих и для лечения сахарного диабета.

Настоящее изобретение относится к фармацевтической композиции, содержащей соединение инсулина в концентрации, достаточной для поддержания терапевтически эффективного уровня соединения инсулина в плазме крови в течение по меньшей мере 3 дней.

Изобретение относится к медицине, а именно к терапии и кардиологии, и касается коррекции когнитивных нарушений у пациентов с артериальной гипертонией на фоне сахарного диабета 2 типа.

Изобретение относится к медицине, а именно к терапии и кардиологии, и касается коррекции повышенного уровня тревоги и депрессии у пациентов с артериальной гипертонией на фоне сахарного диабета 2 типа.

Группа изобретений относится к способам лечения диабета 2 типа, резистентности к инсулину, пониженной продукции инсулина, ожирения, гипергликемии и гиперинсулинемии, включающим введение субъекту эффективного количества антитела к IL-1β или его фрагмента, а также к применению антитела к IL-1β или его фрагмента в производстве композиции, предназначенной для лечения вышеуказанных заболеваний или состояний.

Изобретение относится к фармацевтической промышленности и представляет собой композицию для улучшения состояния гипоальбуминемии, где композиция содержит лейцин и изолейцин и не содержит валин.
Наверх