Способ получения рекомбинантного человеческого g-csf



Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf
Способ получения рекомбинантного человеческого g-csf

 


Владельцы патента RU 2563536:

ОКТАФАРМА АГ, (CH)

Изобретение относится к области биохимии. Заявлен G-CSF-предшественник, содержащий сигнальный пептид и G-CSF-пептид, где сигнальный пептид имеет последовательность человеческого сигнального пептида дикого типа молекулы человеческого G-CSF/b, содержащего, по меньшей мере, одну из мутаций, включающих делецию Glu29, замену His21Phe и замену Gln28Leu. Также представлены полинуклеотид, кодирующий G-CSF-предшественник, экспрессирующий вектор, трансфицированная клетка и способ получения G-CSF с помощью указанной клетки. Изобретение позволяет сделать процессинг белка-предшественника G-CSF более точным и получить G-CSF с очень маленькой степенью укорачивания по N-концу. 5 н. и 8 з.п. ф-лы, 13 ил., 10 пр.

 

Уровень техники

G-CSF представляет собой 20кДа-гликопротеин, стабилизированный двумя внутрицепочечными дисульфидными связями и содержащий один O-связанный углеводный компонент. Зрелый G-CSF содержит 174 аминокислоты. G-CSF синтезируется клетками костного мозга, макрофагами и фибробластами. Его главная функция заключается в том, что он является фактором роста и дифференцировки нейтрофильных гранулоцитов и их клеток-предшественников. Также из уровня техники известно, что G-CSF активирует зрелые нейтрофилы. Кроме того, он стимулирует рост/дифференцировку разных других гемопоэтических клеток-предшественников (совместно с дополнительными гемопоэтическими факторами роста) и способствует пролиферации и миграции эндотелиальных клеток. В клинике G-CSF используется для лечения дефицита уровня нейтрофильных гранулоцитов (нейтропении, вызванной, например, раком/химиотерапией, ВИЧ, или трансплантацией костного мозга).

Сущность изобретения

С целью лечения пациентов с нейтропенией с помощью G-CSF, идентичного человеческому, человеческие клетки трансфицировали плазмидой, кодирующей человеческий G-CSF дикого типа. После очистки G-CSF из супернатанта клеточной культуры выбранных клонов, наблюдали, что существенное количество секретированного G-CSF составлял G-CSF, укороченный по N-концу на три аминокислоты. Это укорачивание не являлось клоноспецифичным и не могло быть исключено модификацией условий культивирования клеток.

На основе этого наблюдения заключили, что процессинг белка-предшественника G-CSF в клетках, особенно в клетках HEK293F, был неточным. Конкретнее, пришли к выводу, что комплекс сигнальной пептидазы отщеплял не только в ожидаемом положении с целью физиологического удаления сигнального пептида, но дополнительно еще в одном положении, что приводило к N-концевому укорачиванию.

Подробное описание изобретения

Неожиданно было обнаружено, что N-концевое укорачивание может быть уменьшено, если использовать модифицированный сигнальный пептид и соответствующий G-CSF-предшественник.

Таким образом, в одном воплощении изобретения предлагается G-CSF-предшественник, содержащий сигнальный пептид и G-CSF-пептид, где сигнальный пептид имеет последовательность человеческого сигнального пептида дикого типа молекулы человеческого G-CSF/b (SEQ ID NO:4), содержащего, по меньшей мере, одну из следующих мутаций:

- делению Glu29,

- вставку Glu26,

- замену Lys11Leu,

- замену His21Phe, и

- замену Gln28Leu.

В предпочтительном воплощении, G-CSF-предшественник содержит, по меньшей мере, 2, или, по меньшей мере, 3, или, по меньшей мере, 4, или все пять мутаций, упомянутых выше.

В следующем воплощении изобретения, G-CSF-предшественник содержит до 3 дополнительных мутаций, выбранных из вставки, делеции и замены.

Следующее воплощение изобретения представляет собой полинуклеотид, кодирующий G-CSF-предшественник по изобретению, и полинуклеотид, комплементарный вышеупомянутому полинуклеотиду.

Следующее воплощение изобретения представляет собой вектор, содержащий полинуклеотид по изобретению, и трансфицированную клетку, содержащую или полинуклеотид по изобретению или вектор по изобретению.

В предпочтительном изобретении, это эукариотическая клетка, предпочтительно, человеческая клетка, более предпочтительно, клетка HEK293 и, более предпочтительно, клетка HEK293F или клетка, произошедшая из клеток HEK293F.

В одном воплощении, трансфекция является транзиторной и, в другом воплощении, трансфекция является стабильной.

Следующее воплощение изобретения представляет собой способ экспрессии G-CSF, содержащий стадии

- культивирования трансфицированных клеток по изобретению в подходящей культуральной среде

- выделения G-CSF из культуральной среды.

В предпочтительном воплощении, культивирование осуществляют при рН в интервале 6,8-7,5, предпочтительно, 7,1-7,3, более предпочтительно, около 7,2. Предпочтительно, рН контролируют во время культивирования.

В следующем воплощении, культивирование осуществляют в присутствии инсулина с концентрацией в интервале 5-25 мг/мл, предпочтительно, 15-25 мг/мл, более предпочтительно, 15-20 мг/мл.

Неожиданно оказалось, что G-CSF, полученный вместе с модифицированным сигнальным пептидом по изобретению, имел очень маленькую степень укорачивания, предпочтительно менее 5% молекул, более предпочтительно, менее 1% от всего G-CSF. Предполагается, что 1% является пределом обнаружения.

Предпочтительно, культуральная среда является бессывороточной.

Профиль гликозилирования основного G-CSF оставался неизменным и активность оставалась такой же как у G-CSF дикого типа.

Таким образом, с помощью способа по настоящему изобретению получают G-CSF, предназначенный для фармацевтических применений.

Описание чертежей

Фигура 1 демонстрирует анализ человеческого G-CSF дикого типа с сигнальным пептидом дикого типа с использованием программы «TargetP».

Фигура 2 демонстрирует анализ человеческого G-CSF дикого типа с сигнальным пептидом SP9 с использованием программы «TargetP».

Фигура 3 демонстрирует анализ человеческого G-CSF дикого типа с сигнальным пептидом SP10 с использованием программы «TargetP».

Фигура 4 демонстрирует экспрессию зрелого белка G-CSF в клетках HEK293F с использованием конструктов, кодирующих белки-предшественники с сигнальным пептидом дикого типа (уровень экспрессии 100%), с сигнальными пептидами SP9 или SP10, соответственно.

Фигура 5 демонстрирует хроматограмму аминоконцевого аминокислотного секвенирования (деградация Эдмана) человеческого G-CSF дикого типа с сигнальным пептидом SP9. Фигуры 5а-5е соответствуют остаткам 1-5. Результат анализа аминокислотной последовательности приведен в таблице ниже.

Фигура 6 демонстрирует хроматограмму аминоконцевого аминокислотного секвенирования (деградация Эдмана) человеческого G-CSF дикого типа с сигнальным пептидом SP10. Фигуры 6а-6е соответствуют остаткам 1-5. Результат анализа аминокислотной последовательности приведен в таблице ниже.

Фигура 7 демонстрирует хроматограмму аминоконцевого аминокислотного секвенирования (деградация Эдмана) «GRANOCYTE». Фигуры 7а-7е соответствуют остаткам 1-5. Результат анализа аминокислотной последовательности приведен в таблице ниже.

Фигура 8 демонстрирует хроматограмму аминоконцевого аминокислотного секвенирования (деградация Эдмана) человеческого G-CSF дикого типа с сигнальным пептидом дикого типа. Фигуры 8а-8е соответствуют остаткам 1-5. Результат анализа аминокислотной последовательности приведен в таблице ниже.

Фигура 9 демонстрирует сравнение количества полноразмерных G-CSF для 2 типичных клонов, полученных в результате выделения клонов при стабильной трансфекции с помощью G-CSF-SP9, Оставшаяся неполноразмерная фракция содержит по большей части G-CSF, укороченный на 3 аминокислоты по N-концу. Черта 99% коррелирует с N-концевым укорачиванием <1%, которое ниже предела обнаружения анализа.

Фигура 10 демонстрирует сравнение количества полноразмерного G-CSF на примере клона 1 для различных рН культивирования в реакционном аппарате с мешалкой. Клон 1 был получен в результате выделения клона со стабильной трансфекцией вектора G-CSF-SP9.

Оставшаяся неполноразмерная фракция содержит, главным образом, G-CSF, укороченный по N-конпу на 3 аминокислоты. Количество полноразмерного G-CSF из эталонного культивирования для клона 1 во встряхиваемых флаконах (без рН-контроля) изображено на первой панели серым цветом. Черта 99% коррелирует с N-концевым укорачиванием <1%, которое ниже предела обнаружения анализа.

Фигура 11 демонстрирует сравнение соотношения полноразмерного G-CSF на примере клона 2 для различных рН культивирования при культивировании в реакционном аппарате с мешалкой. Клон 2 был получен в результате выделения клона со стабильной трансфекцией вектора G-CSF-SP9. Оставшаяся неполноразмерная фракция содержит, главным образом, G-CSF, укороченный по N-концу на 3 аминокислоты. Количество полноразмерного G-CSF из эталонного культивирования для клона 2 во встряхиваемых флаконах (без рН-контроля) изображено на первой панели серым цветом. Черта 99% коррелирует с N-концевым укорачиванием <1%, которое ниже предела обнаружения анализа.

Фигура 12 демонстрирует сравнение количества полноразмерного G-CSF на примере клона 2 для различных концентраций инсулина в культуральной среде. Клон 2 получают в результате выделения клона после стабильной трансфекции с помощью G-CSF-SP9-вектора. Оставшаяся неполноразмерная фракция содержит, главным образом, G-CSF, укороченный по N-концу на 3 аминокислоты. Черта 99% коррелирует с N-концевым укорачиванием <1%, которое ниже предела обнаружения анализа.

Фигура 13 демонстрирует сравнение количества полноразмерного G-CSF для различных дней культивирования на примере клона 2, культивированного крупномасштабным способом с высокой плотностью клеток с применением 15 мг/л инсулина в культуральной среде в отсутствие рН-контроля. Клон 2 был получен в результате выделения клона после стабильной трансфекции вектором G-CSF-SP9. Оставшаяся неполноразмерная фракция содержит, главным образом, G-CSF, укороченный по N-концу на 3 аминокислоты. Черта 99% коррелирует с N-концевым укорачиванием <1%, которое ниже предела обнаружения анализа.

Сведения, подтверждающие возможность осуществления измерения

Пример 1

Оптимизация пептида предшественника G-CSF для получения корректного белка кДНК изоформы b человеческого G-CSF дикого типа опубликована в базе данных GenBank (NM_172219). По существу любой белок предшественник G-CSF, содержащий любую последовательность с происхождением из NM_172219, используется для модификации последовательности сигнального пептида по настоящему изобретению. В типичном воплощении белок-предшественник содержит последовательность, представленную в настоящем документе в виде SEQ ID NO:1 (GenBank NP_757373):

MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Непроцессированный белок-предшественник G-CSF дикого типа (SEQ ID NO:1) содержит 204 аминокислоты, включая 30 аминокислот сигнального пептида. Как опубликовано, процессинг осуществляется между остатками Ala30 и Thr31 (GenBank NP_757373).

Последние литературные данные описывают консенсусную последовательность эукариотического сигнального пептида и функцию комплекса сигнальных пептидаз (Rapoport, 2007, Nature 450 (29), 663-669; Tuteja, 2005, Arch Biochem Biophys 441, 107-111; Dalbey et al., 1997, Protein Science 6, 1129-1138).

Аминокислотную последовательность сигнального пептида G-CSF сравнивали с предполагаемыми особенностями консенсусного сигнального пептида, описанного выше. Было обнаружено, что несколько аминокислотных остатков не удовлетворяют предполагаемой модели. Подробно, предполагаемый мотив Ala-X-Ala в С-концевой области сигнального пептида, который, как предполагается, является критическим для точного отщепления, нарушается заряженной аминокислотой (Glu29) в пептиде-предшественнике G-CSF. Кроме того, заряженные остатки Lys11 и His21 локализованы в гидрофобном участке сигнального пептида и, таким образом, не согласуются с требованиями модели.

Сигнальный пептид G-CSF дикого типа анализировали in silico с помощью программного обеспечения «SignalP» и «TargetP» (www.cbs.dtu.dk/services; Emanuelsson et al., 2007, Nature Protocols 2, 953-971). Программное обеспечение продемонстрировало, что процессинг прогнозируется в корректном N-концевом положении G-CSF (Thr31), но также дополнительно в нескольких других сайтах (фиг.1). Однако процессинг в сайте укорачивания (Gly34), не был спрогнозирован с помощью этого программного обеспечения.

Пример 2

Сигнальный пептид G-CSF дикого типа моделировали in silico путем минимальных изменений в его аминокислотной последовательности по отношению к указанной выше модели гипотетической сигнальной пептидазы. Полученное в результате положение отщепления снова анализировали с использованием программного обеспечения «SignalP» и «TargetP». Прогноз несколько in silico разработанных моделей, названных, например, SP9 G-CSF и SP10 G-CSF, в результате дал только корректное положение (Thr31) для процессинга G-CSF, которое было принято в качестве подсказки для оптимизированного сигнального пептида (см. фиг.2 и фиг.3 для in silico анализа сайтов отщепления SP9 G-CSF и SP10 G-CSF, соответственно). Несколько таких конструктов выбирали для генного синтеза (GeneArt, Регенсбург, Германия). Синтетические гены, кодирующие пептиды SP9 G-CSF и SP10 G-CSF, соответственно, клонировали в эукариотический экспрессирующий вектор и использовали для трансфекции клеток HEK293F.

Пример 3

Белок-предшественник SP9 G-CSF

Белок-предшественник SP9 G-CSF был получен из последовательности сигнального пептида дикого типа человеческого белка-предшественника G-CSF (SEQ ID NO:1). Конкретно, глутаминовую кислоту в положении 29 (Glu29) сигнального пептида дикого типа удаляли и вставляли в положение 26 (Glu26). В типичном воплощении, белок-предшественник SP9 G-CSF содержит последовательность, представленную в настоящем документе в виде SEQ ID NO:2:

MAGPATQSPMKLMALQLLLWHSALWETVQATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Пример 4

Белок-предшественник SP10 G-CSF

Белок-предшественник SP10 G-CSF получали из последовательности сигнального пептида дикого типа человеческого G-CSF (SEQ ID NO:1). Подробно, путем замены лизина в положении 11 на лейцин (Lys11Leu), гистидина 21 на фенилаланин (His21Phe) и глутамина 28 на лейцин (Gln28Leu). В типичном воплощении, пептид SP10 G-CSF содержит последовательность, представленную в настоящем документе в виде SEQ ID NO:3:

MAGPATQSPMLLMALQLLLWFSALWTVLEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKbCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRA GGVLVASHLQSFLEVSYRVLRHLAQP

Важно заметить, что несмотря изменения, сделанные в сигнальном пептиде, зрелый пептид G-CSF остается пептидом дикого типа (SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, остатки 31-204).

Пример 5

Транзиторные трансфекции экспрессирующими векторами, кодирующими SP9 G-CSF и SP10 G-CSF

Клетки HEK293F транзиторно трансфицировали экспрессирующими векторами, кодирующими SP9 G-CSF, или SP10 G-CSF, соответственно. Супернатанты собирали через три дня. Секрецию G-CSF измеряли с помощью ELISA. Данные демонстрировали уровни экспрессии, сравнимые с сигнальным пептидом G-CSF дикого типа, или даже демонстрировали более высокий уровень экспрессии (фиг.4).

G-CSF очищали до высокой степени чистоты. Очистку двух продуктов, SP9 G-CSF и SP10 G-CSF, соответственно, осуществляли подобно G-CSF дикого типа без какой-либо модификации протокола.

Пример 6

Концевые аминокислотные последовательности G-CSF дикого типа, коммерческого продукта GRANOCYTE (патент Chugai CA1341389, G-CSF, продуцированный в клетках СНО), SP9 G-CSF и SP100 G-CSF определяли с помощью деградации по Эдману (TopLab, Мартинсрид, Германия). Неожиданно, в данных двух продуктов экспрессии, SP9 G-CSF и SP10 G-CSF, обнаружили только корректный N-конец без какого-либо укорачивания (фиг.5 и фиг.6). То же самое наблюдали для «GRANOCYTE» (фиг.7). Напротив, укорачивание обнаружили для сигнального пептида G-CSF дикого типа (фиг.8) - и для нескольких других конструктов, хотя только один сайт отщепления был спрогнозирован in silico с помощью «SignalP» или «TargetP» (не показано).

Пример 7

Активность SP9 G-CSF и SP10 G-CSF измеряли с помощью анализа клеточной пролиферации и сравнивали с «GRANOCYTE». Активность клеточной пролиферации SP9 G-CSF и SP10 G-CSF была выше по отношению к «Granocyte».

Пример 8

Гликозилирование SP9 G-CSF и SP10 G-CSF определяли с помощью анализа «фингерпринта» массы пептида с использованием MALDI TOF (времяпролетный масс-анализатор с матрично-активированной лазерной десорбцией/ионизацией) с использованием матрицы после гидролиза GluC. Отражающий спектр продемонстрировал отсутствие какого-либо отличия SP9 G-CSF или SP10 G-CSF по отношению к G-CSF, продуцированному клетками HEK293F.

Пример 9

Оценка клонов, полученных в результате стабильной трансфекции экспрессирующим вектором, кодирующим SP9 G-CSF.

Клетки HEK293F стабильно трансфицировали экспрессирующим вектором, кодирующим SP9 G-CSF. Гомогенные клоны выделяли после стабильной трансфекции. Супернатанты выбранных клонов анализировали для различных масштабов ферментации. Для этого G-CSF очищали до высокой степени чистоты из собранных супернатантов и оценивали относительно их аминоконцевых последовательностей, профиля гликозилирования и активности.

Наблюдали, что хотя N-концевое укорачивание на 3 аминокислоты не наблюдалось для полученных в результате супернатантов SP9 G-CSP, которые анализировали в транзиторном пуле трансфекции, укорачивание на 3 аминокислоты не может быть полностью подавлено для некоторых клонов. Этот эффект носил клонозависимый характер и кроме того, зависел от масштаба культивирования и условий культивирования.

Клонозависимый характер (фиг.9) предполагал, что модификация последовательности сигнального пептида G-CSF, полученного из вектора SP9 G-CSF, по большей части поддерживает корректное отщепление сигнального пептида; тем не менее, на 100% корректное отщепление влияет клоноспецифичный метаболизм.

Главным способом влияния на клоноспецифичный метаболизм является применение оптимизированных условий культивирования.

Влияние рН культивирования на корректное отщепление последовательности сигнального пептида G-CSF оценивали для 2 типичных клонов. Оба клона культивировали в лабораторных реакционных аппаратах с мешалкой, каждый при определенном значении рН, составляющем 6,6; 6,8; 7 и 7,2. Супернатанты, содержащие G-CSF, очищали до высокой степени чистоты и оценивали относительно их аминоконцевой последовательности (фиг.10 и фиг.11). Для обоих типичных клонов наблюдали, что корректный процессинг последовательности сигнального пептида, который приводит в результате к получению соотношения полноразмерного G-CSF >99%, может быть достигнут путем контроля рН клеточного культивирования клонов G-CSF до значения рН 7,2. Значение >99% соответствует меньшему пределу обнаружения метода секвенирования, составляющему 1%.

Пример 10

Культивирование в колбах с мешалкой без контроля рН и с вариацией концентрации инсулина в культуральной среде осуществляли на примере одного клона. Концентрации инсулина изменяли в интервале от 5 мг/л инсулина до 20 мг/л инсулина. Супернатанты, содержащие G-CSF, очищали до высокой степени чистоты и оценивали их аминоконцевые последовательности (фиг.12). На примере оцениваемого клона наблюдали, что оптимизация концентрации инсулина в культуральной среде до интервала от 15 до 20 мг/л инсулина для случая условий культивирования рН-контроля привела в результате к получению корректного процессинга последовательности сигнального пептида.

Крупномасштабное культивирование с высокой плотностью клеток с использованием перфузионного способа обеспечения среды осуществляли на примере одного клона. рН культивирования не контролировали и оно изменялось во время культивирования в интервале от 6,8 до 7,2. Концентрацию инсулина в культуральной среде регулировали до оптимизированной концентрации, составляющей 15 мг/л инсулина. Супернатанты, содержащие G-CSF, из 4 выбранных моментов культивирования, соответствующих дням культивирования 6, 7, 17 и 21, очищали до высокой степени чистоты и оценивали их аминоконцевые последовательности (фиг.13). Корректного процессинга последовательности сигнального пептида, приводящий к получению >99% полноразмерного G-CSF, достигали для всех анализируемых супернатантов независимо от плотности клеток и продуктивности G-CSF. Применение оптимизированной концентрации инсулина, составляющей 15 мг/л, таким образом, эффективно для того, чтобы избежать N-концевого укорачивания при крупномасштабных культивированиях с высокой плотностью клеток.

1. G-CSF-предшественник, содержащий сигнальный пептид и G-CSF-пептид, где сигнальный пептид содержит последовательность человеческого сигнального пептида дикого типа молекулы человеческого G-CSF/b SEQ ID NO: 4, содержащую, по меньшей мере, одну мутацию, выбранную из группы, состоящей из:
- делеции Glu29,
- замены His21Phe, и
- замены Gln28Leu.

2. G-CSF-предшественник по п.1, дополнительно содержащий по меньшей мере одну из следующих мутаций:
- вставки Glu26,
- замены Lys 11Leu.

3. G-CSF-предшественник по п.1, содержащий, по меньшей мере, две или, по меньшей мере, три мутации по п.1.

4. Полинуклеотид, кодирующий G-CSF-предшественник по любому из пп. 1-3.

5. Вектор, экспрессирующий G-CSF-предшественник по любому из пп. 1-3, содержащий полинуклеотид по п.4.

6. Трансфицированная клетка, экспрессирующая G-CSF-предшественник по любому из пп. 1-3, содержащая полинуклеотид по п.4 или вектор по п.5.

7. Трансфицированная клетка по п.6, которая представляет собой клетку НЕК293, более предпочтительно клетку HEK293F.

8. Трансфицированная клетка по п. 6 или 7, где трансфекция является транзиторной.

9. Трансфицированная клетка по п. 6 или 7, где трансфекция является стабильной.

10. Способ получения G-CSF, содержащий стадии:
- культивирования трансфицированных клеток по любому из пп. 6-9 в подходящей культуральной среде и
- выделение G-CSF из культуральной среды.

11. Способ по п.10, где культивирование осуществляют при pH в интервале 6,8-7,5, предпочтительно 7,1-7,3.

12. Способ по п.10, где культивирование осуществляют в присутствии инсулина с концентрацией в интервале 5-25 мг/мл, предпочтительно 15-25 мг/мл, более предпочтительно 15-20 мг/мл.

13. Способ по любому из пп. 10-12, где культуральная среда является бессывороточной.



 

Похожие патенты:

Изобретение относится к области биотехнологии и иммунологии. Описаны биспецифические антитела против фактора роста сосудистого эндотелия человека VEGF и ангиопоэтина-2 человека ANG-2, способы их получения, фармацевтические композиции, содержащие указанные антитела, и их применения.

Изобретение относится к области биотехнологии. Описаны антисмысловые соединения, способы снижения уровня фактора 11 и способы лечения или предупреждения тромбоэмболических осложнений у индивидуума, нуждающегося в этом.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению G-CSF, и может быть использовано для продуцирования G-CSF в клетках Е.coli. Для эффективной продукции белка в клетках Е.coli оптимизируют последовательность ДНК, кодирующую G-CSF.

Изобретение относится к биотехнологии, в частности к генно-инженерному получению белков человека, и может быть использовано для получения эпидермального фактора роста человека (чЭФР) в клетках бактерий в виде гибридного белка с глутатион-3-трансферазой.

Изобретение относится к области генной инженерии, конкретно к созданию мутеинов рецептора фактора роста фибробластов (FGFR), и может быть использовано в медицине. Полипептид мутеина кислотной зоны внеклеточного домена (ECD) рецептора FGFR4 представляет собой химеру кислотной зоны FGFR4 ECD или вариант длинного кислотного бокса FGFR4 и имеет большее количество кислотных остатков в линкерной зоне D1-D2, чем FGFR4 ECD дикого типа.

Изобретение относится к области биотехнологии, конкретно к вакцинации с использованием нуклеиновых кислот, и может быть использовано в медицине. .

Изобретение относится к области биотехнологии, а именно к получению генно-модифицированных клеточных линий, и может быть использовано в медицине для иммунотерапии и иммунопрофилактики у пациентов со злокачественными новообразованиями.

Изобретение относится к генетической инженерии и может быть использовано для получения рекомбинантного полипептида гранулоцитарного колониестимулирующего фактора человека.

Изобретение относится к области экспериментальной медицины и может быть использовано для создания нового антидиабетического препарата. .
Изобретение относится к области биотехнологии, конкретно к стимуляции выработки гранулоцитарного колониестимулирующего фактора (Г-КСФ) клетками костного мозга, и может быть использовано в медицине.

Изобретение относится к биотехнологии и представляет собой онколитический аденовирусный вектор, клетку и фармацевтическую композицию, содержащую указанный вектор, а также применение указанных векторов в производстве лекарственного средства для лечения рака у субъекта и к способу лечения рака у субъекта.

Изобретение относится к способу улучшения выхода реакции пегилирования r-metHuG-CSF, включающему конъюгацию r-metHuG-CSF с ПЭГ-альдегидом по свободной аминогруппе в N-конце r-metHuG-CSF в присутствии восстановителя в буферном растворе для пегилирования, включающем полиол формулы CnH2n+2O n, где n равен 3-6, или углевод, или его производное, где концентрация указанного полиола или углевода, или его производного находится в интервале 0,1%-10%, мас./мас.

Изобретение относится к области биотехнологии, конкретно к получению ПЭГилированного гранулоцитарного колониестимулирующего фактора (Г-КСФ), и может быть использовано в медицине.

Изобретение относится к области биотехнологии и генетической инженерии, а именно к генно-инженерной конструкции pGoatcasGCSF для экспрессии гранулоцит-колониестимулирующего фактора человека (Г-КСФ).

Изобретение относится к способу выделения биологически активного гранулоцитарного колониестимулирующего фактора (G-CSF). .

Изобретение относится к области биотехнологии, конкретно к получению новых пептидов, и может быть использовано в лечении и профилактике цитокинзависимых нарушений.

Изобретение относится к области биотехнологии, конкретно, к выделению кроветворных стволовых клеток, и может быть использовано для трансплантации. .

Изобретение относится к биотехнологии, в частности к получению противоопухолевых лекарственных средств для генной терапии, и может быть использовано в медицине. Получают лекарственное противоопухолевое средство, содержащее генную конструкцию в форме плазмидной ДНК, включающей гены тимидинкиназы вируса простого герпеса (HSVtk) и гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF), заключенную в полимерный носитель - сополимер полиэтиленгликоль-полиэтиленимин-тat пептид (ПЭГ-ПЭИ-ТАТ). При этом генная конструкция обеспечивает экспрессию обоих терапевтических генов HSVtk и GM-CSF с одного вектора. Генная конструкция предназначена для интратуморального введения в режиме прогрессивно увеличивающейся разовой дозы, рассчитываемой в зависимости от объема опухоли, с последующим введением пролекарства - ганцикловира. Изобретение обеспечивает эффективную доставку и проникновение в клетки опухоли плазмиды pCMV-HSVtk-GM-CSF и позволяет с большой эффективностью избирательно уничтожать раковые клетки с предотвращением дальнейшего метастазирования. 2 н. и 6 з.п. ф-лы, 9 ил., 16 табл., 7 пр.
Наверх