Варианты плазминогена и плазмина

Авторы патента:


Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина
Варианты плазминогена и плазмина

 


Владельцы патента RU 2564131:

ТромбоДженикс НВ (BE)

Изобретение относится к области биотехнологии, конкретно к получению вариантов плазминогена и плазмина, содержащих одну или несколько точковых мутаций в каталитическом домене, которые снижают или предотвращают аутокаталитическую потерю протеазной активности плазмина, и может быть использовано в медицине. Изобретение позволяет получить аутопротеолитически стабильный плазмин. 26 н. и 25 з.п. ф-лы, 10 ил., 3 табл., 5 пр.

 

Область изобретения

Данное изобретение относится к вариантам плазминогена и плазмина, содержащим одну или несколько точковых мутаций в каталитическом домене, которые снижают или предотвращают аутокаталитическую потерю протеазной активности плазмина. Также раскрываются композиции, применения и способы применения указанных вариантов плазминогена и плазмина.

ПРЕДПОСЫЛКИ ДАННОГО ИЗОБРЕТЕНИЯ

Активация зимогена плазминогена приводит к образованию фибринолитически/тромболитически активной сериновой протеиназы - плазмина. Активация эндогенного плазминогена может быть запущена или усилена введением активатора плазминогена, такого как урокиназа, стрептокиназа, стафилокиназа или tPA, или любого их варианта. При активации белок плазминоген протеолитически расщепляется до тяжелой цепи, содержащей 5 доменов «двойная петля», и легкой цепи, содержащей каталитический домен. Обе цепи скрепляются вместе посредством 2 дисульфидных связей. После активации аутолитическое расщепление удаляет N-концевой сегмент из тяжелой цепи (78 аминокислот плазмина человека; 77 аминокислот бычьего плазмина) и тяжелая цепь бычьего плазмина может быть дополнительно аутокаталитически расщеплена между доменами типа «двойная петля» 3 и 4, таким образом давая в результате бычий мидиплазмин (Christensen et al. 1995, Biochem J 305, 97-102). Активация плазминогена до плазмина, запущенная с помощью расщепления R561-V562 пептидной связи в плазминогене человека, вызывает большое конформационное изменение в легкой цепи, где указанное изменение приводит к примированию, или активации, каталитической триады внутри указанной легкой цепи. Бактериальные активаторы плазминогена, такие как стрептокиназа и стафилокиназа, формируют комплекс с плазминогеном, и без расщепления пептидной связи R561-V562 плазминогена каталитический сайт плазминогена активируется посредством конформационных изменений при образовании комплекса активатор-плазминоген (механизмы активации плазминогена подытожены в, например, разделе Введение Terzyan et al. 2004; Proteins 56: 277-284).

Поскольку активаторы плазминогена действуют как непрямые тромболитические средства, то альтернативно было предложено применение плазмина самого по себе в качестве прямого фибринолитического/тромболитического средства. Такое прямое применение, однако, затрудняется из-за того факта, что плазмин, подобно многим протеазам, подвергается аутокаталитическому протеолитическому распаду, кинетикой уравнения реакции второго порядка при условии игибирования (Jespersen et al. 1986, Thrombosis Research 41, 395-404).

В начале 1960-х было установлено, что плазмин может быть стабилизирован в кислом pH, или, альтернативно, в нейтральном pH, при условии присутствия аминокислоты, такой как лизин. Тем не менее, сообщалось, что имело место аутолитическое расщепление после Lys104, Arg189 и Lys622 (нумерация относительно Lys-плазмина) даже если плазмин хранили при pH 3,8 (WO01/36608). При хранении плазмина при еще более низком pH, равном 2,2, не-аутолитическое кислотное расщепление происходит между Asp-Pro (D-P) в положениях Asp62, Asp154 и Asp346 (WO01/36608). Это иллюстрирует, что pH может быть понижено до точки, где больше не возникает очевидный аутокаталитический распад, но при которой кислотный гидролиз становится фактором дестабилизации. Отсутствует информация в WO01/36608 в отношении того, что пептидные связи в плазмине являются чувствительными к (аутокаталитическому) гидролизу при нейтральном pH. Известные стабилизаторы плазмина включают глицерин, достаточно высокую ионную силу, фибриноген и ε-аминокапроновую кислоту (EACA), как раскрывается Jespersen et al. (1986, Thromb Res 41, 395-404). Лизин и лизиновые производные (такие как EACA и транексамовая кислота) и p-аминометилбензойная кислота (PAMBA) являются некоторыми дополнительными известными стабилизаторами (Uehsima et al. 1996, Clin Chim Acta 245, 7-18; Verstraete 1985, Drugs 29, 236-261). Патент США №4462980 сообщал об образовании плазминовых агрегатов, которые вносили свой вклад в распад плазмина, несмотря на хранение в кислотных условиях. Решение этой проблемы было представлено в Патенте США №4462980 посредством добавления полигидроксидного соединения. Другие пути стабилизации плазмина включают добавление олигопептидных соединений (например, патент США №5879923). Альтернативно, каталитический сайт плазмина может быть обратимо блокирован посредством дериватизации, например, ацилирования (европейский патент №EP 0009879). Пегилирование плазмина также было предложено как средство стабилизации фермент (WO 93/15189).

Описан ряд вариантов плазмина, отличных от процессированных форм плазмина, и он включает химерный микроплазмин (WO 2004/045558) и варианты с точковой мутацией в сайте расщепления двух цепей (Патент США №5087572) или в аминокислоте каталитической триады (Mhashilkar et al. 1993, Proc Natl Acad Sci USA 90, 5374-5377; Wang et al., 2001, J Mol Biol 295, 903-914). Wang et al. (1995, Protein Science 4, 1758-1767 и 1768-1779) сообщали о широком ряде мутантов микроплазминогена по аминокислотным положениям 545, 548, 550, 555, 556, 558, 560-564, 585, 740 и 788. Двойной мутант, где цистеины в аминокислотных положениях 558 и 566 были замещены на серины, описывался в Linde et al. (1998, Eur J Biochem 251, 472-479). Takeda-Shitaka et al. (1999, Chem Pharm Bull 47, 322-328) приводят вариант плазмина с уменьшенной активностью, где изменение включает замещение аланина в аминокислотном положении 601 на треонин. Все аминокислотные положения, приведенные выше, считаются относительно Glu-плазминогена, начиная с Glu в аминокислотном положении 1. Нерасщепляемый вариант плазминогена (расщепление между тяжелой и легкой цепью нарушено) описан в WO 91/08297. Dawson et al. (1994, Biochemistry 33, 12042-12047) описывают уменьшенную аффинность для стрептокиназы варианта Glu-плазминогена с Glu вместо Arg в положении 719 (R719E). Jespers et al. (1998, Biochemistry 37, 6380-6386) получили при сканировании по Ala ряд полученных с помощью фагового дисплея моносайтовых мутантов микроплазминогена H569A, R610A, K615A, D660A, Y672A, R712A, R719A, T782A, R789A, и обнаружили, что аргинин в положении 719 является ключевым для взаимодействия со стафилокиназой; мутант D660A не был дополнительно охарактеризован из-за очень низкой экспрессии; только мутант R719A был дополнительно получен в растворимой форме. Ни один из мутантов не показал существенного изменения в протеолитической активности (субстрат S-2403). Jespers et al. (1998) также включили в их анализ мутанта с активным сайтом S741A; кристаллическая структура этого мутанта раскрыта в Wang et al. (2000, J Mol Biol 295, 903-914). В дальнейших попытках обнаружить сайты взаимодействия стрептокиназа/плазминоген, Terzyan et al. (2004, Proteins 56, 277-284) сообщали о ряде мутантов микроплазминогена (K698M, D740N, S741A) в уже мутированном окружении (R561A), последнее подавляло протеолитическую активацию плазминогена и, таким образом, подавляло образование активного микроплазмина (который будет затруднять изучение механизма контакт-активации комплекса стрептокиназа-микроплазминоген). Terzyan et al. (2004) дополнительно упоминают “произвольный” тройной мутант R561A/H569Y/K698M очевидно функционально не отличающийся от двойного мутанта R561A/K698M. Wang et al. (2000, Eur J Biochem 267, 3994-4001) при изучении взаимодействия стрептокиназа/плазмина(плазминогена) получили набор мутантов микроплазминогена (аминокислоты 530-791 Glu-плазминогена) в Cys536Ala и Cys541Ser окружении. Эти мутанты включают мутацию R561A, как описано выше (Terzyan et al. (2004)), а также двойные мутанты R561A/K698G, R561A/K698A и R561A/K698Q. В такое же C536A/C541S окружении были введены также отдельные мутации K698G и K698A, из которых K698G не была в дальнейшем охарактеризована из-за трудностей с очисткой. Описанные выше исследования были направлены на достижение лучшего понимания характеристик молекулы плазминогена/плазмина и не сообщают о какой-либо клинической пользе или преимуществе или предполагаемых клинических преимуществах мутантов плазминогена/плазмина. Peisach et al. (1999, Biochemistry 38, 11180-11188) добились успеха в определении кристаллической структуры микроплазминогена, содержащего мутации M585Q, V673M и M788L.

Nguyen и Chrambach (1981, Preparative Biochem 11, 159-172) сообщили о присутствии “минорного и неидентифицированного белкового компонента” 10,0 кДа на основе SDS-PAGE в восстанавливающих условиях сырого коммерческого препарата урокиназа-активированного плазмина (Homolysin). Отличия в аутолизе плазмина человека в зависимости от pH были описаны детально Shi и Wu (1988, Thrombosis Research 51, 355-364). Ohyama et al. (2004, Eur J Biochem 271, 809-820) предложили применение нелизиновых аналоговых модуляторов плазминогена при лечении рака благодаря усилению аутопротеолиза плазмина такими соединениями, которые приводят к усиленному образованию ангиостатинов (в присутствии урокиназного активатора плазминогена). Таблица 3 в Ohyama et al. (2004) приводит по меньшей мере 15 сайтов расщепления в плазмине, подвергнутом действию усиливающих аутопротеолиз соединений. При обсуждении их наблюдений в свете ранее проведенных исследований считается вероятным, что усиливающие аутопротеолиз соединения являются более или менее селективно усиливающими протеолиз B/легкой цепи, поскольку минимальный распад как A/тяжелой-, так и B-цепи обнаружен при отсутствии усиливающих аутопротеолиз соединений.

Ясно, что ни один из описанных выше способов/вариантов не решал проблему получения плазмина, стабилизированного на молекулярном уровне. Обеспечение варианта плазмина (или соответствующего варианта плазминогена, из которого может быть получен плазмин) с каталитическим доменом, по сути являющимся устойчивым к аутокаталитическому распаду, будет значительным шагом вперед по направлению к эффективному и безопасному длительному хранению, а также по направлению к эффективному и безопасному терапевтическому применению плазмина, например при тромболитической терапии или при индукции заднего отслоения стекловидного тела или разжижения стекловидного тела глаза.

Краткое описание данного изобретения

Данное изобретение относится к выделенным вариантам плазминогена или плазминам, полученным из них, или к выделенным вариантам плазмина, или к протеолитически активным или обратимым неактивным производным любого из указанных плазминов, характеризующихся тем, что указанные варианты плазминогена или плазмина или указанные производные содержат в их каталитическом домене мутацию по меньшей мере одной внутренней аминокислоты в положении P, пептидная связь которой с внутренней аминокислотой в положении P+1 склонна к аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P+1 является менее склонной или не склонна к аутопротеолизу.

Альтернативно, вариант плазминогена, вариант плазмина или производное плазмина по данному изобретению содержит в его каталитическом домене мутацию по меньшей мере двух внутренних аминокислот в положениях P и P', пептидная связь которых с внутренними аминокислотами в положениях P+1 и P'+1 склонна к аутопротеолизу в аминокислоты, пептидная связь которых с внутренними аминокислотами в положениях P+1 и P'+1 является менее склонной или не склонна к аутопротеолизу.

В частности, указанные внутренние аминокислоты в положениях P или P и P' представляют собой лизины или аргинины.

Более конкретно, указанная по меньшей мере одна или две внутренние аминокислоты в положении P или в положениях P и P' могут быть по меньшей мере одной или по меньшей мере двумя из следующего:

(i) лизин в положении 137 каталитического домена плазмина человека или соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку;

(ii) лизин в положении 147 каталитического домена плазмина человека или соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку; или

(iii) аргинин в положении 158 каталитического домена плазмина человека или соответствующий аргинин или лизин каталитического домена плазмина, не принадлежащего человеку;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

Альтернативно, указанная по меньшей мере одна внутренняя аминокислота в положении P представляет собой лизин в положении 147 каталитического домена плазмина человека или представляет собой соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека. Необязательно, варианты плазминогена, варианты плазмина или производные плазмина с мутацией лизина в положении 147 каталитического домена плазмина человека (или соответствующего лизина или аргинина каталитического домена плазмина, не принадлежащего человеку) могут дополнительно содержать мутацию внутренних аминокислот в положениях 137 и/или 158 каталитического домена человека или соответствующих лизинов и/или аргининов каталитического домена плазмина, не принадлежащего человеку, где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

В дополнительной альтернативе варианты плазминогена, варианты плазмина или производные плазмина по данному изобретению являются такими, что:

(i) если мутация указанной по меньшей мере одной внутренней аминокислоты в положении P представляет собой мутацию лизина в положении 137 каталитического домена плазмина человека (которое является аминокислотным положением 698 относительно Glu-плазминогена человека) в аминокислоту, делая пептидную связь между аминокислотами 137 и 138 более устойчивой к аутопротеолизу, то указанный вариант плазминогена, вариант плазмина или производное плазмина содержит интактный сайт активации в аминокислотных положениях 561 и 562 (относительно Glu-плазминогена человека), и если аминокислоты в положении 536 и 541 (относительно Glu-плазминогена человека) присутствуют снаружи каталитического домена, то указанные аминокислоты представляют собой цистеины дикого типа, или

(ii) если мутация указанной по меньшей мере одной внутренней аминокислоты в положении P представляет собой мутацию аргинина в положении 158 каталитического домена плазмина человека (которое является аминокислотным положением 719 относительно Glu-плазминогена человека) в аланин или глутамат, то по меньшей мере одна другая внутренняя аминокислота каталитического домена плазмина человека в положении P', пептидная связь которой с внутренней аминокислотой в положении P'+1, склонна к аутопротеолизу, мутирована в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P'+1 является менее склонной или не склонна к аутопротеолизу.

Вариант плазминогена, вариант плазмина или производное плазмина согласно (i) или (ii), приведенных выше, может дополнительно содержать мутацию внутренней аминокислоты в положении 147 каталитического домена человека или соответствующего лизина или аргинина каталитического домена плазмина, не принадлежащего человеку, где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

Любой из вариантов плазминогена, вариантов плазмина или производных плазмина по данному изобретению может дополнительно характеризоваться тем, что его константа аутолиза составляет не более чем 95% от константы аутолиза плазмина дикого типа.

Любой из вариантов плазминогена, вариантов плазмина или производных плазмина по данному изобретению может дополнительно характеризоваться тем, что каталитическая константа kкат находится в диапазоне 10% - 200% от kкат плазмина дикого типа.

Любой из вариантов плазминогена, вариантов плазмина или производных плазмина по данному изобретению может дополнительно характеризоваться тем, что его константа аутолиза составляет не более чем 95% от константы аутолиза плазмина дикого типа, и его каталитическая константа kкат находится в диапазоне 10% - 200% от kкат плазмина дикого типа.

Без какого-либо ограничения, любой из выше перечисленных вариантов плазминогена, вариантов плазмина или производных плазмина по данному изобретению может быть одним из следующего: Glu-плазминоген или Glu-плазмин, Lys-плазминоген или Lys-плазмин, мидиплазминоген или мидиплазмин, миниплазминоген или миниплазмин, микроплазминоген или микроплазмин, дельтаплазминоген или дельтаплазмин.

Данное изобретение дополнительно относится к выделенным вариантам плазминогена, вариантам плазмина или производным плазмина по данному изобретению или комбинации любых из них для применения в качестве лекарственного препарата.

Данное изобретение также относится к композициям, содержащим выделенный вариант плазминогена, вариант плазмина или производное плазмина по данному изобретению или комбинацию любого из них и по меньшей мере одно из следующего: фармацевтически приемлемый разбавитель, носитель или вспомогательное средство. Такая композиция может необязательно дополнительно содержать по меньшей мере одно из следующего: антикоагулянт, тромболитическое средство, противовоспалительное средство, противовирусное средство, антибактериальное средство, противогрибковое средство, антиангиогенное средство, антимитотическое средство, антигистаминное средство или анестетик.

Данное изобретение также включает любое полезное применение выделенного варианта плазминогена, варианта плазмина или производного плазмина по данному изобретению. Без какого-либо ограничения, они включают следующее: индуцирование или стимулирование лизиса патологического отложения фибрина у субъекта, индуцирование заднего отслоения стекловидного тела глаза и/или для индуцирования разжижения стекловидного тела глаза, облегчение хирургической витрэктомии глаза у субъекта, ферментное очищение раны поврежденной ткани субъекта, снижение циркулирующего фибриногена у субъекта, снижение уровней α2-антиплазмина у субъекта, снижение риска патологического отложения фибрина.

Данное изобретение дополнительно относится к способам скрининга в отношении аутопротеолитически стабильного варианта плазмина, где указанные способы включают этапы следующего:

(i) определение в каталитическом домене плазмина дикого типа по меньшей мере одной внутренней аминокислоты в положении P, пептидная связь которой с внутренней аминокислотой в положении P+1 склонна к аутопротеолизу,

(ii) мутирование аминокислоты в положении P, определенной в (i), в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P+1 является менее склонной или не склонна к аутопротеолизу,

(iii) определение аутопротеолитической стабильности мутанта, полученного в результате (ii), и

(iv) отбор из (iii) мутанта, который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта.

Альтернативно, такие способы скрининга в отношении аутопротеолитически стабильного варианта плазмина могут включать этапы следующего:

(i) мутирование одной или нескольких аминокислот аргинина или лизина в положениях 137, 147 и 158 каталитического домена плазмина человека или соответствующих аргининов или лизинов плазмина, не принадлежащего человеку, в аминокислоту, отличающуюся от природной аминокислоты,

(ii) определение аутопротеолитической стабильности мутанта, полученного в результате (i) и

(iii) отбор из (ii) мутанта, который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта плазмина;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

Любой из выше перечисленных способов скрининга может необязательно дополнительно включать этап, где определяют протеолитическую активность аутопротеолитически стабильного варианта плазмина.

Данное изобретение дополнительно включает способы улучшения стабильности при длительном хранении плазмин-содержащей композиции, где указанные способы включают этап определения аутопротеолитически стабильного варианта плазмина, способного храниться в течение длительного периода времени без существенной потери протеолитической активности.

Данное изобретение дополнительно включает способы получения варианта плазминогена по данному изобретению, где указанные способы включают этапы следующего:

(i) введение нуклеиновой кислоты, кодирующей плазминоген по данному изобретению, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;

(ii) выращивание клетки-хозяина, полученной в (i), в условиях и за время, достаточное для экспрессии указанного плазминогена в указанной клетке-хозяине; и

(iii) сбор плазминогена, экспресированного в (ii).

Такие способы могут необязательно дополнительно включать этап (iv), где плазминоген, собранный в (iii), очищают.

Данное изобретение аналогично включает способы получения варианта плазмина по данному изобретению, где указанные способы включают этапы следующего:

(i) введение нуклеиновой кислоты, кодирующей плазминоген по данному изобретению, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;

(ii) выращивание клетки-хозяина, полученной в (i), в условиях и за время, достаточное для экспрессии указанного плазминогена в указанной клетке-хозяине;

(iii) сбор плазминогена, экспресированного в (ii);

(iv) активация плазминогена (iii) до плазмина.

Такие способы могут дополнительно необязательно включать этап, где плазминоген, собранный в (iii), очищают до активации в (iv). Дополнительно, в любом способе получения варианта плазмина по данному изобретению активный плазмин, полученный в (iv), можно необязательно очистить. Также дополнительно активный вариант плазмина, полученный согласно способу данного изобретения, можно необязательно дериватизировать и/или обратимо инактивировать.

Данное изобретение дополнительно относится к выделенным последовательности нуклеиновых кислот, кодирующим вариант плазминогена или вариант плазмина по данному изобретению. Рекомбинантные векторы, содержащие такие нуклеиновые кислоты, являются также частью данного изобретения, также как и клетки-хозяева, трансформированные такой нуклеиновой кислотой или рекомбинантным вектором.

УСЛОВНЫЕ ОБОЗНАЧЕНИЯ НА ФигураХ

ФИГУРА 1. Аминокислотная последовательность с двойной нумерацией аминокислотных положений Glu-плазминогена дикого типа человека (1-791) и каталитического домена плазмина (1-230, аминокислотная последовательность и нумерация полужирным шрифтом). Микроплазминоген, используемый для демонстрации данного изобретения, начинается в положении аминокислоты 543 (нумерация относительно Glu-плазминогена). Выделенные аминокислоты в аминокислотных положениях 137, 147 и 158 (нумерация относительно каталитического домена плазмина), как определили, являются аминокислотами, пептидная связь которых с аминокислотами в положениях 138, 148 и 159, соответственно, является чувствительной к аутокаталитическому расщеплению. Домены «двойная петля» (полученные из информации, включенной в GenBank по номером доступа AAA36451) заключены в рамки и их аминокислотные последовательности напечатаны с заменой букв нормального шрифта на курсив. Аминокислоты каталитической триады обведены кружком.

ФИГУРА 2. Профиль эксклюзионной хроматографии (SEC) микроплазмина, полученного в широкомасштабном производстве. Собирали элюаты, соответствующие номеру фракции 5 (пре-пик 1), номерам фракций 7 и 8 (пре-пик 2), номерам фракций 10-12 (пик микроплазмина), и номерам фракций 15 и 16 (пост-пик) и материал из них подвергли секвенированию по аминокислотам с N-конца (метод Эдмана). Пик, элюирующий около номеров фракций 17-18, соответствовал пику буфера. AU: единицы поглощения.

ФИГУРА 3. Анализ SDS-PAGE в восстанавливающих условиях микроплазмина, полученного в широкомасштабном производстве. Дорожка 1: шкала молекулярных масс, где молекулярные массы обозначены слева. Дорожка 2: микроплазминоген. Дорожка 3: микроплазмин при pH 3,1. Дорожка 4: микроплазмин при pH 4,0. Дорожка 5: микроплазмин при pH 5,0. Дорожка 6: микроплазмин при pH 6,0. Дорожка 7: микроплазмин при pH 7,0. Все образцы (конечная концентрация белка 0,6 мг/мл) оставляли на 4 часов при 20°C при указанном pH и затем замораживали при -70°C. Гель окрашивали Кумасси бриллиантовым голубым. μPlg=микроплазминоген, μPl=плазмин, фронт=основной фронт геля.

ФИГУРА 4. Микроплазмин инкубировали в буфере с нейтральным pH, и образцы собирали в указанные моменты времени и анализировали с помощью SDS-PAGE (A) или вестерн-блоттинга (B). Стрелка “a” указывает на интактный микроплазмин, тогда как стрелки “b” и “c” указывают на ~ 15 кДа и ~ 10 кДа фрагменты, соответственно, которые были получены аутокаталитически.

ФИГУРА 5. Кинетика аутолиза микроплазмина, оцениваемая с помощью вестерн-блоттинга (кружки), соответствует потере активности микроплазмина (квадраты).

ФИГУРА 6. (A) Микроплазмин разводили в PBS (квадраты) или в стекловидном теле глаза свиньи (кружки) до конечной концентрации 1,53 мкМ, и остаточную концентрацию активного микроплазмина измеряли в различные моменты времени. (B) Образцы стекловидного тела глаза свиньи собирали в указанные моменты времени и анализировали с помощью вестерн-блоттинга. Стрелка указывает на ~15 кДа фрагмент.

ФИГУРА 7. (A) Иммуноаффинная хроматограмма варианта микроплазмина Lys137Met (K137M) на иммобилизированном антителе к микроплазмину. Собранные фракции элюирования имеют нумерацию 1-11 выше по оси X (объем элюирования). (B) Анализ SDS-PAGE в восстанавливающих условиях фракций элюирования иммуноаффинности, проведенный в (A). Дорожка 1: шкала молекулярных масс. Дорожка 2: фракция элюата 2. Дорожка 3: фракция элюата 3; Дорожка 4: фракция элюата 4; Дорожка 5: фракция элюата 5; Дорожка 6: фракция элюата 6; Дорожка 7: сырой супернатант. Гель был окрашен Кумасси.

ФИГУРА 8. (A) Активация варианта K137M рекомбинантной стафилокиназой. Активность достигала максимума через 10 мин (указано стрелкой), затем снижалась по мере прохождения аутолитической инактивации. (B) SDS-PAGE в восстанавливающих условиях варианта K137M, показывающий, что активация стафилокиназой является почти полной в течение 10 мин, и что потеря активности является результатом аутолитического распада, что доказывается накоплением двух фрагментов ~ 17 и ~8 кДа. Полосы 1-7 представляют образцы, собранные через 0 мин, 10 мин, 1 час, 2 час, 3 час, 6 час и 24 час после добавления стафилокиназы. (▲) Микроплазминоген, (▼) микроплазмин, (∇) фрагменты аутолитического распада. (C) HPLC анализ образцов, собранных через 0 мин, 10 мин и 6 часов после добавления стафилокиназы. HPLC-профиль, полученный через 10 мин после добавления стафилокиназы, показывает, что ~ 85% неактивного микроплазминогена превратилось в активный вид микроплазмина, и HPLC профиль при t=6 часов показывает присутствие фрагментов аутолитического распада (∇), в соответствии с SDS-гелем, показанным в (B). Площадь пика микроплазмина при t=10 мин (стрелка) использовали, чтобы рассчитать концентрацию активного вида путем сравнения со стандартной кривой, полученной с высоко очищенным микроплазмином (не показано). Все данные HPLC были получены, используя UPLC-устройства Acquity (Waters). Образцы микроплазмина типично разводили в 5 раз в 0,1% трифторуксусной кислоте (TFA), 5% ацетонитриле, и впрыскивали на BEH300 C18 UPLC-колонку Acquity (Waters), которую предварительно уравновесили в 0,1% TFA, 34% ацетонитриле. Элюирование затем проводили 34 - 44% ацетонитрилом, 1,5-мл линейным градиентом в 0,1% TFA, а белки обнаруживали с помощью последующего поглощения при 214 нм. Температура колонки поддерживали при 75°C, и все эксперименты проводили со скоростью потока 100 мкл/мин. (D) Количественный анализ вида микроплазмина K137M при t=10 мин с помощью HPLC и последующее снижение остаточной активности объединили для расчета молярной концентрации интактного, активного микроплазмина, присутствующего в образце в каждой временной точке. Данные согласовывали с Уравнением 1 (смотри Пример 3) для расчета константы второго порядка для аутолиза (k). Незакрашенные кружки (○) представляют данные для варианта K137M. Для сравнительных целей также представлен (●) сходный набор данных, полученных с другим вариантом (K147A-R158A).

ФИГУРА 9. Определение кинетических параметров для варианта микроплазмина K137M. Определение kкат и Kм из измерения начальных скоростей гидролиза (vi) при различных концентрациях субстрата (S-2403). Данные сопоставили с Уравнением 2 (смотри Пример 4).

ФИГУРА 10. Выравнивание аминокислотной последовательности белков плазминогена млекопитающих, полученных из GenBank. Выравнивание последовательностей проводили с помощью программного обеспечения COBALT (Constraint-based Multiple Alignment Tool; Papadopolous and Aagarwala, Bioinformatics, 23:1073-79, 2007), доступным с сайта Национального центра биотехнологической информации (NCBI) с установками по умолчанию. ▼: обозначение начала Glu-плазминогена. Аминокислотная нумерация дана по отношению к плазминогену человека.

Детальное описание изобретения

Данное изобретение основано на результатах исследования механизмов, лежащих в основе естественной ауто-инактивации протеолитической активности плазмина при нейтральном pH, исследования, для которого изобретатель сфокусировался на микроплазмине, который состоит, главным образом, из каталитического домена плазмина. Пептидные связи, подверженные расщеплению плазмином, расположены на C-конце лизина или аргинина (Weinstein and Doolittle, 1972, Biochim Biophys Acta 258, 577-590). Около 10% (22 из 230) аминокислот каталитического домена плазмина (начиная с аминокислотного положения 562, валин, в Glu-плазминогене человека) представляют собой лизины или аргинины. Теоретически все пептидные связи, которые являются C-концевыми на этих лизинах и аргининах в одной молекуле плазмина, могут быть протеолитически расщеплены другой молекулой плазмина.

Один аспект данного изобретения, таким образом, относится к молекулам плазмина и к молекулам плазминогена, в частности, молекулам плазминогена, которые являются активируемыми/могут потенциально быть активированы до плазмина, содержащим в их каталитическом домене одну или несколько мутаций аминокислот, так чтобы пептидные связи, восприимчивые к аутопротеолитическому распаду в плазмине или плазминогене дикого типа, были менее восприимчивы или не восприимчивы к аутопротеолитическому распаду в молекулах плазмина и плазминогена - объектов данного изобретения.

Данное изобретение другими словами относится к выделенному варианту плазминогена или плазмину, полученному из него, или выделенному варианту плазмина, или протеолитически активному или обратимому неактивному производному любого из указанных плазминов, характеризующимся тем, что указанный вариант плазминогена или вариант плазмина или их производное содержит в своем каталитическом домене мутацию по меньшей мере одной внутренней аминокислоты в положении P, пептидная связь которой с внутренней аминокислотой в положении P+1 склонна к (или чувствительна к, подвержена, или восприимчива к) аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P+1 является менее склонной или не склонна к (или менее чувствительной, подверженной или восприимчивой или не чувствительна, подвержена или восприимчива) к аутопротеолизу. В частности, указанная внутренняя аминокислота в положении P представляет собой лизин или аргинин. В качестве используемой в данном документе ссылки (если не указано иное) каталитический домен плазмина будет нумероваться по отношению к плазмину человека, который начинается с валина в положении P=1, который является таким же, как валин в положении 562 Glu-плазминогена человека (смотри Фигуру 1). В данном документе также может быть сделана ссылка на два различных аминокислотных положения в каталитическом домене плазмина, которые затем называют P и P', соответственно.

Альтернативно, вариант плазминогена, вариант плазмина или производное плазмина по данному изобретению могут содержать в своем каталитическом домене мутацию по меньшей мере двух внутренних аминокислот в положении P и P', пептидная связь которых с внутренними аминокислотами в положениях P+1 и P'+1 склонна к аутопротеолизу, в аминокислоты, пептидная связь которых с внутренними аминокислотами в положении P+1 и P'+1 является менее склонной или не склонна к аутопротеолизу.

После определения аминокислот в положениях P специалист в данной области техники будет способен легко решить, в какую другую аминокислоту дикого типа может быть мутирована аминокислота в положении P. Такое решение может, но не обязательно должно, следовать критериям, таким как размер аминокислоты, заряд аминокислоты, полярность аминокислоты и/или индекс гидрофобности аминокислоты (смотри Таблицу 1). В частности, для плазмина и плазминогена указанная внутренняя аминокислота в положении P, по всей вероятности, будет лизином или аргинином, подразумевая, что они должны мутировать в аминокислоту, отличную от аргинина или лизина, соответственно. Более того, наличие кристаллической структуры каталитического домена плазминогена и плазмина (MMDB ID:12717; PDB ID:1DDJ; Wang et al., 2001, J Mol Biol 295, 903-914) значительно помогает определению мутантных аминокислот так, чтобы полученная мутантная молекула плазмина или плазминогена сохраняла протеолитическую активность. Кроме того, можно ожидать, что мутация аминокислоты дикого типа в указанном положении P в любую из аминокислот данной группы будет давать на выходе сходные результаты. На основе Таблицы 1, указанные данные группы могут быть обозначены следующим образом:

- гидрофобные алифатические аминокислоты: Met, Ile, Leu и Val

- гидрофобные ароматические аминокислоты: Phe

- гидрофильные кислые аминокислоты: Asp, Glu, Asn и Gln

- гидрофильные основные аминокислоты: Arg, Lys и His

- умеренно гидрофобные алифатические аминокислоты: Gly, Ala, Ser, Thr, Cys, Pro

- умеренно гидрофобные ароматические аминокислоты: Tyr и Trp.

Из них, и с целью мутации, Cys и Pro могут быть менее предпочтительными аминокислотами-заменителями аминокислот дикого типа плазмина или плазминогена из-за создания возможной свободной тиольной группы с помощью Cys, или из-за более обширного нарушения белковой структуры с помощью Pro. Другие аминокислотные замены включают мутацию аминокислоты дикого типа в указанном положении P каталитического домена плазмина(плазминогена) в неприродную или неканоническую аминокислоту или в аналоги аминокислот, такие как норлейцин, норвалин, орнитин или цитруллин (для более обширного списка, смотри, например, Hendrickson et al. 2004, Annu Rev Biochem 73, 147-176).

Таблица 1. Характеристики аминокислот.

Аминокислота Полярность боковой цепи Заряд боковой цепи
(при pH 7)
Индекс гидрофобности
A неполярная нейтральный 1,8
Аланин Ala положительный -4,5
Аргинин Arg нейтральный -3,5
Аспарагин Asn отрицательный -3,5
Цистеин Cys Аспарагиновая кислота Asp нейтральный 2,5
Глутаминовая кислота Glu E полярная отрицательный -3,5
Глутамин Gln Q полярная нейтральный -3,5
Глицин Gly G неполярная нейтральный -0,4
Гистидин His H полярная положительный -3,2
Изолейцин Ile I неполярная нейтральный 4,5
Лейцин Leu L неполярная нейтральный 3,8
Лизин Lys K полярная положительный -3,9
Метионин Met M неполярная нейтральный 1,9
Фенилаланин Phe F неполярная нейтральный 2,8
Пролин Pro P неполярная нейтральный -1,6
Серин Ser S полярная нейтральный -0,8
Треонин Thr T полярная нейтральный -0,7
Триптофан Trp W неполярная нейтральный -0,9
Тирозин Tyr Y полярная нейтральный -1,3
Валин Val V неполярная нейтральный 4,2

Изобретатель наблюдал, что в тестовых условиях внутри каталитического домена плазмина происходит лишь ограниченное число аутопротеолитических расщеплений. Как описано в разделе Примеры, данное изобретение определило 3 горячие точки аутопротеолиза. Это, однако, не исключает возможности существования других пептидных связей, которые поддаются аутопротеолитическому расщеплению.

Таким образом, в указанном выше, указанная по меньшей мере одна внутренняя аминокислота в положении P или указанные по меньшей мере две внутренних аминокислоты в положениях P и P' являются, конкретнее, по меньшей мере одной или по меньшей мере двумя, выбранными из следующего:

(i) лизин в положении 137 каталитического домена плазмина человека или соответствующий лизин или аргинин плазмина, не принадлежащего человеку;

(ii) лизин в положении 147 каталитического домена плазмина человека или соответствующий лизин или аргинин плазмина, не принадлежащего человеку; или

(iii) аргинин в положении 158 каталитического домена плазмина человека или соответствующий лизин или аргинин плазмина, не принадлежащего человеку;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека. Для ясности нумерации аминокислот в плазминогене человека и каталитическом домене плазмина человека в данном документе сделана ссылка на Фигуру 1.

Определение аминокислоты в последовательности плазмина(плазминогена), не принадлежащего человеку, которая “соответствует” (т.е. определение “соответствующей” аминокислоты) аминокислоте в плазмине(плазминогене) человека, вначале подразумевает выравнивание обеих аминокислотных последовательностей. Такое выравнивание может требовать некоторой оптимизации, такой как введение минорных гэпов в одну или обе выравниваемые последовательности, для получения наивысшей идентичности и гомологии. Во-вторых, аминокислота в плазмине(плазминогене), не принадлежащем человеку, выравнивающаяся с аминокислотой в плазмине(плазминогене) человека определяется и называется в данном документе как “соответствующая” аминокислота. Фигура 10 в данном документе изображает такое выравнивание публично доступных последовательности белка плазминогена млекопитающих и выделяет аминокислоты, представляющие особый интерес для данного изобретения, в последовательности плазминогена человека (линия 1) вместе с соответствующими аминокислотами в последовательностях плазминогена, не принадлежащего человеку (линии 2-18). Аминокислотами, представляющими особый интерес, являются Lys в положении 698 (положение 137 в каталитическом домене, смотри Фигуру 1), Lys в положении 708 (положение 147 в каталитическом домене, смотри Фигуру 1) и Arg в положении 719 (положение 158 в каталитическом домене, смотри Фигуру 1).

Указанный вариант плазминогена, вариант плазмина или производное плазмина по данному изобретению может быть таким, где указанная по меньшей мере одна внутренняя аминокислота в положении P представляет собой лизин в положении 147 каталитического домена плазмина человека или представляет собой соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку. Он может необязательно содержать дополнительно мутацию внутренних аминокислот в положениях 137 и/или 158 каталитического домена человека или соответствующих лизинов и/или аргининов каталитического домена плазмина, не принадлежащего человеку. Указанный в данном документе каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

Указанный вариант плазминогена, вариант плазмина или производное плазмина по данному изобретению может альтернативно быть таким, где:

(i) если мутация указанной по меньшей мере одной внутренней аминокислоты в положении P представляет собой мутацию лизина в положении 137 каталитического домена плазмина человека (которое является аминокислотным положением 698 относительно Glu-плазминогена человека) в аминокислоту, делая пептидную связь между аминокислотами 137 и 138 устойчивой или более устойчивой к аутопротеолизу, то указанный вариант плазминогена, вариант плазмина или производное плазмина содержит интактный сайт активации в аминокислотных положениях 561 и 562 (относительно Glu-плазминогена человека), и если аминокислоты в положении 536 и 541 (относительно Glu-плазминогена человека) присутствуют снаружи каталитического домена, то указанные аминокислоты являются цистеинами дикого типа, или

(ii) если мутация указанной по меньшей мере одной внутренней аминокислоты в положении P представляет собой мутацию аргинина в положении 158 каталитического домена плазмина человека (которое является аминокислотным положением 719 относительно Glu-плазминогена человека) в аланин или глутамат, то по меньшей мере одна другая внутренняя аминокислота каталитического домена плазмина человека в положении P', пептидная связь которой с внутренней аминокислотой в положении P'+1 склонна к аутопротеолизу, мутирована в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P'+1 является менее склонной или не склонна к аутопротеолизу.

Варианты, описанные в (i) и (ii) выше, могут необязательно дополнительно содержать мутацию внутренней аминокислоты в положении 147 каталитического домена человека или соответствующего лизина или аргинина каталитического домена плазмина, не принадлежащего человеку, где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

В любом из вышеописанных вариантов плазминогена, вариантов плазмина или производных плазмина указанный лизин в положении 137 каталитического домена человека или соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, может быть мутирован в аминокислоту следующих групп: гидрофобные алифатические аминокислоты, гидрофобные ароматические аминокислоты, гидрофильные кислые аминокислоты, гидрофильные основные аминокислоты, отличные от лизина, умеренно гидрофобные ароматические аминокислоты и умеренно гидрофобные алифатические аминокислоты. В частности, указанный лизин, например, может быть мутирован в аминокислоту, выбранную из Ala, Glu, Phe, His, Ile, Met, Gln или Arg.

В любом из вышеописанных вариантов плазминогена, вариантов плазмина или производных плазмина указанный лизин в положении 147 каталитического домена человека или соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, может быть мутирован в аминокислоту следующих групп: гидрофобные алифатические аминокислоты, гидрофобные ароматические аминокислоты, гидрофильные кислые аминокислоты, гидрофильные основные аминокислоты, отличные от лизина, умеренно гидрофобные ароматические аминокислоты и умеренно гидрофобные алифатические аминокислоты. В частности, указанный лизин, например, может быть мутирован в аминокислоту, выбранную из Ala, Glu, Gln, His, Ile или Phe.

В любом из вышеописанных вариантов плазминогена, вариантов плазмина или производных плазмина указанный аргинин в положении 158 каталитического домена человека или соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, может быть мутирован в аминокислоту следующих групп: гидрофобные алифатические аминокислоты, гидрофобные ароматические аминокислоты, гидрофильные кислые аминокислоты, гидрофильные основные аминокислоты, умеренно гидрофобные ароматические аминокислоты и умеренно гидрофобные алифатические аминокислоты. В частности, указанный аргинин, например, может быть мутирован в аминокислоту, выбранную из Ala, Glu, Gln, Ile, Phe или His.

“Плазмин”, также известный как фибринолизин или лизофибрин, представляет собой протеазу серинового типа, которая является результатом активации зимогена плазминогена. Активация является результатом протеолитического расщепления между аминокислотами 561 и 562 (нумерация относительно Glu-плазминогена человека). Плазмин несет тяжелую цепь, содержащую 5 доменов «двойная петля», и легкую цепь, содержащую каталитический домен. Плазминоген может быть получен из плазмы крови, например, посредством аффинной к лизину хроматографии (Deutsch и Mertz, 1970, Science 170, 1095-1096). Процессинг молекулы плазмина (снаружи и/или внутри каталитического домена плазмина) возможет при условии, что каталитический домен остается функциональным, такой процессинг, таким образом, приводит к образованию “протеолитически активного производного” плазмина. В связи с этим, один или несколько из 5 доменов «двойная петля» могут быть удалены полностью или частично. Процессированные плазмины, в которых не достает одного или нескольких доменов «двойная петля» и/или не достает частей одного или нескольких доменов «двойная петля», следовательно, рассматриваются данным изобретением как примеры протеолитически активных производных плазмина. Примеры процессированных вариантов плазмина включают, но не ограничиваясь, следующее: “мидиплазмин”, “миниплазмин”, “микроплазмин” и “дельта-плазмин”. Мидиплазмин, в основном, не содержит домены «двойная петля» 1-3 (например, Christensen et al., 1995, Biochem J 305, 97-102). Миниплазмин изначально получали путем ограниченного расщепления плазмина эластазой, и он, в основном, не содержит домены «двойная петля» 1-4 (например, Christensen et al., 1979, Biochim Biophys Acta 567, 472-481; Powell и Castellino, 1980, J Biol Chem 255, 5329). Миниплазмин был впоследствии получен рекомбинантно (WO 2002/050290). Микроплазмин изначально был получен путем инкубации плазмина при повышенном pH, и он, в основном, не содержит все домены «двойная петля» (например, WO 89/01336). Тогда как микроплазмин, полученный в результате инкубации плазмина при повышенном pH, содержит 30-31 карбокси-концевых аминокислот тяжелой цепи, рекомбинантно полученный вариант микроплазмина содержит 19 карбокси-концевых аминокислот тяжелой цепи (WO 2002/050290). Дельта-плазмин представляет собой рекомбинантную версию плазмина, в котором домен «двойная петля» 1 связан непосредственно с каталитическим доменом (WO 2005/105990). Вышеописанные процессированные варианты плазмина получают путем активации “мидиплазминогена”, “миниплазминогена”, “микроплазминогена” и “дельтаплазминогена”, соответственно. Для того, чтобы быть активируемым, процессированный плазминоген должен содержать минимальное количество аминокислот линкера между доменом «двойная петля» 5 и каталитическим доменом (смотри, например, Wang et al., 1995, Protein Science 4, 1758-1767). В контексте данного изобретения может быть желательным, чтобы плазминоген содержал “интактный сайт активации”, который предполагает, что по меньшей мере аминокислоты 561 и 562 (относительно Glu-плазминогена человека; или соответствующие аминокислоты в плазминогене, не принадлежащему человеку) являются такими, чтобы могла проходить активация/превращение плазминогена в плазмин, хотя возможно с различной кинетикой, как это происходит в плазмине дикого типа. Как альтернатива плазмину или его активному процессированному варианту, активируемый плазминоген или его процессированный вариант может использоваться в контексте данного изобретения (смотри, например, EP 0480906; US 5304383; EP 0631786; US 5520912; US 5597800; US 5776452). “Плазминоген” относится к любой форме плазминогена, например, Glu-плазминоген или Lys-плазминоген (начинающихся с Arg в положении 68 или Lys в положениях 77 или 78). Если используют активируемый плазминоген или его активируемый процессированный вариант, то активация до плазмина может быть отсрочена и будет, как правило, происходить после контактирования его с органом, тканью или жидкостью организма, т.е. после введения субъекту. В еще одной альтернативе плазмином или его активным процессированным вариантом можно заменить в контексте данного изобретения активируемый плазминоген или его активируемый процессированный вариант совместно с активатором плазминогена (таким как тканевой активатор плазминогена (tPA), урокиназа, стрептокиназа или стафилокиназа или любой их вариант; смотри, например, US 6733750; US 6585972; US 6899877; WO 03/33019). В еще дополнительной альтернативе смесь любого из следующего: (i) плазмин или его производное (ii) активируемый плазминоген или его активируемое производное, и, необязательно (iii) активатор плазминогена может использоваться в контексте данного изобретения (смотри, например, US 2004/0081643). Для того, чтобы обеспечить стабильность плазмина (или плазминогена), его будут, как правило, хранить при пониженных температурах (например,+4 градусов Цельсия или -20 градусов Цельсия). Композицией для хранения может быть стабилизирующая композиция, такая как композиция с низким рН (pH 4 или ниже; полученная, например, с помощью 1 мМ - 250 мМ кислоты, такой как лимонная кислота, смотри, например, Castellino и Sodetz, 1976, Methods Enzymol 45, 273-286; WO 01/36608; WO 01/36609; WO 01/36611) или композиция с высоким содержанием глицерина (30-50% объемного содержания, например, Castellino и Sodetz, 1976, Methods Enzymol 45, 273-286), альтернативно в или совместно с одной или несколькими дополнительными композициями стабилизаторов, содержащими, например, аминокислоту (например, лизин или его аналог, такой как EACA или транексамовая кислота), сахар (например, маннитол) или любой стабилизатор, который известен в данном уровне техники (например, дипептиды, WO 97/01631). Дополнительно включенным в род “плазмин” является любое его активное производное (или активного процессированного варианта плазмина) или сходное производное активируемого плазминогена (или его активируемого процессированного варианта). Такие производные включают, например, меченный плазмин или плазминоген (или их процессированные варианты), такой как Tc99-меченный плазмин (Deacon et al., 1980, Br J Radiol 53, 673-677) или пегилированный или ацилированный плазмин или плазминоген (или их процессированные варианты; EP 9879, WO 93/15189). Также можно использовать любую другую метку (радиоактивная, флуоресцентная и т.п.) для получения производного плазмина или плазминогена. Указанные производные дополнительно включают гибридные или химерные молекулы плазмина или плазминогена, содержащие, например, процессированный плазмин или плазминоген по данному изобретению, слитый, например, с фибрин-связывающей молекулой (такой как «двойная петля» 2 tPA, аполипопротеиновая «двойная петля», пальцеобразный домен tPA или фибронектин или Fab домен фибрин-связывающего антитела).

Сравнение аутопротеолитической устойчивости (т.е. стабильности) плазмина дикого типа и вариантов плазмина или производных плазмина по данному изобретению может быть проведено сходным образом, как для сравнения протеолитической активности, например, при хромогенном анализе активности или анализе биологического субстрата на основе, например, фибрина, фибриногена или фибронектина.

Для того, чтобы определить аутопротеолитическую устойчивость, может быть определена константа скорости аутолиза. Предусматривается, что варианты плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любое из производных плазмина по данному изобретению могут характеризоваться константой скорости аутолиза, которая является на по меньшей мере на 5% или по меньшей мере на 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 75%, 80%, 90%, 95%, 99% или 99,5% ниже, чем константа скорости аутолиза плазмина дикого типа, или, альтернативно, константой скорости аутолиза, которая составляет не более 95% или не более 0,5%, 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 75%, 80% или 90% константы скорости аутолиза плазмина дикого типа. Для того, чтобы определить указанный процент, расчет может быть произведен на основе абсолютных значений константы скорости аутолиза. Например, микроплазмин дикого типа имеет константу скорости аутолиза 230 M-1 с-1, тогда как вариант микроплазмина K137M имеет константу скорости аутолиза 1 M-1 с-1 (смотри Пример 3/Таблица 3). Константа скорости аутолиза варианта K137M следовательно составляет 0,43% константы скорости аутолиза микроплазмина дикого типа.

Дополнительно, любой из вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или производные любого из указанных плазминов могут сохранять протеолитическую активность. отличную (выше или ниже) от протеолитической активности плазмина дикого типа, такой, которая определена с помощью, например, анализа хромогенной активности или анализa биологического субстрата на основе, например, фибрина, фибриногена, фибронектина, желатина, ламинина или коллагена.

Протеолитические активности вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любое из производных плазмина по данному изобретению можно сравнить с протеолитической активностью плазмина дикого типа посредством каталитической константы kкат, которая является мерой числа молекул субстрата, которое каждый сайт фермента превращает в продукт за единицу времени. Таким образом, любой из вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любое из производных плазмина по данному изобретению может характеризоваться значением kкат, которое находится в диапазоне от+100% до -90% или от+50% до -50% значения kкат плазмина дикого типа, т.е., характеризоваться значением kкат в диапазоне 10% - 200% или 50% - 150% значения kкат плазмина дикого типа. Для того, чтобы определить указанный процент, расчет производят на основании абсолютных значений kкат. Например, микроплазмин дикого типа имеет kкат 46 с-1, тогда как вариант микроплазмина K137M имеет kкат 36 с-1 (смотри Пример 4/Таблица 3). kкат варианта K137M, следовательно, составляет 78,3% kкат микроплазмина дикого типа.

Другой способ сравнения протеолитической активности вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любого из производных плазмина по данному изобретению с протеолитической активностью плазмина дикого типа включает сравнение kкат/Kм (Таблица 3). До 1000-раз или до 500-раз более низкое kкат/Kм вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любого из производных плазмина по данному изобретению по сравнению с kкат/Kм плазмина дикого типа все еще может быть приемлемым (смотри далее).

Дополнительно, любой из вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любое из производных плазмина по данному изобретению может характеризоваться комбинацией определенных выше константы скорости аутолиза и каталитической константы kкат.

Альтернативно, любой из вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любое из производных плазмина по данному изобретению можно сравнить с плазмином дикого типа путем комбинирования данных по константе скорости аутолитической реакции и данных по kкат/Kм. Например, вариант плазмина с константой скорости аутолитической реакции, которая в 20 раз ниже по сравнению с плазмином дикого типа, и с kкат/Kм, которое в 10 раз ниже по сравнению с плазмином дикого типа, будет в 2 раз лучше, чем плазмин дикого типа. Разумеется, в зависимости от конечного применения, очень стабильный плазмин (т.е. нет или почти нет аутопротеолитического распада) с низкой протеолитической активностью может быть очень желательным, например, в случаях, где низкая, но пролонгированная активность плазмина, желательна или даже необходима для достижения предполагаемого клинического эффекта. Такие высоко стабильные варианты плазмина с низкой протеолитической активностью будут, по сути, фактически равными составам замедленного высвобождения без действительной необходимости фактического применения носителя или вспомогательного средства для замедленного высвобождения.

Еще одна другая альтернатива для сравнения любого из вариантов плазмина по данному изобретению, включая плазмины, полученные из вариантов плазминогена по данному изобретению, или любого из производных плазмина по данному изобретению может заключаться в сравнении с плазмином дикого типа путем объединения данных по константе скорости аутолитической реакции и данных по kкат.

Разумеется, для любых сравнительных измерений, таких как описано выше, необходимо сравнить варианты плазмина с их ближайшим плазмином дикого типа, например, сравнить вариант микроплазмина с микроплазмином дикого типа, или вариант миниплазмина с миниплазмином дикого типа. Кроме того ясно, что для любого измерения активности, обратимо инактивированное производное варианта плазмина по данному изобретению следует сначала активировать путем устранения причины обратимой инактивации (например, ацилирование или неоптимальный pH).

Любой из вариантов плазминогена по данному изобретению или плазминов, полученных из них, вариантов плазмина по данному изобретению может быть следующим: Glu-плазминоген Glu-плазмина, Lys-плазминоген или Lys-плазмин, мидиплазминоген или мидиплазмин, миниплазминоген или миниплазмин, микроплазминоген или микроплазмин, дельтаплазминоген или дельтаплазмин.

Существует много анализов для определения того, является или нет вид плазмина протеолитически активным. Простые и прямые анализы основаны на расщеплении хромогенного субстрата плазмином, присутствующим в образце; хромогенные субстраты включают S-2403 (Glu-Phe-Lys-pNA) и S-2251 (Val-Leu-Lys-pNA), которые высвобождают p-нитроанилин (pNA) при протеолитическом расщеплении. Количество образованного pNA может быть измерено с помощью поглощения света при 405 нм. Альтернативным анализом для определения активности плазмина является потенциометрический анализ. Колориметрические (с использованием хромогенного субстрата) и потенциометрические анализы описаны, например, в Castellino и Sodetz (1976, Methods Enzymol 45, 273-286). Следующим альтернативным анализом для определения активности плазмина является казеинолитический анализ (например, Robbins и Summaria, 1970, Methods Enzymol 19, 184-199; Ruyssen и Lauwers, 1978, Chapter IX - Plasmin, В “Pharmaceutical Enzymes”, Story-Scientia, Gent, Belgium, pp. 123-131). Еще одним альтернативным анализом для определения активности плазмина является фибринолитический анализ (например, Astrup и Mullertz, 1952, Arch Biochem Biophys 40, 346-351). Можно легко разработать дополнительные анализы активности с применением других белковых субстратов. Ясно, что такие анализы также могут использоваться для отслеживания исчезновения протеолитической активности плазмина с течением времени вследствие аутопротеолитического распада фермента. Как альтернатива для оценивания стабильности варианта плазмина или любого его активного процессированного варианта или их производного данного изобретения, можно проинкубировать указанный вариант плазмина в присутствии плазмина дикого типа и можно отследить устойчивость варианта плазмина к расщеплению плазмином дикого типа.

Применение плазмина при удалении некротических элементов или инородных остатков из повреждений, ран, изъязвляющихся ран (таких как изъязвляющиеся зашитые раны) и т.д. было описано, например, в патенте США №3208908. Аналогично, местное нанесение плазмин-содержащих терапевтических препаратов для лечения ожогов было раскрыто, например, в патенте США №4122158. Хирургическая обработка раны относится к удалению мертвой, поврежденной и/или инфицированной ткани для того, чтобы улучшить или повысить заживление оставшейся здоровой ткани. Такое удаление может быть достигнуто с помощью хирургических, механических или химических средств, или посредством определенных видов живых личинок, которые избирательно поедают некротическую ткань (терапия личинками). Хирургическая обработка раны может также быть проведена с использованием ферментов или может быть выполнена с помощью ферментов, этот процесс называется ферментное очищение раны. Хирургическая обработка раны является важным аспектом в процесс заживления ожогов и других серьезных ран, и ее также используют при лечении некоторых типов укусов змей. Применение плазмина (или любого его варианта или производного или, соответственно, альтернативы, как описано выше) при ферментном очищении раны (отдельно или в комбинации с другими типами обработки раны) является особенно пригодным при стимулировании или облегчении заживления раны и в качестве вспомогательного средства в хирургических процедурах, таких как пересадка кожи.

Более общеизвестное применение плазмина (или любого его варианта или производного или, соответственно, альтернативы, которые описаны выше) относится, в общих выражениях, к лечению патологического(патологических) отложения(отложений) фибрина. Отложения фибрина могут быть результатом широкого разнообразия патологических ситуаций в организме. Например, содержащие фибрин кровяные сгустки могут формироваться в сосудах ткани, приводя к закупорке или тромбозу глубоких вен, коронарной артерии, мозговой артерии или ретинальной вены. Небольшие скопления фибрина предшествуют и могут обуславливать предвестник угрожающего катастрофического тромбоза. Примеры включают нестабильную стенокардию, которая рассматривается как предвестник угрожающего коронарного тромбоза и транзиторных ишемических атак, которые могут предшествовать инсультам. Фибрин, кроме того, часто откладывается в ткани в связи с воспалением, связанным со многими патологическими процессами, включая инфекцию, аутоиммунное заболевание и рак. Другая ситуация, при которой откладывается фибрин - это вокруг абсцессов, вызванных инфицированием микроорганизмами. Фибриновые отложения, кроме того, часто обнаруживаются связанными с определенными солидными опухолями. Отложение фибрина может также происходить во время заживления любого типа раны. Еще одна ситуация отложения фибрина - это накопление фибрина в ретинальной вене, которое может привести к дегенерации сетчатки, нарушенному зрению или даже потере зрения. Выражение патологическое отложение фибрина дополнительно включает такие отложения, как сформированные или как присутствующие в или на кончике катетера, катетерного устройства или другого имплантата, такого как протезные сосуды и трансплантаты синтетического, человеческого или животного происхождения и эффективно блокируемые закупоркой, содержащей фибрин. Выражение "катетерное устройство" относится к любому катетеру или трубко-подобному устройству, которое может проникать в организм, включая артериальные катетеры, кардиальные катетеры, центральные венозные катетеры, внутривенные катетеры, периферически вводимые центральные катетеры, пульмонарные артериальные катетеры, туннельные центральные венозные катетеры и артериально-венозные шунты.

Среди различных факторов, вовлеченных в процесс тромбоза, т.е. образование тромба или гемостатической пробки, имеют место следующие: (1) повреждение выстилки эндотелиальных клеток пораженного кровеносного сосуда, (2) повышение свертывающих свойств крови и (3) застой крови в пораженном кровеносном сосуде. Тромбоз может начинаться как очень маленький комочек, прикрепленный к поврежденной части выстилки кровеносного сосуда. Его присутствие стимулирует дальнейшее протекание тромбоза и вызывает замедление потока крови путем уменьшения внутреннего диаметра сосуда. Дальнейший рост изначально небольшого тромба часто ведет к полной или почти полной закупорке пораженного кровеносного сосуда. Если тромбоз имеет место в одной из артерий, то ткани, которые снабжаются этой артерией, могут быть лишены кислорода и питательных веществ, что приводит к повреждению или смерти ткани (гангрене). Тяжесть повреждения зависит от положения и размера тромбоза, скорости, с которой он растет, и то, имеет ли пораженная область только одну артерию или снабжается коллатеральными кровеносными сосудами. Если поражен сосуд к жизненному органу, например, сердцу или мозгу, то индивидуум может получить тяжелые увечья или умереть. Иногда тромб может содержать инфекционные организмы, такие как бактерии, может иметь место и септический тромбоз с образованием гноя и инфицированием окружающих тканей.

Дополнительные применения плазмина (или любого его варианта или производного или, соответственно, альтернативы, которые описаны выше) включают снижение уровня циркулирующего фибриногена (например, WO 93/07893) и его применение как ингибитора α2-антиплазмина (который, как сообщалось, снижает размер церебрального инфаркта после ишемического инсульта; WO 00/18436).

Еще одно применение плазмина (или любого его варианта или производного или, соответственно, альтернативы, которые описаны выше) связано с индукцией заднего отслоения стекловидного тела (PVD) и/или разжижения стекловидного тела глаза в качестве альтернативы механической витрэктомии или в качестве вспомогательного средства для механической витрэктомии (WO 2004/052228; US 6733750; US 6585972; US 6899877; WO 03/33019; WO 2006/122249; WO 2007/047874; US 5304118; US 2006/0024349; US 2003/0147877). Витрэктомия и/или разжижение стекловидного тела является предпочтительным для ряда состояний глаза, таких как плавающие помутнения стекловидного тела (подвижные инородные остатки/отложения стекловидного тела внутри жидкости стекловидного тела с нормальной прозрачностью, которые могут нарушать зрение), отслоение сетчатки (ведущее к слепоте состояние, который может быть вызвано витреальной тракцией), макулярная складчатость (рубцовая ткань на желтом пятне; желтое пятно необходимо для острого центрального зрения; макулярная складчатость также известна как эпи- или преретинальная мембрана, целлофановая макулопатия, складка сетчатки, ретинопатия с образованием поверхностных складок, премакулярный фиброз или заболевание внутренней ограничивающей мембраны), диабетическая ретинопатия (пролиферативная или непролиферативная), которая может приводить к кровоизлиянию в стекловидное тело и/или образованию фиброзной рубцовой ткани на сетчатке (которая может вызывать отслоение сетчатки), макулярные отверстия (макулярное отверстие, вызванное слепым пятном и вызванная витреальной тракцией, травмой или травматичным событием), кровоизлияние в стекловидное тело (вызванное диабетической ретинопатией, травмами, отслоением сетчатки или разрывами сетчатки, субарахноидальные кровоизлияния (синдром Терсона) или закупоренные сосуды), субгиалоидная гемморагия (кровоизлияние под гиалоидной мембраной, покрывающей стекловидное тело), макулярная эдема (скопление жидкости и белка на или под желтым пятном глаза) и дегенерация желтого пятна (начиная с образования друзы; встречается в сухой и мокрой форме; при корреляции с возрастом вызывала возрастную макулярную дегенерацию). Другие применения плазмина для глаз включают поддержание или восстановление фильтрационной подушки после трабекулоэктомической операции (проведенной для снижения внутриглазного давления), смотри, например, WO 2009/073457.

Другое дополнительное применение плазмина (или любого его варианта или производного или, соответственно, альтернативы, которые описаны выше) принадлежит к диагностике, более конкретно, подходящим образом меченный (например, Tc99-меченный, смотри выше) плазмин (или любой его вариант или производное или, соответственно, альтернатива, которые описаны выше) можно применять для обнаружения патологических отложений фибрина. При применении процессированного плазмина или варианта плазминогена согласно данному изобретению в таких диагностиках следует проявлять осторожность, так как указанный вариант все еще содержит фибрин-связывающий сайт (вне зависимости от того, происходит он из плазмина самого по себе, или добавлен, например, к каталитическому домену плазмина путем создания гибридной молекулы).

Плазмин или любой его вариант или производное или, соответственно, альтернатива по данному изобретению могут храниться в фармацевтически приемлемом носителе, разбавителе или вспомогательном средстве. Такой носитель, разбавитель или вспомогательное средство может состоять из или содержать кислый буфер с низким рН, такой как 1-100 мМ ацетат или цитрат. Если он кислый, то фармацевтически приемлемый носитель, разбавитель или вспомогательное средство может иметь pH 2,5 - 4,0, такой как pH 3,0 - 3,5 или такой как pH 3,1. Пригодные кислые соединения включают уксусную кислоту, лимонную кислоту, соляную кислоту, молочную кислоту, яблочную кислоту, винную кислоту или бензойную кислоту. Можно использовать муравьиную кислоту, но следует проявлять осторожность, так как это соединение не индуцирует протеолитическое расщепление на C-конце Asp-остатков. Фармацевтически приемлемый носитель, разбавитель или вспомогательное средство, кислое или нейтральное, может содержать одну или несколько аминокислот, таких как серин, треонин, метионин, глутамин, глицин, изолейцин, валин, аланин, аспарагиновая кислота, лизин, гистидин или любые их производные или аналоги. Фармацевтически приемлемый носитель, разбавитель или вспомогательное средство может содержать углевод, такой как моносахарид, дисахарид, полисахарид или многоатомный спирт. Примеры включают сахара, такие как сахароза, глюкоза, фруктоза, лактоза, трегалоза, мальтоза и манноза, сахарные спирты, такие как сорбит и маннит, и полисахариды, такие как декстрины, декстраны, гликоген, крахмалы и целлюлозы. Фармацевтически приемлемый носитель, разбавитель или вспомогательное средство может включать соединения, такие как глицерин, ниацинамид, глюкозамин, тиамин, цитруллин, неорганические соли (такие как хлорид натрия, хлорид калия, хлорид магния, хлорид кальция), бензиловый спирт или бензойную кислоту. Фармацевтически приемлемый носитель, разбавители или вспомогательное средство может включать соединения, такие как ε-аминокапроновая кислота (EACA) и/или транексамовая кислота (смотри также выше и раздел Предпосылки изобретения). Некоторые из этих соединений могут быть использованы как стабилизатор плазмина или любого его варианта или производного или, соответственно, альтернативы, которые описаны выше.

В свете описанного выше, другой аспект данного изобретения относится к выделенному плазминогену, плазмину, или любому их варианту или производному, или, соответственно, альтернативе по данному изобретению, или комбинации любых из них для применения в качестве лекарственного препарата.

Дополнительный аспект данного изобретения относится к композициям, содержащим выделенный плазминоген, плазмин, или любой их вариант или производное, или, соответственно, альтернативы по данному изобретению, или комбинации любых из них, и по меньшей мере одного из фармацевтически приемлемого разбавителя, носителя или вспомогательного средства. В следующем варианте осуществления указанная композиция может дополнительно содержать по меньшей мере одно из следующего: антикоагулянт, дополнительное тромболитическое средство, противовоспалительное средство, противовирусное средство, антибактериальное средство, противогрибковое средство, антиангиогенное средство, антимитотическое средство, антигистамин или анестетик.

В варианте осуществления к описанным выше двум аспектам данного изобретения выделенный плазминоген, плазмин, или любой их вариант или производное, или, соответственно, альтернативу по данному изобретению, или комбинацию любых из них, или композицию по данному изобретению можно использовать в любой клинически применимой установке, такой как для лечения патологического отложения фибрина, для индуцирования заднего отслоения стекловидного тела глаза, для индуцирования разжижения стекловидного тела глаза, как вспомогательное вещество для и облегчения витрэктомии глаза, для индуцирования заднего отслоения стекловидного тела, для расщепления витреомакулярной адгезии, для закрытия макулярных отверстий, для ферментного очищения раны, для снижения циркулирующего фибриногена, для снижения уровней α2-антиплазмина или совместно с трабекулэктомией.

В другом варианте осуществления к описанным выше двум аспектам данного изобретения выделенный плазминоген, плазмин, или любой их вариант или производное, или, соответственно, альтернативу по данному изобретению, или комбинацию любых из них, или композицию по данному изобретению можно использовать для профилактических целей или в способах профилактического лечения. Профилактические применения включают снижение риска развития патологического отложения фибрина у млекопитающего с повышенным риск его развития (такого как страдающее ожирением млекопитающее, млекопитающее, которое не делает достаточных физических упражнений или млекопитающее, которому предписано серьезное хирургическое вмешательство или операция). Другие профилактические применения включают индукцию заднего отслоения стекловидного тела и/или разжижения стекловидного тела в явно здоровом глазу млекопитающего, у которого другой глаз, как показывает(показывала) диагностика, нуждается в индукции заднего отслоения стекловидного тела и/или разжижения стекловидного тела.

Альтернативно, данное изобретение относится к способам лечения, растворения, разрыхления, размягчения, лизирования, индуцирования или активации лизиса патологического отложения фибрина у субъекта, при этом указанные способы включают контактирование указанного отложения фибрина с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного, или, соответственно, альтернатив по данному изобретению, или комбинации любых из них, при этом указанное контактирование приводит к лечению, растворению, разрыхлению, размягчению, лизису или индукции или активации лизиса указанного патологического отложения фибрина.

Данное изобретение дополнительно относится к способам индуцирования заднего отслоения стекловидного тела глаза и/или индуцирования разжижения стекловидного тела глаза, или облегчения хирургической витрэктомии глаза у субъекта, при этом указанные способы включают контактирование глаза указанного субъекта, нуждающегося в таком лечении, с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного, или, соответственно, альтернативы по данному изобретению, или комбинации любых из них, при этом указанное контактирование приводит к индукции указанного заднего отслоения стекловидного тела и/или указанного разжижения стекловидного тела или к облегчению указанной хирургической витрэктомии.

Данное изобретение также относится к способам ферментного очищения раны поврежденной ткани субъекта, при этом указанный способ включает контактирование указанной поврежденной ткани с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного, или, соответственно, альтернативы по данному изобретению, или комбинации любых из них, при этом указанное контактирование приводит к указанному ферментному очищению раны указанной поврежденной ткани.

Другие способы данного изобретения представляют собой лечение или профилактику любого другого клинически соответствующего симптома, включая способы снижения циркулирующего фибриногена или снижения уровней α2-антиплазмина у субъекта, при этом указанные способы включают контактирование субъекта, нуждающегося в таком лечении, с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного или, соответственно, альтернативы по данному изобретению, или комбинации любых из них, при этом указанное контактирование приводит к указанному снижению циркулирующего фибриногена или указанных уровней α2-антиплазмина.

В основном, лекарственный препарат или композиция данного изобретения, содержащая плазмин (или любой его вариант или производное или, соответственно, альтернативу) по данному изобретению может, в зависимости от ее конечного применения и способа введения, содержать один или несколько дополнительных активных ингредиентов, таких как антикоагулянт, дополнительное тромболитическое средство, противовоспалительное средство, противовирусное средство, антибактериальное средство, противогрибковое средство, антиангиогенное средство, антимитотическое средство, антигистамин или анестетик.

“Антикоагулянты” включают гирудины, гепарины, кумарины, низкомолекулярный гепарин, ингибиторы тромбина, ингибиторы тромбоцитов, ингибиторы агрегации тромбоцитов, ингибиторы фактор коагуляции, антитела к фибрину и ингибиторы фактора VIII (такие как те, что описаны в WO 01/04269 и WO 2005/016455).

“Тромболитические средства” включают плазмин дикого типа, плазминоген дикого типа, урокиназу, стрептокиназу, активатор плазминогена тканевого типа (tPA или альтеплаза), активатор плазминогена урокиназного типа (uPA) и стафилокиназу или любой вариант или производное любого из них, например, APSAC (анизоилированный активаторный комплекс стрептокиназы и палзминогена), ретеплаза, тенектеплаза, scuPA (одноцепочечный uPA) или комбинацию любых из них.

“Противовоспалительные средства” включают стероиды (например, преднизолон, метилпреднизолон, кортизон, гидрокортизон, преднизон, триамцинолон, дексаметазон) и нестероидные противовоспалительное средства (NSAID, например, ацетаминофрен, ибупрофен, аспирин).

“Противовирусные средства” включают трифлуридин, видарабин, ацикловир, валацикловир, фамцикловир и доксуридин.

“Антибактериальные средства” или антибиотики включают ампицилин, пенициллин, тетрациклин, окситетрациклин, фрамицетин, гатифлоксацин, гентамицин, тобрамицин, бацитрацин, неомицин и полимиксин.

“Антимикотические/фунгистатические/противогрибковые средства” включают флюконазол, амфотерицин, клотримазол, эконазол, итраконазол, миконазол, 5-фторцитозин, кетоконазол и натамицин.

“Антиангиогенные средства” включают антитела (или их фрагменты), такие как антитела к VEGF (сосудистый эндотелиальный фактор роста) или к PlGF (плацентарный фактор роста), и средства, такие как макуген (пегаптаниб натрия), триптофанил-тРНК-синтаза (TrpRS), анекортав ацетат, пролекарство комбрестатин A4, AdPEDF (аденовектор, способный экспрессировать полученный из пигментного эпителия фактор), VEGF-ловушка, ингибитор VEGF рецептора-2, ингибиторы VEGF, PlGF или TGF-β, сиролимус (рапамицин) и эндостатин.

“Антимитотические средства” включают митомицин C и 5-фторурацил.

“Антигистаминное средство” включает кетитофена фумарат и фенирамина малеат.

“Анестетики” включают бензокаин, бутамбен, дибукаин, лидокаин, оксибупрокаин, прамоксин, пропаракаин, проксиметакаин, тетракаин и аметокаин.

“Приведение в контакт”, когда используется в данном документе, означает любой способ введения, который приводит к взаимодействию между композицией, такой как лекарственный препарат, и тканью, жидкостью организма, органом, организмом и т.д., с которым указанная композиция контактирует. Взаимодействие между композицией и тканью, жидкостью организма, органом, организмом и т.д. может происходить, начинаясь немедленно или почти немедленно с введением композиции, может происходить в течение длительного периода времени (начинаясь немедленно или почти немедленно с введением композиции), или может быть отсроченным по отношению ко времени введения композиции.

Любой способ приведения в контакт патологического отложения фибрина, который обеспечивает (или немедленно, отсрочено или в течение длительного периода времени) эффективное количество плазмина (или любого его варианта или производного или, соответственно, альтернативы) к такому отложению фибрина, может быть использован. Если такое отложение фибрина связано со сгустком крови, то плазмин (или любой его вариант или производное или, соответственно, альтернатива) может быть доставлен внутриартериально, внутривенно или местно (на малое расстояние от сгустка или даже в сгусток) посредством инъекции, и/или инфузии, и/или катетера.

Если плазмин используется (или любой его вариант или производное или, соответственно, альтернатива) в ферментной хирургической обработке раны, то он может быть включен в гелеподобную композицию, которая может быть нанесена местно, или может быть нанесен в жидкой форме.

Может быть использован любой способ приведения в контакт стекловидного тела глаза и/или водянистой влаги, который обеспечивает (или немедленно, отсрочено или в течение длительного периода времени) эффективное количество плазмина (или любого его варианта или производного или, соответственно, альтернативы) к стекловидному телу и/или водянистой влаге. Один способ приведения в контакт стекловидного тела и/или водянистой влаги достигается одной или несколькими внутриглазными инъекциями непосредственно в стекловидное тело и/или водянистую влагу. Альтернативно, указанное приведение в контакт может включать субконъюктивальные, внутримышечные или внутривенные инъекции. Дополнительный альтернативный способ приведения в контакт включает помещение интравитреального имплантируемого устройства, такого как OCUSERT® (Alza Corp., Пало-Альто, Калифорния) или VITRASERT® (Bausch & Lomb Inc., Rochester, Нью-Йорк). Приведение в контакт стекловидного тела и/или водянистой влаги с эффективным количеством плазмина (или любого его варианта или производного или, соответственно, альтернативы) может происходить непрерывным способом, используя состав пролонгированного, замедленного высвобождения или любое имплантируемое устройство, подходящее для этого.

Выражение “эффективное количество” относится к режиму дозирования лекарственного препарата по данному изобретению, в частности, активного ингредиента лекарственного препарата по данному изобретению, т.е., плазмина или его активного процессированного варианта (или, следовательно, любой альтернативы, как описано выше). Эффективное количество будет, как правило, зависеть от и нуждаться в регулировании относительно способа приведения в контакт или введения и состояния, которое подлежит лечению. Эффективное количество лекарственного препарата, более конкретно его активного ингредиента, представляет собой количество, необходимое, чтобы получить желательный клинический результат или терапевтический или профилактический эффект, не вызывая значительных или нежелательных токсических эффектов. Для получения или поддержания эффективного количества лекарственный препарат может быть введен как одна доза или в множественных дозах. Эффективное количество может дополнительно варьировать в зависимости от тяжести состояния, которое необходимо лечить, или предполагаемой тяжести состояния, которое необходимо предотвратить; оно может зависеть от общего состояния здоровья и физического состояния пациента, и обычно необходима оценка лечащего врача или терапевта для установления того, каким является эффективное количество. Эффективное количество может дополнительно быть получено путем комбинации различных типов введения. Лекарственный препарат может быть введен в виде раствора (жидкого или полужидкого, например, гелеподобного или в дисперсии или суспензии, коллоидного, в эмульсии, суспензии наночастиц) или в виде твердой формы (например, таблетка, минитаблека, капсулы с твердой или мягкой оболочкой).

Для целей тромболиза дозировка плазмина и длительность терапии плазмином будет, как правило, зависеть от размера и расположения кровяного сгустка, а также от размера, веса и возраста пациента. Если сгусток является венозным, то лечение плазмином может продолжаться в течение дней, тогда как лишь часы терапии плазмином могут быть необходимы, если сгусток является артериальным. Инфаркт миокарда можно лечить коротким лечением однократными дозами, тогда как состояния, такие как тромбофлебит и эмболия сосудов легких, могут требовать более длительного лечения многократными дозами. Пролонгированная непрерывная и/или периодическая тромболитическая терапия плазмином может быть применена для лечения коронарной окклюзии или в случае профилактической терапии для того, чтобы снизить риск образования сгустка у субъектов, которые, как известно, имеют повышенный риск развития образования сгустка. Дополнительный фактор, влияющий на дозировку плазмина, включает уровни циркулирующих в крови ингибиторов плазмина, таких как α2-антиплазмин и/или α2-макроглобулин, начальный уровень которых является зависящим от пациента. Может быть целесообразным откорректировать дозировку плазмина так, чтобы оставалось не более 15% общего циркулирующего α2-антиплазмина с тем, чтобы достичь эффективной тромболитической терапии. С целью индуцирования тромболиза контактный способ доставки плазмина или любого его варианта или производного или, соответственно, альтернативы на короткое расстояние вблизи тромба может быть выгодным, поскольку воздействие сывороточных ингибиторов снижается. Такой контактный способ, как правило, включает доставку посредством катетерного устройства. Для применения в тромболизе типичные дозировки плазмина находятся в диапазоне от 500 микрограмм/кг веса тела до 10 миллиграмм/кг веса тела, вводимые как одноразовая ударная доза вещества или разделенные на 1 начальную инъекцию с последующей 1 или несколькими повторными инъекциями ударной дозы вещества. Плазмин может, альтернативно, вводиться в течение длительного периода времени, например, путем инфузии или с помощью микронасоса для доставки лекарственного средства. Дозировки плазмина для продолжительного введения могут находиться в диапазоне от 1 до 10 мг/кг/час.

Типичная дозировка плазмина для индуцирования задней отслойки стекловидного тела, разжижения стекловидного тела, очищения от крови в стекловидном теле или кровоизлияний или очищения от токсичных материалов или посторонних веществ из полости стекловидного тела может быть в диапазоне от около 0,1 микрограмм до около 250 микрограмм на глаз на дозу, что может быть доставлено в объеме разбавителя или носителя от около 50 микролитров до около 300 микролитров на глаз на дозу. Разбавитель или носитель может, например, быть стерильным сбалансированным солевым раствором (BSS или BSS Plus), физиологическим солевым раствором или раствором, содержащим 1-10 мМ лимонную кислоту. В одном варианте осуществления плазмин доставляют к глазу в дозе 125 микрограмм, содержащихся в 0,1 мл разбавителя или носителя. В случае витрэктомии, указанный плазмин может быть доставлен к глазу за 15 - 300 минут или 15 - 120 минут до витрэктомии. Если плазминоген используется как альтернативный источник плазмина (смотри определение “плазмин”), до 250 микрограмм плазминогена может быть введено на каждый глаз, и указанный плазминоген может сопровождаться до 2000 IU урокиназы или стрептокиназы в качестве активатора плазминогена или до 25 микрограмм tPA. При использовании в глазу введение плазмина или плазминогена может дополнительно сопровождаться введением газообразного вспомогательного средства, такого как воздух, расширяющийся газ, или сжижаемый газ, или их смеси, при условии, что он является нетоксичным для глаза. Другие подходящие газообразные материалы включают SF6 (гексафторид серы) и перфторуглероды, такие как C2F6 (гексафторэтан), C3Fs (октафторпропан), C4Fs (октафторциклобутан), кислород, азот, диоксид углерода, аргон и другие инертные газы. Объем газообразного материала, который вводят в глаз, может изменяться в зависимости от газообразного материала, пациента и желаемого результата. Например, объем воздуха, который впрыскивают в заднюю камеру, может находится в диапазоне от около 0,5 мл до около 0,9 мл. Другие газообразные материалы, такие как SF6 и газы-перфторуглероды, могут находиться в диапазоне от около 0,3 мл до 0,5 мл. Предпочтительно, газообразный материал вводят в заднюю камеру глаза в количестве, достаточном для сжатия стекловидного тела напротив задней гиалоидной мембраны и образования полости в стекловидном теле без повреждения глаза. В предпочтительных вариантах осуществления газообразное вспомогательное средство вводят в стекловидное тело с образованием полости, которая заполняет около 40% до около 60% внутреннего объема внутриглазной полости.

Перечисленные выше дозировки являются показательными значениями, не подразумевающими, что они являются каким-либо образом ограничивающими. Указанные дозировки, кроме того, относятся к плазмину дикого типа, или плазминогену, или любому его активному или активированному процессированному варианту. Если используется плазмин с повышенной стабильностью по данному изобретению (или любой его вариант или производное или, соответственно, альтернатива), и в зависимости от конечной стабильности и остаточной активности плазмина по данному изобретению, дозировки могут быть сходными, более высокими или более низкими, чтобы получить такой же или лучший суммарный клинический эффект, чем получен с плазмином дикого типа. Дозировка плазмина по данному изобретению может также зависеть от скорости ингибирования эндогенными ингибиторами, такими как α2-антиплазмин.

В соответствии с работой, раскрытой в данном документе, данное изобретение дополнительно относится к способам скрининга в отношении аутопротеолитически стабильного варианта плазмина, где указанные способы включают этапы:

(i) определение в каталитическом домене плазмина дикого типа по меньшей мере одной внутренней аминокислоты в положении P, пептидная связь которой с внутренней аминокислотой в положении P+1 склонна к аутопротеолизу,

(ii) мутирование аминокислоты в положении P, определенной в (i), в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P+1 является менее склонной или не склонной к аутопротеолизу,

(iii) определение аутопротеолитической стабильности мутанта, полученного из (ii), и

(iv) отбор из мутанта (iii), который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта.

Данное изобретение аналогично относится к способам скрининга в отношении аутопротеолитически стабильного варианта плазмина, где указанные способы включают:

(i) мутирование одного или нескольких аминокислот аргинина или лизина в положениях 137, 147 и 158 каталитического домена плазмина человека или соответствующих аргининов или лизинов плазмина, не принадлежащего человеку, в аминокислоту, отличающуюся от природной аминокислоты,

(ii) определение аутопротеолитической стабильности мутанта, полученного из (i), и

(iii) отбор из (ii) мутанта, который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта плазмина;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

Описанные выше способы скрининга могут дополнительно включать этап, где определяют протеолитическую активность аутопротеолитически стабильного варианта плазмина.

Многие продукты, включая медикаменты (здесь понимаемые, в частности, как готовый к употреблению активный ингредиент, т.е. в конечном составе для введения пациенту) и хранящиеся навалом активные ингредиенты медикаментов обычно хранят в течение значительного количества времени перед применением. Представляет интерес увеличить срок хранения продуктов как можно дольше. Под сроком хранения понимают время, в течение которого продукт может использоваться безопасно и в течение которого продукт сохраняет свою эффективную применимость, т.е. его активность в случае медикамента и/или его активного ингредиента. Как правило, срок хранения указан на продукте или его упаковке. Как только срок хранения истекает, безопасная и эффективная применимость продукта больше не гарантируется. Дополнительным важным аспектом в хранении продуктов является температура хранения, при которой может быть достигнут желательный срок хранения. Например, срок хранения продукта, хранящегося при+4°C или средней температуре холодильника может составлять до 12 месяцев, тогда как срок хранения того же продукта, хранящегося при -20°C или средней температуре морозильной камеры может составлять до 36 месяцев. Логично, однако, что поддержание холодовой цепи при температурах замораживания, например, -20°C, является более сложным, трудным и дорогим, чем поддержание холодовой цепи при+4°C. Таким образом, может еще быть привлекательным иметь более короткий, но достаточно длительный срок хранения, объединенный с возможностью хранить продукт при+4°C. Данное изобретение предлагает решение для продолжения, увеличения или повышения срока хранения или стабильности при длительном хранении плазмина, или любого его активного фрагмента, или производного, или композиции, содержащей плазмин, или любого его активного производного. Решение заключается в предоставлении вариантов плазмина, которые описаны в данном документе, где указанные варианты имеют увеличенную стабильность, которая, в сущности, повышает, увеличивает или продлевает их срок хранения.

Данное изобретение аналогично относится к способам улучшения стабильности при длительном хранении содержащей плазмин композиции, где указанные способы включают этап определения аутопротеолитически стабильного варианта плазмина, способного храниться в течение длительного периода времени без существенной потери протеолитической активности. Для определения долговременной стабильности отбирают аликвоту препарата плазмина по данному изобретению и измерения активности проводят повторно во время предусмотренного срока хранения. Если предусмотренный срок хранения составляет, например, 24 месяцев, то измерения активности могут проводиться, например, каждый месяц. Допустимая потеря протеолитической активности в конце предусмотренного срока хранения будет в большей степени зависеть от предусмотренного клинического применения, но, как правило, может быть не более, например, от 10% до 15%.

Данное изобретение, кроме того, относится к способам получения варианта плазминогена по данному изобретению, т.е. получения плазминогена, содержащего в его каталитическом домене мутацию по меньшей мере одной внутренней аминокислоты в положении P, пептидная связь которой с внутренней аминокислотой в положении P+1 склонна к аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P+1 является менее склонной или не склонной к аутопротеолизу. Такие способы включают этапы:

(i) введения в подходящую клетку-хозяина нуклеиновой кислоты, кодирующей вариант плазминогена по данному изобретению в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;

(ii) выращивания клетки-хозяина, полученной в (i), в условиях и в течение времени, достаточного для экспрессии указанного плазминогена в указанной клетке-хозяине; и

(iii) сбора плазминогена, экспресированного в (ii).

В конечном итоге к таким способам может быть добавлен этап (iv), который включает очистку плазминогена, собранного в (iii).

Подходящие клетки-хозяева и способы экспрессии и продукции раскрыты в, например, WO 90/13640 (клетки насекомых), WO 2002/050290 и WO 03/066842 (дрожжевые клетки), WO 2008/054592 (бактериальные клетки/процесс рефолдинга) и WO 2005/078109 (трансгенные растения ряски или клетки трансгенного растения).

Данное изобретение дополнительно включает способы получения варианта плазмина по данному изобретению, т.е. получения плазмина, содержащего в его каталитическом домене мутацию по меньшей мере одной внутренней аминокислоты в положении P, пептидная связь которой с внутренней аминокислотой в положении P+1 склонна к аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P+1 является менее склонной или не склонной к аутопротеолизу. Такие способы, как правило, включают этапы продукции плазминогена по данному изобретению, как описано выше, и дополнительно включают этап активирования плазминогена по данному изобретению до плазмина по данному изобретению, используя подходящий активатор плазминогена (такой как tPA, uPA, урокиназа, стрептокиназа, стафилокиназа или любой его вариант). В конечном итоге могут быть добавлены один или несколько этапов, где плазминоген очищают до активации, очищают активированный плазмин и/или получают производные активного плазмина, как описано выше, и/или обратимо инактивируют и/или, факультативно, приводят к подходящим условиям хранения (например, стабилизирующий раствор, лиофилизация и/или низкая температура).

Данное изобретение также относится к выделенной последовательности нуклеиновой кислоты(кислот), кодирующей вариант плазминогена или вариант плазмина по данному изобретению. Данное изобретение также относится к рекомбинантному вектору(ам), содержащему такую нуклеиновую кислоту. Данное изобретение также относится к клетке-хозяину(хояевам), трансформированной такой нуклеиновой кислотой или таким рекомбинантным вектором. ПРИМЕРЫ

ПРИМЕР 1. Самораспад каталитического домена плазмина и определение пептидных связей в каталитическом домене плазмина, которые являются чувствительными к аутопротеолизу.

Для того чтобы изучить механизмы, лежащие в основе аутоинактивации протеолитической активности плазмина, изобретатель считает необходимым сосредоточить внимание на микроплазмине, который состоит, в основном, из каталитического домена плазмина.

Типичный профиль гель-хроматографии (SEC) микроплазмина, полученного в крупномасштабном производстве, показан на Фигуре 2. Элюаты, соответствующие фракции номер 5 (пред-пик 1), фракциям номер 7 и 8 (пред-пик 2), фракциям номер 10-12 (пик микроплазмина) и фракциям номер 15 и 16 (пост-пик), собирали и материал из них подвергали секвенированию с отщеплением N-концевой аминокислы (расщепление Эдмана). Предельное элюирование в районе фракций номер 17-18, соответствует пику буфера. SEC выполнили на колонке Amersham Bioscience Superdex 75 10/300 GL, соединенной с системой HPLC Waters Alliance. Колонку уравновесили и элюировали буфером, содержащим 8 мМ Na2HPO4, 1,5 мМ KH2PO4, 3 мМ KCl, 0,5 M (NH4)2SO4, pH 7,4. Вводили пятьдесят мкл 1 мг/мл раствора микроплазмина (т.е., 50 мкг микроплазмина). Элюат подвергали мониторингу в отношении белков детектором поглощения УФ при 220 нм.

Полученные аминокислотные последовательности проведены в Таблице 2 и соответствуют “тяжелой цепи” микроплазмина (начиная с аминокислот APS, т.е., 19 C-концевых аминокислот тяжелой цепи) и легкой цепи (начиная с аминокислот VVG), и они соответствуют двум продуктам самораспада (начиная с аминокислот EAQ и аминокислот VCN). Смотри Фигуру 1 для полной последовательности плазмина(плазминогена) и указания на тяжелые- и легкие-цепи и сайты ауторасщепления. Продукты самораспада соответствуют расщеплению амидной связи, которая является C-концевого Lys 137 и Lys 147, соответственно (нумерация начинается с Val в положении 1 легкой цепи плазмина, смотри Фигуру 1).

Микроплазмин из крупномасштабного производства подвергали аутокаталитическому распаду. Микроплазмин в конечной концентрации 0,6 мг/мл инкубировали в течение 4 часов при+20°C при pH 3,1, pH 4,0, pH 5,0, pH 6,0 и pH 7,0, после чего образцы немедленно замораживали при -70°C. Образцы анализировали путем восстанавливающего SDS-PAGE, результаты которого показаны на Фигуре 3 (гель, окрашенный Кумасси бриллиантовым синим). Фигура 3 иллюстрирует основные продукты аутокаталитического распада приблизительно 15 кДа, приблизительно 10 кДа и несколько меньше чем 10 кДа. Наблюдаемые полосы согласуются с сайтами расщепления, что определено посредством секвенирования с отщеплением N-концевой аминокислоты (смотри Таблицу 1).

В другом наборе экспериментов микроплазмин, полученный из крупномасштабного производства (4 мг/мл в 5 мМ лимонной кислоте, 6 мг/мл манните, pH 3,1) разводили в буфере с нейтральным pH и аликвоты, собранные через различные временные промежутки, анализировали либо с помощью SDS-PAGE, либо вестерн-блоттинга. Для анализа SDS-PAGE данные получали с помощью разведения микроплазмина в BSS+(Alcon; содержащий на мл 7,14 мг NaCl, 0,38 мг KCl, 0,154 мг CaCl2, 0,2 мг MgCl2, 0,42 мг фосфата Na, 2,1 мг NaHCO3, 0,92 мг глюкозы и 0,184 мг дисульфида глутатиона; pH 7,4) в конечной концентрации 1,25 мг/мл, причем образец сохраняли при комнатной температуре (Фигура 4A). Для вестерн-блоттинг анализа микроплазмин (конечная концентрация 1,53 мкМ) разводили в PBS, и инкубировали при 37°C, и вестерн-блоттинг проводили с мышиным антителом к микроплазмину (Фигура 4B). Фигуры 4A и 4B иллюстрируют зависящий от времени распад интактного микроплазмина и накопления продуктов аутокаталитического распада. Другой образец получали путем разведения микроплазмина, полученного в крупномасштабном производстве, в 2 раза в 100 мМ фосфате натрия, pH 7,2 и образец инкубировали в течение 30 мин при 37°C. Двадцать пять микрограмм белка затем растворяли на 4-12% полиакриламидном геле. После окрашивания Кумасси полосы, соответствующие двум фрагментам распада, выделяли и пептиды выделяли из геля и подвергали N-концевому секвенированию (проведенному с помощью Eurosequence B.V., Гронинген, Нидерланды). Полоса 15 кДа давала на выходе последовательность, предполагаемую для интактного каталитического домена (Val-Val-Gly-Gly). Меньший фрагмент 10 кДа давал на выходе последовательность Val-Gln-Ser-Thr-Glu-Leu, которая определяет главный сайт расщепления, который находится между Arg 158 и Val 159. Фрагмент 10 кДа также давал на выходе менее распространенную (<10%) последовательность с меньшей растворимостью (Xaa-Xaa-Asn-Arg-Tyr), это предполагает, что второстепенный сайт расщепления расположен со стороны C-конца по отношению к Lys 147. Все нумерации начинаются с Val в положении 1 легкой цепи плазмина (смотри Фигуру 1). Таким образом, когда микроплазмин подвергали самораспаду при 2 мг/мл, идентифицировали дополнительный сайт аутокаталитического расщепления между Arg 158 и Val 159.

Как показано на Фигуре 5, кинетика аутолиза микроплазмина, который оценивался с помощью вестерн-блоттинга (кружки), сопровождает потерю активности микроплазмина (квадраты), что оценивалось с помощью анализа хромогенного субстрата (смотри Пример 3). Данные аутолиза получали из количественной оценки полосы, соответствующей интактному микроплазмину на Фигуре 4B, и из данных активности (которые были наилучшим образом подобраны с использованием уравнения процесса второго порядка; не показано). Из описанных выше экспериментов, был сделан вывод, что самораспад микроплазмина является ответственным за потерю активности и что основные сайты, склонные к аутокаталитическому расщеплению, находятся между Arg 158 и Val 159, между Lys 147 и Val 148 и между Lys 137 и Glu 138.

Интересно, что кинетика инактивации микроплазмина в стекловидном теле глаза была очень сходна с таковой, наблюдаемой в PBS (Фигура 6A), и вестерн-блоттинг анализ показал, что инактивация микроплазмина в стекловидном теле глаза также происходит посредством аутолиза (Фигура 6B). Для этого микроплазмин разводили в PBS (квадраты на Фигуре 6A) или в стекловидном теле глаза свиньи (кружки на Фигуре 6A) до конечной концентрации 1,53 мкМ, и остаточную концентрацию активного микроплазмина измеряли в различные моменты времени с использованием хромогенного субстрата Glu-Phe-Lys-pNA. Образцы стекловидного тела глаза свиньи собирали в указанные моменты времени и анализировали с помощью вестерн-блоттинга (Фигура 6B), как описано выше. Стрелка показывает фрагмент 15 кДа.

ПРИМЕР 2. Построение, экспрессия и очистка вариантов плазминогена и активация до плазмина.

Вектор экспрессии

Вектор секреции pPICZαA, приобретенный у Invitrоgen Corporation (Карлсбад, Калифорния), использовали для прямой экспрессии и секреции рекомбинантного микроплазминогена человека в Pichia pastoris.

Этот вектор содержит сигнал секреции препропептида α-фактора Saccharomyces cerevisiae. Последовательность распознавания ХhoI присутствует на COOH-конце сигнала секреции α-фактора, сразу выше сайта Lys-Arg, который отщепляется Kex2 для удаления сигнала секреции из зрелого белка. Этот сайт рестрикции XhoI может быть использован для клонирования гена интереса наравне с сайтом расщепления Kex2 путем синтеза гена с сайтами распознавания XhoI и Kex2 на его 5' конце. Рекомбинантный ген интереса будет затем экспрессирован с нативным NH2-концом. Сконструированный непосредственно ниже сигнала секреции α-фактора в pPICZαA вектор является сайтом множественного клонирования с сайтами распознавания для ферментов рестрикции EcoRI, SfiI, KpnI, SacII и XbaI для облегчения клонирования гетерологичных генов.

Cинтез генов

Для улучшения экспрессии микроплазминогена человека в Pichia pastoris, гены, кодирующие микроплазминоген человека и его варианты, синтезировали de novo, принимая во внимание предпочтительную использования кодонов Pichia pastoris.

Для конструирования кодон-оптимизированной последовательности гена аминокислотную последовательность микроплазминогена человека (SEQ ID NO:2) вносили в программу Gene Designer, которая разработана DNA2.0 (Менло-Парк, Калифорния) и находится в свободном доступе в интернете. Эту последовательность обратно считали в последовательность ДНК с использованием таблицы использования кодонов Pichia pastoris, обеспеченную программой. Нуклеотидную последовательность затем проверяли вручную и доводили до лучшего соответствия использованию кодонов Escherichia coli. К тому же, палиндромные последовательности из 6 пар оснований и нуклеотидные повторы удаляли при возможности. На 5' конце добавляли сайт рестрикции XhoI и сайт расщепления Kex2 и на 3' конце добавляли сайт рестрикции XbaI.

Мутации вводили в эту последовательность микроплазминогена дикого типа с тем, чтобы изменить аминокислотные остатки, определенные, как описано в Примере 1. Смежные нуклеотиды также изменяли для введения уникального сайта рестрикции, но в данном случае обращали внимание на сохранение кодируемой аминокислотной последовательности.

В первом варианте лизин в положении 137 замещают на глутамин. Lys137 кодируется кодоном AAA в положениях 478-480. Нуклеотиды TTGAAA (положения 475-480) заменили на CTGCAG, вводя сайт PstI и заменяя Lys137 на Gln в белке микроплазминогена, при этом оставляя лейцин в положении 136 неизменным (нуклеотидная последовательность находится в SEQ ID NO:4 и выведенная аминокислотная последовательность в SEQ ID NO:5).

Во втором варианте лизин в положении 147 замещают на гистидин. Lys147 кодируется кодоном AAG в положениях 508-510. Нуклеотиды AAGGTT (положения 508-513) заменили на CACGTG, вводя сайт PmlI и заменяя Lys147 на His в белке микроплазминогена, при этом оставляя валин в положении 148 неизменным (нуклеотидная последовательность находится в SEQ ID NO:6 и выведенная аминокислотная последовательность - в SEQ ID NO:7).

В третьем варианте аргинин в положении 158 замещают на гистидин. Arg158 кодируется кодоном CGT в положениях 540-542. Нуклеотиды TCGTGTT (положения 539-545) заменили на ACACGTG, вводя сайт PmlI и заменяя Arg158 на His в белке микроплазминогена, при этом оставляя глицин в положении 157 и валин в положении 159 неизменными (нуклеотидная последовательность находится в SEQ ID NO:8 и выведенная аминокислотная последовательность - в SEQ ID NO:9).

В четвертом варианте все изменения, описанные выше объединили с замещением лизина в положении 137 на глутамин, лизина в положении 147 на гистидин и аргинина в положении 158 на гистидин (нуклеотидная последовательность находится в SEQ ID NO:10 и выведенная аминокислотная последовательность - в SEQ ID NO:11).

Последовательности варианта микроплазминогена синтезировали de novo и клонировали в вектор pUC57 с помощью Integrated DNA Technologies (Коралвиль, Айова).

В других случаях последовательности микроплазминогена синтезировали и клонировали в вектор pPICZαA с помощью DNA2.0 (Менло-Парк, Калифорния), используя такую же стратегию клонирования.

В других случаях варианты микроплазминогена были получены после сайт-направленного мутагенеза векторов экспрессии, созданных, как описано выше, используя набор для сайт-направленного мутагенеза QuikChange II от Stratagene (Ла-Хойя, Калифорния). Были использованы следующие праймеры:

мутация Lys137Gln:

CGTTCGGTGCTGGTCTGCTGCAGGAAGCACAATTACCTGTG (смысловая; SEQ ID NO:12)

и

CACAGGTAATTGTGCTTCCTGCAGCAGACCAGCACCGAACG (антисмысловая; SEQ ID NO:13)

мутация Lys137Arg:

GGTACGTTCGGTGCTGGTCTGTTGCGTGAAGCACAATTACCTGTGATTG (смысловая; SEQ ID NO:14) и

CAATCACAGGTAATTGTGCTTCACGCAACAGACCAGCACCGAACGTACC (антисмысловая; SEQ ID NO:15)

мутация Lys147Ala:

CAATTACCTGTGATTGAGAACGCCGTGTGTAACAGATACGAGTTC (смысловая; SEQ ID NO:16) и

GAACTCGTATCTGTTACACACGGCGTTCTCAATCACAGGTAATTG (антисмысловая; SEQ ID NO:17)

мутация Lys147Glu:

CAATTACCTGTGATTGAGAACGAAGTGTGTAACAGATACGAGTTC (смысловая; SEQ ID NO:18) и

GAACTCGTATCTGTTACACACTTCGTTCTCAATCACAGGTAATTG (антисмысловая; SEQ ID NO:19)

мутация Lys147Gln:

CAATTACCTGTGATTGAGAACCAAGTGTGTAACAGATACGAGTTC (смысловая; SEQ ID NO:20) и

GAACTCGTATCTGTTACACACTTGGTTCTCAATCACAGGTAATTG (антисмысловая; SEQ ID NO:21)

мутация Arg158Ala:

CAGATACGAGTTCCTGAATGGCGCCGTGCAGTCCACTGAGTTGTGTGCAGG (смысловая; SEQ ID NO:22) и

CCTGCACACAACTCAGTGGACTGCACGGCGCCATTCAGGAACTCGTATCTG (антисмысловая; SEQ ID NO:23)

мутация Arg158Gln:

GATACGAGTTCCTGAATGGTCAGGTTCAGTCCACTGAGTTGTGTG (смысловая; SEQ ID NO:24) и

CACACAACTCAGTGGACTGAACCTGACCATTCAGGAACTCGTATC (антисмысловая; SEQ ID NO:25)

Полный список созданных одинарных, двойных и тройных мутантов представлен в Таблице 3 (смотри ниже).

Построение вектора экспрессии для вариантов микроплазминогена

Последовательности дикого типа и варианта микроплазминогена отщеплены от вектора pUC57, используя XhoI и XbaI, и направленно клонированы в вектор pPICZαA. Реципиентный вектор-фрагмент получали с помощью рестрикции XhoI и XbaI и очищали от агарозного геля, используя набор для извлечения из геля Qiaquick (Qiagen GmbH, Германия). Штамм E.coli TOP10 (Invitrоgen) трансформировали смесью для лигирования и отбирали устойчивые к ампициллину клоны. На основе рекстрикционного анализа плазмидный клон, содержащий вставку предполагаемого размера, сохраняли для дальнейшего получения характеристик. Определение последовательности полученных плазмидных клонов подтверждало точную вставку кодирующей области микроплазминогена, слитую с сигналом спаривания α-фактора, а также отсутствие нежелательных мутаций в кодирующей области.

Экспрессия вариантов микроплазминогена и активация до плазмина

Варианты микроплазминогена и активированные варианты микроплазмина получают, следуя, по сути, процедуре, которая описана в Примере 2 WO 02/50290.

До активации мутанты микроплазминогена очищали с помощью иммуноаффинности непосредственно из супернатантов Pichia pastoris. Мышиное антитело к микроплазмину человека (индуцируемое у мышей Balb/c при использовании микроплазмина как антигена; продуцируемое клеточной линией гибридoмы 7H11A11, доступное от ThromboGenics N.V.) связывали на сефарозных бусинах согласно протоколу №71500015AD от GE Healthcare. Согласно этому протоколу 7,5 мл смолы для иммуноаффинной хроматорафии получали из 45 мг антитела и упаковывали в колонку XK 16/20. 200-400 мл неочищенного супернатанта (отфильтрованного через фильтр 0,2 мкМ из культуры Pichia/pH 6,0) напрямую загружали на аффинную колонку 7H11A11. После этапа отмывки (100 мМ KH2PO4, 0,5M NaCl, pH 6,2, 10 объемов колонки) вариант микроплазминогена элюировали с 0,2M глицин-HCl буфера, pH 3,0.

Элюат (фракции 4-6) нейтрализовали и подвергали диализу против 25 мМ натрий фосфатного буфера, pH 7,2. Очистка мутанта Lys157Met (K157M) проиллюстрирована на Фигуре 7 посредством хроматограммы, полученной при иммуноаффинной хроматографии (A), и различные фракции элюата анализировали с помощью SDS-PAGE с последующим окрашиванием Кумасси (B).

Аминокислотные последовательности и нуклеотидные последовательности описанных выше видов микроплазминогена дикого типа и варианта микроплазминогена перечислены ниже.

SEQ ID NO:2 - Аминокислотная последовательность человеческого микроплазминогена дикого типа

apsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqstelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwiegvmrnn

SEQ ID NO:3 - Последовательность искусственной нуклеиновой кислоты с оптимизированным использованием кодона для экспрессии в Pichia. Последовательность нуклеиновой кислоты кодирует аминокислотную последовательность человеческого микроплазминогена дикого типа SEQ ID NO:2

GCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGTTGAAAGAAGCACAATTACCTGTGATTGAGAACAAGGTTTGTAACAGATACGAGTTCCTGAATGGTCGTGTTCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAA

SEQ ID NO:4 - Вариант микроплазминогена с заменой Lys137Gln (мутированный кодон показан полужирным курсивом, сайты рестрикции XhoI, PstI и XbaI подчеркнуты)

CTCGAGAAAAGAGCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGCTGCAGGAAGCACAATTACCTGTGATTGAGAACAAGGTTTGTAACAGATACGAGTTCCTGAATGGTCGTGTTCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAATCTAGA

SEQ ID NO:5 - Выведенная аминокислотная последовательность SEQ ID NO:4 (подчеркнутые N-концевые аминокислоты “LEKR” кодируются введенными сайтами расщепления XhoI+Kex2; введенная мутация по аминокислоте указана полужирным шрифтом/курсивом и подчеркнута)

lekrapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipaclpspnyvvadrtecfitgwgetqgtfgagllQeaqlpvienkvcnryeflngrvqstelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwiegvmrnn

SEQ ID NO:6 - Вариант микроплазминогена с заменой Lys147His (мутированный кодон показан полужирным курсивом, сайты рестрикции XhoI, PmlI и XbaI подчеркнуты)

CTCGAGAAAAGAGCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGTTGAAAGAAGCACAATTACCTGTGATTGAGAACCACGTGTGTAACAGATACGAGTTCCTGAATGGTCGTGTTCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAATCTAGA

SEQ ID NO:7 - Выведенная аминокислотная последовательность SEQ ID NO:6 (подчеркнутые N-концевые аминокислоты “LEKR” кодируются введенными сайтами расщепления XhoI+Kex2; введенная мутация по аминокислоте указана полужирным шрифтом/курсивом и подчеркнута)

lekrapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienhvcnryeflngrvqstelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwiegvmrnn

SEQ ID NO:8 - Вариант микроплазминогена с заменой Arg158His (мутированный кодон показан полужирным курсивом, сайты рестрикции XhoI, PmlI и XbaI подчеркнуты)

CTCGAGAAAAGAGCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGTTGAAAGAAGCACAATTACCTGTGATTGAGAACAAGGTTTGTAACAGATACGAGTTCCTGAATGGACACGTGCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAATCTAGA

SEQ ID NO:9 - Выведенная аминокислотная последовательность SEQ ID NO:8 (подчеркнутые N-концевые аминокислоты “LEKR” кодируются введенными сайтами расщепления XhoI+Kex2; введенная мутация по аминокислоте указана полужирным шрифтом/курсивом и подчеркнута)

lekrapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflnghvqstelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwiegvmrnn

SEQ ID NO:10 - Вариант микроплазминогена с заменами Lys137Gln, Lys147His и Arg158His (мутированные кодоны показаны полужирным курсивом, сайты рестрикции XhoI, PstI, PmlI и XbaI подчеркнуты)

CTCGAGAAAAGAGCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGCTGCAGGAAGCACAATTACCTGTGATTGAGAACCACGTGTGTAACAGATACGAGTTCCTGAATGGACACGTGCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAATCTAGA

SEQ ID NO:11 - Выведенная аминокислотная последовательность SEQ ID NO:10 (подчеркнутые N-концевые аминокислоты “LEKR” кодируются введенными сайтами расщепления XhoI+Kex2; введенные мутации по аминокислотам указаны полужирным шрифтом/курсивом и подчеркнуты)

lekrapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipaclpspnyvvadrtecfitgwgetqgtfgagllQeaqlpvienhvcnryeflnghvqstelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwiegvmrnn

ПРИМЕР 3. Пониженный аутопротеолиз вариантов плазмина по сравнению с плазмином дикого типа.

Очищенные мутанты микроплазминогена вначале превращали в активные разновидности микроплазмина с использованием рекомбинантной стафилокиназы (SAK-SY162) или урокиназы (Sigma). Вкратце, мутанты микроплазминогена (как правило, 5-20 мкМ в 25 мМ фосфате натрия, pH 7,2) инкубировали при 37°C в присутствии стафилокиназы (типичное соотношение микроплазминоген/стафилокиназа=50/1) или урокиназы (типичное соотношение микроплазминоген/урокиназа=200) и появление активных видов микроплазмина отслеживали путем мониторинга гидролитической активности по отношению к хромогенному субстрату S-2403 (использован при концентрации 0,3 мM), как описано в других местах. Как только достигалась максимальная активность, степень превращения микроплазминогена оценивали с помощью SDS-PAGE и HPLC. После активации аутолитическую реакцию отслеживали путем измерения потери активности в образце, который поддерживали при 37°C. Аутолитический распад также визуализировали с помощью SDS-PAGE и HPLC. Типичный пример такого эксперимента показан на Фигурах 8A-C.

Определение констант скорости реакции второго порядка для аутолиза (k) определяли следующим образом: (1) область пика микроплазмина в HPLC использовали для расчета молярной концентрации активной разновидности микроплазмина (путем сравнения со стандартной кривой, установленной с очищенным микроплазмином дикого типа) в конце фазы активации/начале аутолитической фазы; (2) потерю активности, измеренную во время аутолитической фазы, использовали для расчета для каждого момента времени остаточной молярной концентрации активного микроплазмина; (3) остаточную концентрацию микроплазмина (в моль/л) наносили на график как функцию от времени (в секундах), и данные приводили в соответствие с Уравнением 1 посредством нелинейного регрессионного анализа с получением константы аутолиза k, значение которой выражено в M-1 с-1.

Уравнение 1:

[μPL]=[μPL]0/(1+[μPL]0·k·t)

В Уравнении 1, [μPL] - это концентрация микроплазмина в любое заданное время и [μPL]0 - это концентрация при t=0. Пример такой кривой показан на Фигуре 8D и значения k, измеренные для различных мутантов микроплазмина, представлены в Таблице 3 (смотри ниже).

SAK-SY162 - представляет собой вариант стафилокиназы Sak-STAR (Collen et al. 1992; Fibrinolysis 6, 203-213) со следующими аминокислотными заменами: K35A, E65Q, K74R, E80A, D82A, T90A, E99D, T101S, E108A, K109A, K130T и K135R.

ПРИМЕР 4. Протеолитическая активность вариантов плазмина по сравнению с плазмином дикого типа.

Гидролитическую активность микроплазмина можно отследить, используя хромогенный субстрат Glu-Phe-Lys-pNA (S-2403, Chromogenix, Милан, Италия). При гидролизе субстрата высвобождается pNA (p-нитроанилиновая) группа, которая приводит к повышению поглощения при 405 нм. Активность микроплазмина дикого типа и вариантов микроплазмина измеряли при помощи спектрофотометра для считывания планшетов Powerwave X (Bio-Tek). Анализы проводили при 37°C, в 50 мМ Трис, 38 мМ NaCl, 0,01% Tween 80, pH 7,4.

Для вариантов микроплазмина препараты были вначале активированы стафилокиназой или урокиназой, и концентрацию активной разновидности микроплазмина определяли в конце фазы активации, как описано в других местах. Однако для того, чтобы предотвратить последующую инактивацию, активированные образцы стабилизировали понижением pH до ~ 3 путем добавления 2 объемов 5 мМ лимонной кислоты.

Кинетические параметры (kкат и Kм) вариантов микроплазмина по отношению к хромогенному субстрату S-2403 были получены путем измерения начальных скоростей гидролиза при различных концентрациях субстрата и путем анализа данных с использованием Уравнения 2, где [μPL] - это концентрация активного микроплазмина, которая измерена с помощью HPLC, и [S] - это концентрация S-2403. Пример определения kкат и Kм из результатов измерения начальных скоростей гидролиза показан на Фигуре 9.

Уравнение 2:

υi=(kкат·[μPL]· [S])/(KM+[S])

Значения kкат и Kм, полученные для различных мутантов микроплазмина, приведены в Таблице 3.

Таблица 3. Общий обзор кинетических параметров (kкат и Kм) и констант скорости аутолиза микроплазмина дикого типа и ряда одинарных, двойных и тройных мутантов.

Кинетические параметры Константа скорости аутолиза
Мутант kкат (с-1) Kм (M) k (M-1 с-1)
Дикий тип 46 7,6 x10-5 230
137A 61 1,4 x10-2 3
137E 5 2,2 x10-3 1
137F 29 4,0 x 10-3 1,6
137H 54 6,0 x10-3 8
137I Не определено Не определено 5
137M 36 4,7 x10-3 1
137Q 55 3,6 x10-3 10
137R 39 8,1 x 10-3 3
147A 34 1,3 x 10-4 24
147E 35 9,2 x 10-5 21
147F 32 1,0 x 10-4 122
147H 51 1,3 x 10-4 118
147I 36 1,1 x 10-4 76
147Q 39 8,5 x 10-5 45
158A 32 1,2 x 10-4 80
158E 24 1,8 x10-4 86
158F 36 2,2 x10-4 159
158H 59 1,7 x 10-4 192
158I 31 2,1 x 10-4 66
158Q 29 1,2 x 10-4 59
137A147A 64 1,6 x 10-2 5
137A147H 40 1,2 x 10-2 1
137A158A 36 6,4 x 10-3 1,4
137A158H 30 1,1 x 10-2 0,7
137H147H 38 6,2 x 10-3 3
137H158H 40 7,7 x 10-3 2
137Q147H 69 8 x 10-3 <0,5
137Q158H 38 3,9 x 10-3 <1,3
147A158A 33 7,9 x 10-5 26
147A158H 27 1,1 x 10-4 57
147H158H 50 1,7 x 10-4 163
147H158A 29 1,3 x 10-4 30
137A147A158A 46 8,3 x 10-3 <0,8
137A147H158H 25 9,1 x 10-3 <0,7
137H147A158A 27 3,2 x 10-3 <1,2
137H147H158H 34 4,5 x 10-3 <0,6
137Q147H158H 45 6,6 x 10-3 1
137R147H158H 30 7,2 x 10-3 <4

ПРИМЕР 5. Терапевтическая эффективность вариантов плазмина в моделях in vitro или in vivo.

5.1 Эффект вариантов плазмина на размер ишемического инсульта.

Эффективность вариантов плазмина данного изобретения в снижении размера ишемического инсульта может быть продемонстрирована в мышиной модели ишемического инсульта, такой как описана в Примере 2 WO 00/18436 или согласно Welsh et al. (1987, J Neurochem 49, 846-851). Благоприятный эффект плазмина дикого типа на размер ишемического инсульта был продемонстрирован в Примере 5 WO 00/18436. Подобный эксперимент проводят с любым из вариантов плазмина данного изобретения и благоприятный эффект этих вариантов плазмина измеряют и сравнивают с благоприятным эффектом плазмина дикого типа.

5.2 Тромболитическая активность вариантов плазмина in vivo

Кроличья модель тромболиза с экстракорпоральной петли (Пример 6 WO 02/50290; Hotchkiss et al., 1987, Thromb Haemost 58, 107 - Реферат 377), модель тромбоза, индуцированного медной спиралью в огибающей ветви коронарной артерии собаки (Пример 8 WO 02/50290; Bergmann et al., 1983, Science 220, 1181-1183) или модель тромбоза яремной вены кролика (Collen et al., 1983, J Clin Invest 71, 368-376) могут использоваться для демонстрации in vivo тромболитической активности вариантов плазмина данного изобретения. Благоприятный эффект плазмина дикого типа на тромболиз был продемонстрирован с этими моделями, как описано в Примерах 7 и 9 WO 00/18436 и Collen et al. (1983). Сходные эксперименты проводят с любым из вариантов плазмина данного изобретения и благоприятный эффект этих вариантов плазмина измеряют и сравнивают с благоприятным эффектом плазмина дикого типа.

5.3 Тромболитическая активность вариантов плазмина in vitro

Модель закупорки периферической артерии (PAO) in vitro описана в Примере 6 WO 01/36609 и тромболитическая эффективность плазмина дикого типа была продемонстрирована в этой модели. Сходный эксперимент проводят с любым из вариантов плазмина данного изобретения и благоприятный эффект этих вариантов плазмина на тромболиз закупорок периферических артерий измеряют и сравнивают с благоприятным эффектом плазмина дикого типа.

5.4 Разжижение стекловидного тела глаза и задняя отслойка стекловидного тела, индуцированные вариантами плазмина

Пример 5 WO 2004/052228 раскрывает анализ для определения эффективности, а также эффективность микроплазмина в разжижении стекловидного тела в глазах свиньи после смерти. Пример 6 WO 2004/052228 раскрывает анализ для определения эффективности, а также эффективность микроплазмина в индукции задней отслойки стекловидного тела (PVD) в глазах человека после смерти. Индукцию разжижения стекловидного тела и PVD с помощью вариантов плазмина данного изобретения показывают в сходных посмертных моделях.

5.5 PVD in vivo, индуцированное вариантами плазмина

Пример 7 WO 2004/052228 раскрывает анализ для определения эффективности, а также эффективность микроплазмина в индуцировании в кошачьей модели PVD in vivo. Индукцию PVD вариантами плазмина данного изобретения показывают в сходной модели in vivo.

1. Выделенный вариант плазминогена, позволяющий получить аутопротеолитически стабильный плазмин, отличающийся тем, что он содержит в своем каталитическом домене мутацию одной внутренней аминокислоты в положении Р, пептидная связь которой с внутренней аминокислотой в положении Р+1 склонна к аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении Р+1 является менее склонной к аутопротеолизу, причем указанная одна внутренняя аминокислота в положении Р представляет собой:
(i) лизин в положении 147 каталитического домена плазмина человека или соответствующий лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, и причем указанный лизин или аргинин мутирован в аланин, глутамат, глутамин, гистидин, изолейцин или фенилаланин;
(ii) лизин в положении 137 каталитического домена плазмина человека, с учетом, что указанный вариант плазминогена содержит интактный сайт активации в аминокислотных положениях 561 и 562 относительно Glu-плазминогена человека, и если аминокислоты в положении 536 и 541 относительно Glu-плазминогена человека присутствуют снаружи каталитического домена, то указанные аминокислоты представляют собой цистеины дикого типа, и причем указанный лизин или аргинин мутирован в аланин, глутаман, фенилаланин, гистидин, изолейцин, метионин, глутамин или аргинин;
(iii) лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, соответствующий лизину в положении 137 каталитического домена человека, и причем указанный лизин или аргинин мутирован в аланин, глутамат, фенилаланин, гистадин, изолейцин, метионин или глутамин;
(iv) аргинин в положении 158 каталитического домена плазмина человека мутирован в аланин, глутамат, фенилаланин, гистидин, изолейцин или глутамин, с учетом, что если указанный аргинин в положении 158 мутирован в аланин или глутамат, то по меньшей мере одна другая внутренняя аминокислота каталитического домена плазмина человека в положении Р′, пептидная связь которой с внутренней аминокислотой в положении Р′+1 склонна к аутопротеолизу, мутирована в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении Р′+1 является менее склонной или не склонна к аутопротеолизу; или
(v) лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, соответствующий лизину в положении 158 каталитического домена плазмина человека, и причем указанный лизин или аргинин мутирован в аланин, глутамат, фенилаланин, гистидин, изолейцин или глутамин;
причем указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена.

2. Вариант плазминогена по п. 1, где каталитический домен плазмина состоит из аминокислот 562-791 SEQ ID NO: 1.

3. Вариант плазминогена по п. 1, где указанный вариант плазминогена выбран из группы, включающей Glu-плазминоген, Lys-плазминоген, мидиплазминоген, миниплазминоген, микроплазминоген, дельтаплазминоген.

4. Аутопротеолитически стабильный вариант плазмина, полученный из варианта плазминогена по пп. 1-3.

5. Вариант плазмина по п. 4, где указанный плазмин выбран из группы, включающей Glu-плазмин, Lys-плазмин, мидиплазмин, миниплазмин, микроплазмин, дельтаплазмин.

6. Вариант плазмина по п. 4, дополнительно отличающийся тем, что его константа аутолиза составляет не более 95% константы аутолиза плазмина дикого типа.

7. Вариант плазмина по п. 4, дополнительно отличающийся тем, что каталитическая константа kкат находится в диапазоне от 10% до 200% kкат плазмина дикого типа.

8. Вариант плазмина по п. 4, дополнительно отличающийся тем, что его константа аутолиза составляет не более 95% константы аутолиза плазмина дикого типа, и его каталитическая константа kкат находится в диапазоне от 10% до 200% kкат плазмина дикого типа.

9. Вариант плазмина по любому из пп. 4-8 для применения в качестве лекарственного препарата.

10. Вариант плазмина по любому из пп. 4-8, где указанный вариант плазмина находится в форме протеолитически активного или обратимо неактивного производного.

11. Способ получения аутопротеолитически стабильного варианта плазмина по п. 4, где указанный способ включает этапы, на которых:
(i) мутируют в плазминогене одну аминокислоту аргинин или лизин, которая соответствует положениям 137, 147 и 158 каталитического домена плазмина человека или соответствующих аргининов или лизинов плазмина, не принадлежащего человеку, в аминокислоту, отличающуюся от природной аминокислоты, с получением варианта плазминогена по п. 1,
(ii) активируют мутантный плазминоген с использованием рекомбинантной стафилокиназы или урокиназы с дальнейшим превращением его в плазмин,
(iii) определяют аутопротеолитическую стабильность мутанта, полученного из (ii), и
(iv) отбирают из (iii) мутанта, который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта плазмина;
где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

12. Способ по п. 11, дополнительно включающий этап, где определяют протеолитическую активность аутопротеолитически стабильного варианта плазмина.

13. Способ получения варианта плазминогена по любому из пп. 1-3, где указанный способ включает этапы, на которых:
(i) вводят нуклеиновую кислоту, кодирующую плазминоген по любому из пп. 1-3, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;
(ii) выращивают клетку-хозяина, полученную в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине; и
(iii) собирают плазминоген, экспрессированный в (ii).

14. Способ по п. 13, дополнительно включающий этап (iv), где плазминоген, собранный в (iii), очищают.

15. Способ получения варианта плазмина по любому из пп. 4-8, где указанный способ включает этапы, на которых:
(i) вводят нуклеиновую кислоту, кодирующую плазминоген по любому из пп. 1-3, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;
(ii) выращивают клетку-хозяина, полученную в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине;
(iii) собирают плазминоген, экспрессированный в (ii);
(iv) активируют плазминоген из (iii) до плазмина.

16. Способ по п. 15, где плазминоген, собранный в (iii), очищают перед активацией в (iv).

17. Способ по п. 15, где активный плазмин, полученный в (iv), очищают.

18. Способ по п. 15, где получают производные активного плазмина и/или активный плазмин обратимо инактивируют.

19. Выделенная нуклеиновая кислота, кодирующая вариант плазминогена по любому из пп. 1-3.

20. Выделенная нуклеиновая кислота, кодирующая вариант плазмина по любому из пп. 4-8.

21. Вектор экспрессии, содержащий нуклеиновую кислоту по п. 19.

22. Вектор экспрессии, содержащий нуклеиновую кислоту по п. 20.

23. Клетка-хозяин, трансформированная нуклеиновой кислотой по п. 19, для экспрессии плазминогена, который кодируется указанной нуклеиновой кислотой.

24. Клетка-хозяин, трансформированная нуклеиновой кислотой по п. 20, для экспрессии плазмина, который кодируется указанной нуклеиновой кислотой.

25. Клетка-хозяин, трансформированная вектором по п. 21, для экспрессии плазминогена, который кодируется указанной нуклеиновой кислотой.

26. Клетка-хозяин, трансформированная вектором по п. 22, для экспрессии плазмина, который кодируется указанной нуклеиновой кислотой.

27. Вариант плазминогена, позволяющий получить аутопротеолитически стабильный плазмин, отличающийся тем, что он содержит в своем каталитическом домене мутацию двух внутренних аминокислот в положении Р, пептидная связь которой с внутренней аминокислотой в положении Р+1 склонна к аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении Р+1 является менее склонной к аутопротеолизу, причем указанные две внутренние аминокислоты в положении Р представляют собой комбинации:
(i) лизин в положении 137 каталитического домена плазмина человека, и причем указанный лизин мутирован в аланин, глутамат, фенилаланин, гистидин, изолейцин, метионин, глутамин или аргинин;
(ii) лизин или аргинин каталитического домена плазмина, не принадлежащего человеку, соответствующего лизину в положении 137 каталитического домена плазмина человека, и причем указанный лизин или аргинин мутирован в аланин, глутамат, фенилаланин, гистидин, изолейцин, метионин или глутамин;
(iii) лизин в положении 147 каталитического домена плазмина человека или соответствующего лизина или аргинина каталитического домена плазмина, не принадлежащего человеку, и причем указанный лизин или аргинин мутирован в аланин, глутамат, глутамин, гистидин, изолейцин или фенилаланин; или
(vi) аргинин в положении 158 каталитического домена плазмина человека или соответствующего аргинина или лизина каталитического домена плазмина, не принадлежащего человеку, и причем указанный лизин или аргинин мутирован в аланин, глутамат, фенилаланин, гистидин, изолейцин или глутамин;
где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

28. Вариант плазминогена по п. 27, где каталитический домен плазмина состоит из аминокислот 562-791 SEQ ID NO: 1.

29. Аутопротеолитически стабильный вариант плазмина, полученный из варианта плазминогена по пп. 27 и 28.

30. Вариант плазмина по п. 29, где указанный плазмин выбран из группы, включающей Glu-плазмин, Lys-плазмин, мидиплазмин, миниплазмин, микроплазмин, дельтаплазмин.

31. Вариант плазмина по п. 29, дополнительно отличающийся тем, что его константа аутолиза составляет не более 95% константы аутолиза плазмина дикого типа.

32. Вариант плазмина по п. 29, дополнительно отличающийся тем, что каталитическая константа kкат находится в диапазоне от 10% до 200% kкат плазмина дикого типа.

33. Вариант плазмина по п. 29, дополнительно отличающийся тем, что его константа аутолиза составляет не более 95% константы аутолиза плазмина дикого типа, и его каталитическая константа kкат находится в диапазоне от 10% до 200% kкат плазмина дикого типа.

34. Вариант плазмина по любому из пп. 29-33 для применения в качестве лекарственного препарата.

35. Вариант плазмина по любому из пп. 29-33, где указанный вариант плазмина находится в форме протеолитически активного или обратимо неактивного производного.

36. Способ получения аутопротеолитически стабильного варианта плазмина по п. 29, где указанный способ включает этапы, на которых:
(i) мутируют в плазминогене две аминокислоты аргинин или лизин, которые соответствуют положениям 137, 147 и 158 каталитического домена плазмина человека или соответствующих аргининов или лизинов плазмина, не принадлежащего человеку, в аминокислоты, отличающиеся от природных аминокислот, с получением варианта плазминогена по п. 27,
(ii) активируют мутантный плазминоген с использованием рекомбинантной стафилокиназы или урокиназы с дальнейшим превращением его в плазмин,
(iii) определяют аутопротеолитическую стабильность мутанта, полученного из (ii), и
(iv) отбирают из (iii) мутанта, который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта плазмина;
где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является той же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

37. Способ по п. 36, дополнительно включающий этап, где определяют протеолитическую активность аутопротеолитически стабильного варианта плазмина.

38. Способ получения варианта плазминогена по любому из пп. 27 и 28, где указанный способ включает этапы, на которых:
(i) вводят нуклеиновую кислоту, кодирующую плазминоген по любому из пп. 27 и 28, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;
(ii) выращивают клетку-хозяина, полученную в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине; и
(iii) собирают плазминоген, экспрессированный в (ii).

39. Способ по п. 38, дополнительно включающий этап (iv), где плазминоген, собранный в (iii), очищают.

40. Способ получения варианта плазмина по любому из пп. 29-33, где указанный способ включает этапы, на которых:
(i) вводят нуклеиновую кислоту, кодирующую плазминоген по любому из пп. 27 и 28, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;
(ii) выращивают клетку-хозяина, полученную в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине;
(iii) собирают плазминоген, экспрессированный в (ii);
(iv) активируют плазминоген из (iii) до плазмина.

41. Способ по п. 40, где плазминоген, собранный в (iii), очищают перед активацией в (iv).

42. Способ по п. 40, где активный плазмин, полученный в (iv), очищают.

43. Способ по п. 40, где получают производные активного плазмина и/или активный плазмин обратимо инактивируют.

44. Выделенная нуклеиновая кислота, кодирующая вариант плазминогена по любому из пп. 27 и 28.

45. Выделенная нуклеиновая кислота, кодирующая вариант плазмина по любому из пп. 29-33.

46. Вектор экспрессии, содержащий нуклеиновую кислоту по п. 44.

47. Вектор экспрессии, содержащий нуклеиновую кислоту по п. 45.

48. Клетка-хозяин, трансформированная нуклеиновой кислотой по п. 44, для экспрессии плазминогена, который кодируется указанной нуклеиновой кислотой.

49. Клетка-хозяин, трансформированная нуклеиновой кислотой по п. 45, для экспрессии плазмина, который кодируется указанной нуклеиновой кислотой.

50. Клетка-хозяин, трансформированная вектором по п. 46, для экспрессии плазминогена, который кодируется указанной нуклеиновой кислотой.

51. Клетка-хозяин, трансформированная вектором по п. 47, для экспрессии плазмина, который кодируется указанной нуклеиновой кислотой.



 

Похожие патенты:

Изобретение относится к биотехнологии и представляет собой иммобилизованную на матрице стрептокиназу, активирующую плазминоген в плазмин. Такая стрептокиназа устойчива к расщеплению плазмином по сравнению с соответствующей ей стрептокиназой дикого типа и содержит аминокислотную последовательность, имеющую аспарагин в положениях, соответствующих положениям 85 и 412 в SEQ ID NO:1.

Изобретение относится к области биотехнологии и может быть использовано для выделения плазминогена или плазмина. .

Изобретение относится к получению высокоочищенных высокоактивных ферментных препаратов-активаторов плазминогена, которые могут быть использованы в биохимии и медицине.

Изобретение относится к области биохимии и может быть использовано в фармацевтической промышленности для очистки смесей природного происхождения, содержащих плазминоген и фибриноген, от плазминогена.
Изобретение относится к области физиологии и биохимии свертывания крови и цитологии и может быть применено в фармакологии и экспериментальной медицине. .

Изобретение относится к микробиологической промышленности, к производству ферментов и касается нового штамма бактерий, продуцирующего внеклеточную протеинаду с тромболитическим действием.

Изобретение относится к области биохимии, в частности к соединениям и композициям для ослабления экспрессии гентингтина. Заявлены варианты одноцепочечного модифицированного олигонуклеотида, ингибирующего экспрессию гентингтина.

Изобретение относится к области биохимии, в частности к соединениям и композициям для ослабления экспрессии гентингтина. Заявлены варианты одноцепочечного модифицированного олигонуклеотида, ингибирующего экспрессию гентингтина.

Настоящее изобретение относится к области молекулярной иммунологии, биотехнологии и медицины. Создана рекомбинантная псевдоаденовирусная частица, на основе генома аденовируса человека 5 серотипа, содержащая экспрессирующую кассету со вставкой гена модифицированного химерного наноантитела, связывающегося с микоплазмой M.

Настоящее изобретение относится к области иммунологии. Предложен выделенный пептид, обладающий способностью индуцировать цитотоксические Т-лимфоциты (ЦТЛ) в присутствии антигенпредставляющих клеток (АПК), несущих HLA-A*2402, и представляющий собой фрагмент белка FOXM1.

Изобретение относится к области биотехнологии, конкретно к использованию антисмыслового олигонуклеотида ISIS 301012 для долгосрочного понижения уровней АроВ, и может быть использовано в медицине.

Настоящее изобретение относится к области биотехнологии. Предложено терапевтическое антитело и терапевтический фрагмент антитела для повышения продукции тромбоцитов, включающие пептид-миметик тромбопоэтина (ТРО), содержащий последовательность IEGPTLRQWLAARA и встроенный как дополнение к С-концу константной области легкой цепи и/или в положении менее 20 аминокислот ниже С-конца шарнирной области тяжелой цепи.

Изобретение относится к области биохимии. Предложен способ выделения коротких РНК из биологических жидкостей.

Настоящее изобретение относится к биотехнологии и представляет собой конъюгат для внутриклеточной доставки миРНК, содержащий миРНК, которая посредством ковалентной связи конъюгирована с одной стороны с гидрофильным соединением, например, с ПЭГ, а с другой стороны с гидрофобным соединением, например с холестерином.

Изобретение относится к области биохимии, в частности к способам получения растения с повышенной устойчивостью к засухе и действию солей по сравнению с диким видом растения путем снижения экспрессии/функции белка-фактора транскрипции у растения.

Изобретения относятся к области ДНК-генеалогии и касаются способа определения гаплогрупп Y-хромосомы человека, тест-системы и олигонулкотидных праймеров. Охарактеризованный способ осуществляют в два этапа.

Изобретение относится к области иммунологии и медицины. Предложено пептидное производное для выработки в организме специфических антител, взаимодействующих с изоформой 2 фактора элонгации трансляции 1A (eEF1A2), но не взаимодействующих с изоформой 1 фактора элонгации трансляции 1A (eEF1A1), содержащее фрагмент аминокислотной последовательности eEF1A2 с 330 по 343 положения.
Наверх