Антитело, набор и способ определения амилоидных пептидов

Авторы патента:


Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов
Антитело, набор и способ определения амилоидных пептидов

 


Владельцы патента RU 2571213:

ЭРЭКЛОН БАЙОТЕК, С.Л. (ES)

Изобретение относится к биохимии. Описаны способы определения: пептида Aβ(1-17) в образце; имеется ли у субъекта умеренная форма болезни Альцгеймера; имеется ли у субъекта умеренное когнитивное нарушение с продромальной формой болезни Альцгеймера и мониторинга болезни Альцгеймера. Способы включают определение действия или уровня пептида Aβ(1-17) на основании количества выявленной метки. Изобретение представляет способы, позволяющие отличать пациентов с умеренной формой болезни Альцгеймера, с продромальной формой, с непродромальным умеренным когнитивным нарушением, с непродромальным умеренным когнитивным ухудшением. 7 н. и 1 з.п. ф-лы, 6 ил., 3 табл., 4 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к области иммуноисследований, которые позволяют обнаруживать пептиды Aβ17 за счет применения анти-Aβ17 антитела, набора и способа применения указанного антитела. Настоящее изобретение также относится к способу диагностики или разграничения разных стадий нейродегенеративного заболевания.

Предпосылки создания изобретения

Болезнь Альцгеймера (БА) - это прогрессирующее дегенеративное заболевание центральной нервной системы, отличающееся прогрессирующей и усиливающейся потерей памяти с последующей утратой контроля над функционированием конечностей и туловища, заканчивающееся смертельным исходом. Общепризнанно, что это основная причина возникновения старческого слабоумия, которому подвержены от 1 до 6% людей в возрасте старше 65 лет и от 10 до 20% людей старше 80 лет.

БА отличается от других типов слабоумия рядом патологических признаков, включая все возрастающее возникновение в мозге пациентов сенильных бляшек, локализованных во внеклеточном пространстве между нейронами. Бляшки содержат центральные ядра амилоидных отложений, сформированных в основном фибриллами пептида длиной 40-42 аминокислоты, называемого амилоидным пептидом β (Aβ), окруженными дегенеративными невритами и глиальными клетками. Этот пептид образуется в результате протеолиза белка-предшественника, называемого β-амилоидным белком-предшественником (β amyloid precursor protein - βAPP).

Национальный институт неврологических заболеваний и инсульта (National Institute of Neurological и Communicative Disorders и Stroke - NINCDS) совместно с Ассоциацией болезни Альцгеймера и связанных нарушений (Alzheimer′s Disease и Related Disorders Association - ADRDA) установил в 1984 году наиболее широко применяемые критерии NINCDS-ADRDA для диагностики болезни Альцгеймера. Критерии NINCDS/ADRDA включают:

- Окончательная постановка диагноза болезнь Альцгеймера: состояние пациента соответствует критериям предполагаемой болезни Альцгеймера и у него обнаружено доказательство БА за счет аутопсии или биопсии.

- Вероятный или продромальный период болезни Альцгеймера: слабоумие устанавливают с помощью клинических и нейрофизиологических исследований. Когнитивные ухудшения также прогрессируют и наблюдаются в двух или более областях сознания. Возникновение ухудшений происходит в возрасте 40-90 лет и в итоге не должно быть других болезней, способных вызвать синдром слабоумия.

- Возможный или непродромальный диагноз болезни Альцгеймера: синдром слабоумия с атипичным началом, имеющимся состоянием или прогрессированием; без известной этиологии; однако предполагают, что в начале заболевания отсутствуют сопутствующие заболевания, способные вызвать слабоумие.

- Диагноз болезни Альцгеймера маловероятен: у пациента имеется синдром слабоумия с внезапным началом, с фокальными нейрологическими признаками или с пароксизмами или расстройством походки в начале заболевания.

Диагнозом умеренного когнитивного нарушения (УКН), также называемого начальным слабоумием или отдельным нарушением памяти, является диагноз, который ставят тем индивидуумам, у которых есть когнитивные нарушения, помимо тех, которые ожидаемы для их возраста и образования, но которые существенно не влияют на их повседневную деятельность (Petersen R.C. и др., Arch. Neurol. 56(3), 1999, cc.303-308). Полагают, что эта форма заболевания является пограничной или промежуточной стадией между нормальным старением и слабоумием. Хотя при УКН могут быть различные симптомы, потеря памяти является доминирующим симптомом, и состояние называют «УКН с потерей памяти» и часто рассматривают в качестве фактора риска развития болезни Альцгеймера (Grundman М. и др., Arch. Neurol. 61(1), 2004, cc.59-66). Исследования подтверждают, что у таких индивидуумов проявляется тенденция к прогрессированию предполагаемой или продромальной болезни Альцгеймера со скоростью примерно 10-15% в год (Grundman М. и др., Arch. Neurol. 61(1), 2004, cc.59-66). Кроме того, если у индивидуумов имеются наследственные нарушения, несвязанные с памятью, их классифицируют в качестве одно- или множественно доменных УКН без амнезии и полагают, что у этих индивидуумов с большей вероятностью происходит конверсия в другие формы слабоумия (Tabert М.Н. и др., Arch. Gen. Psychiatry 63(8), 2006, cc.916-924).

Диагноз УКН нуждается в существенном клиническом исследовании, и в этом случае наилучшим вариантом является всесторонняя клиническая оценка, включающая наблюдение, нейровизуализацию, анализы крови и нейропсихологическое тестирование для утверждения иного диагноза. Сходную оценку обычно дают при диагностике болезни Альцгеймера. Диагностируют УКН в случае (Morris J.C. и др., Arch. Neurol. 58(3), 2001, cc.397-405):

- Доказанного нарушения памяти

- Сохранения общих когнитивных и функциональных способностей

- Отсутствия диагностируемого слабоумия

За последние десять лет предпринят ряд попыток идентификации периферических маркеров с помощью плазмы, сыворотки или клеток крови. В частности, поскольку амилоидные бляшки являются отличительным свойством нейропатологического состояния при болезни Альцгеймера и Аβ можно обнаружить в плазме, его измерение является убедительным биомаркером болезни Альцгеймера.

В клинической практике диагностику БА проводят, используя клинические критерии, основанные на наличии типичных клинических признаков и на исключении других типов слабоумия, используя методы нейровизуализации и анализ крови. Используя эти критерии, достигают надежной диагностики, хотя при исследовании аутопсии мозга оказывается, что у 10-20% пациентов с диагнозом БА имеется другое заболевание. Кроме того, современные методы диагностики могут быть выполнены только в том случае, если нейродегенеративный процесс проявляется настолько, что тяжелая форма слабоумия и повреждения мозга пациента тяжелы до такой степени, что число терапевтических измерений ограничено. Четкий диагноз требует патологической оценки ткани мозга после смерти.

Учитывая, что Aβ накапливается в мозге больных БА и является главным элементом патогенеза при БА, этот белок рассматривают в качестве наиболее четкого биомаркера БА. Однако применение Aβ в качестве биомаркера плазмы для диагностики БА осложнено тем, что концентрации пептидов Aβ (Aβ(1-40) и Aβ(1-42)) в сыворотке чрезвычайно малы, поэтому отсутствуют методы, которые были бы достаточно чувствительными для надежного выявления пептидов указанного типа.

Применяют различные исследования для определения уровней бета-амилоидных пептидов в биологических образцах (см., например, методы, описанные Scheuner и др., Nature Med., 2, 1996, cc.864-870; Tamaoka А и др., J Neurol Sci., 141, 1996, cc.65-68; Suzuki N. и др., Science, 264, 1994, cc.1336-1340; WO200722015; Vanderstichele H. и др., Amyloid, 7, 2000, cc.245-258; Fukomoto H. и др., Arch. Neurol. 60, 2003, cc.958-964; Mehta и др., Arch. Neurol. 57, 2000, cc.100-105; Mayeux R. и др., Ann Neurol. 46, 1999, cc.412-416; Lanz T.A., Schacthter J.B., J. Neuroscience Methods, 157, 2006, cc.71-81; WO 200750359, WO 0162801, WO 0315617, WO 0246237, WO 0413172). Однако все известные современные методы, основанные на ELISA, имеют низкий предел обнаружения, который в большинстве случаев находится вне диапазона и содержат самое большее отдельные пг/мл, что достаточно для обнаружения Aβ40 и Aβ42 в СМЖ, а также для обнаружения указанных соединений в плазме пациентов с семейной формой БА, но непригодны для обнаружения Aβ42 в плазме пациентов, больных спорадической БА, при которой концентрация Aβ42 в плазме намного меньше.

В настоящее время единственными методами анализа пептидов Aβ, которые имеют предел обнаружения ниже отдельных пг/мл, являются методы, описанные в WO 200646644 и WO 2009015696.

В WO 200646644 описывают электрохемилюминесцентный (ЭХЛ) метод сэндвич, в котором моноклональное антитело (mAb) 21F12 (которое распознает аминокислоты 33-42 в Aβ42) соединено с магнитными гранулами, которые затем используют для захвата пептида Aβ42 в образце, содержащем Aβ42, и дополнительно контактирует с моноклональным антителом mAb 3D6, объединенным в рутениевый комплекс. Затем определяют количество связанного антитела 3D6 с помощью люминесценции, испускаемой рутениевым комплексом, под действием применяемой электрической энергии. С помощью этого метода можно выявить всего лишь 0,5 пг/мл стандарта пептида Aβ42. Однако при использовании того же метода для сравнения содержания Aβ42 в образцах плазмы пациентов с БА и здоровых контрольных субъектов нельзя обнаружить существенных различий между двумя группами субъектов, из чего следует вывод, что количество интактного пептида Aβ42 в сыворотке очень низкое из-за разрушения и следует перейти к конкурентному методу ELISA, используя моноклональное антитело 21F12, которое обеспечивает пониженные уровни чувствительности в диапазоне нг/мл.

В WO 2009015696 описывают высокочувствительный метод сэндвич ELISA, согласно которому выявляемое антитело контактирует с меченым биотином реагентом, проявляющим специфичность в отношении указанного антитела. Реагент контактирует со стрептавидином, соединенным с пероксидазой. Действие пероксидазы затем выявляют колориметрически, используя ТМБ, или флуоресцентно, используя краситель QuantaBlue.

В WO 2006053251 описывают способ определения пептидов типа бета-амилоидных в образце, включающий контакт образца с денатурирующим агентом, экстракцию пула пептидов из смеси образца с денатурирующим агентом, разделение бета-амилоидных пептидов из пула пептидов и определение количества разных типов бета-амилоидных пептидов. Для этого способа необходима стадия разделения пептидов до определения, что требует большего времени и приводит к удорожанию способа.

Способы диагностики БА, известные в предшествующем уровне техники, основаны на определении уровней биомаркеров, присутствующих в мозге или СМЖ пациентов. Описаны различные биомаркеры, определение которых проводят в СМЖ. СМЖ непосредственно отражает состав внеклеточного пространства центральной нервной системы и таким образом предоставляет повышенные концентрации соединений, рассматриваемых в качестве биомаркеров. Однако СМЖ может быть получена только с помощью пункции в поясничном отделе - метода, не являющегося рутинным диагностическим методом, легко переносимым пациентами со слабоумием, не говоря о пациентах с расстройствами памяти. Таким образом, существует потребность в биомаркерах БА, которые можно обнаружить в образцах, полученных неинвазивно.

Соответствующие описанные в предшествующем уровне техники биомаркеры БА, которые могут быть определены в плазме, включают (i) маркеры - производные амилоидных бляшек, (ii) аутоантитела против Aβ или βAPP, (iii) маркеры воспаления, например, IL-6, его рецептор или gp130, C-реактивный белок или белок оксидативного стресса (изопростаны), (iv) маркеры липидного метаболизма (ароЕ, оксистеролы) и (v) маркеры сосудистого заболевания (гомоцистеин, липопротеин b C1q) (Scheuner D. и др., Nature Med 2, 1996, cc.864-870).

Однако исходя из того обстоятельства, что Аβ накапливается в мозге пациентов с БА и является центральным элементом в патогенезе БА, этот белок рассматривают в качестве наиболее приемлемого кандидата в биомаркеры БА. Однако применение Аβ в качестве биомаркера плазмы для диагностики БА сталкивается с осложнением, заключающимся в том, что концентрации пептидов Аβ (Aβ(1-40) и Aβ(1-42)) в сыворотке чрезвычайно низкие, причем настолько, что нет методов, которые были бы настолько чувствительными, чтобы обеспечить надежное выявление указанных типов пептидов.

Кроме того, было описано несколько антител для выявления пептидов Aβ и применимых для иммунологических исследованиях. Например, моноклональное анти-Aβ(1-17) антитело (6Е10) является антителом, направленным на N-концевую область пептида Aβ, выработанного против пептида Aβ(1-17) (Kim K.S. и др. Neurosci. Res. Comm. 7; 1988) и распознающим пептиды Aβ, которые включают указанную область, или моноклональное антитело, выработанное против пептида Aβ(1-28) (фирма Pierce).

Однако в данной области существует потребность в улучшенных иммунологических методах и наборах для выявления пептидов, производных от Aβ, которые преодолевают недостатки способов и наборов, известных в данной области, в частности тех, которые достаточно чувствительны для надежного обнаружения пептидов Aβ в плазме пациентов со спорадической БА. Также существует потребность в идентификации биомаркеров для ранней диагностики БА, чувствительных и специфичных, которые позволяют отличать когнитивное нарушение из-за возраста от когнитивного нарушения, ассоциированного с ранними симптомами процесса, а также отличать изменения, вызванные БА, от других нейродегенеративных состояний. По Growdon и др. (Neurobiol. Aging, 19, 1998, cc.109-116) следует, что идеальный маркер БА должен соответствовать следующим требованиям:

- выявлять фундаментальный признак нейропатологии

- должен быть подтвержден в тех случаях, когда случаи заболевания установлены нейропатологически

- быть чувствительным по меньшей мере на 80% для обнаружения БА

- быть специфичным по меньшей мере на 80%, чтобы отличить БА от других типов слабоумия, и

- быть надежным, давать воспроизводимые результаты, быть неинвазивным, простым для применения и недорогим.

Краткое описание изобретения

Один из объектов настоящего изобретения относится к антителу, которое специфически связывается с пептидом Aβ(1-17).

Другой объект настоящего изобретения относится к набору для обнаружения пептида Aβ(1-17), который включает:

(i) первое антитело, которое представлено в одном из пунктов формулы изобретения 1-3, и

(ii) второе антитело, которое распознает область пептида Aβ(1-17), отличающуюся от области, которую распознает первое антитело.

Третий объект настоящего изобретения относится к способу определения или выявления пептида Aβ(1-17) в образце, который включает стадии:

(i) захвата имеющегося в образце пептида Aβ(1-17) первым антителом, которое специфически связывается с указанным пептидом,

(ii) контакта иммунных комплексов, сформированных на стадии (i), со вторым антителом, причем указанное второе антитело, представленное в одном из пунктов формулы изобретения 1-4, в отличие от первого антитела распознает другую область, отличную от области распознавания первым антителом, и соединено с первым представителем связывающей пары;

(iii) контакта комплексов, сформированных на стадии (ii), со вторым представителем связывающей пары, которая соединена с выявляемой меткой, и

(iv) выявления или обнаружения активности или количества выявляемой метки.

Другой объект настоящего изобретения относится к способу мониторинга нейродегенеративного заболевания у субъекта, включающему:

(а) определение в образце, полученном от указанного субъекта в первой временной точке, уровня свободного пептида Aβ17 в образце плазмы и уровня пептида Aβ17, связанного с клетками в образце крови, полученном из образца от указанного субъекта,

(б) определение в образце, полученном от указанного субъекта во второй временной точке, уровня свободного пептида Aβ17 в образце плазмы и уровня пептида Aβ17, связанного с клетками в образце крови указанного субъекта, и

(в) сравнение соотношения уровня свободного пептида Aβ17 в образце плазмы и уровня пептида Aβ17, связанного с клетками в образце крови, в указанные первую и вторую временную точки,

причем повышенное указанное соотношение во второй временной точке относительно первой временной точки означает ухудшение состояния пациента с болезнью Альцгеймера во время от первой до второй временных точек.

В другом варианте осуществления настоящее изобретение относится к способу определения, имеется ли у субъекта умеренная форма болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови, взятом от образца указанного субъекта,

(б) дополнительных величин суммарных уровней пептидов Aβ17, Aβ40 и Aβ42 в плазме образца от указанного субъекта и уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками, в образце крови указанного субъекта,

(в) дополнительной величины суммарного уровня пептида Aβ42 в образце плазмы субъекта и уровня пептида Aβ42, связанного с клетками в образце крови субъекта,

(г) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в полученном от субъекта образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови субъекта, и

(д) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы указанного субъекта и пептида Aβ17, связанного с клетками в образце крови субъекта,

причем если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце здорового субъекта, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

В другом варианте осуществления настоящее изобретение относится к способу определения, имеется ли у субъекта УКН с продромальной формой болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин суммарного уровня пептида Aβ42 в образце плазмы указанного субъекта, и уровня пептида Aβ42, связанного с клетками, в образце крови указанного субъекта,

(б) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в полученном от субъекта образце и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови указанного субъекта,

(в) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы указанного субъекта и пептида Aβ17, связанного с клетками в образце крови субъекта,

(г) величины соотношения между уровнем пептида Aβ17, связанного с клетками в образце крови субъекта, и уровнем пептида Aβ42, связанного с клетками в образце крови,

(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным уровням суммарного пептида Aβ17 в образце плазмы и уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным уровням суммарного пептида Aβ42 в образце плазмы и уровню пептида Aβ42, связанного с клетками в образце крови,

(е) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине уровней пептида Aβ40, связанного с клетками в образце крови, и пептида Aβ42, связанного с клетками в образце крови, и

(ж) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровням пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

причем если величина одного или нескольких из параметров (а), (б) или (в) повышена и/или величина одного или нескольких из параметров (г), (д), (е) или (ж) снижена относительно величины тех же параметров в контрольном образце здорового субъекта, тогда у субъекта имеется УКН с продромальной формой болезни Альцгеймера.

В другом варианте осуществления настоящее изобретение относится к способу определения, имеется ли у субъекта УКН с продромальной формой болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови от образца указанного субъекта,

(б) величины соотношения между уровнем пептида Aβ17, связанного с клетками в образце крови субъекта, и уровнем пептида Aβ42, связанного с клетками в образце крови указанного субъекта,

(в) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине суммарного пептида Aβ42 в образце плазмы указанного субъекта и уровню пептида Aβ42, связанного с клетками в образце крови,

(г) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

причем если величина (а) повышена и/или величина одного или нескольких из указанных параметров (б), (в), (г) и (д) снижена относительно величины тех же параметров в контрольном образце субъекта с УКН с непродромальной формой болезни Альцгеймера, тогда у субъекта имеется УКН с продромальной формой болезни Альцгеймера.

В другом варианте осуществления настоящее изобретение относится к способу определения, имеется ли у субъекта умеренная форма болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками, в образце крови,

(б) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками, в образце крови,

(в) дополнительных величин суммарного уровня пептида Aβ42 в образце плазмы и уровня пептида Aβ42, связанного с клетками, в образце крови,

(г) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками, в образце крови,

(д) дополнительных величин суммарного уровня пептида Aβ40 в образце плазмы и уровня пептида Aβ40, связанного с клетками, в образце крови,

(е) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови, и

(ж) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы и уровнем пептида Aβ17, связанного с клетками в образце крови,

причем если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце субъекта с УКН с непродромальной формой болезни Альцгеймера, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

В другом варианте осуществления настоящее изобретение относится к способу определения, имеется ли у субъекта умеренная форма болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы и уровнем свободного пептида Aβ40 в образце плазмы, и

(б) соотношения между двумя параметрами, причем первый параметр соответствует уровню свободного пептида Aβ17 в образце плазмы, и второй параметр соответствует дополнительным уровням пептидов Aβ40 и Aβ42 в образце плазмы;

причем если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце субъекта с умеренным когнитивным нарушением, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

Краткое описание фигур

Фиг.1. Результат дот-блот анализа, проведенного с использованием поликлонального анти-Aβ(1-17) антитела и других пептидов Aβ, адсорбированных на мембране. Второе антитела, используемое в анализе, является козьим антителом против антитела кролика, меченое пероксидазой хрена (goat anti-rabbit antibody-HRP). Дот-блот анализ проводят с применением электрохемолюминесценции и метода направленного нейтронного зонда (Shielded Neutron Assay Probe - SNAP) при экспозиции 1 мин и 3 мин.

Фиг.2. Результат масс-спектрометрического анализа образца СМЖ (2А) и образца плазмы (2Б); пик Aβ17 отмечен стрелкой.

Фиг.3. Средние показатели некоторых маркеров в разных группах пациентов. СП: свободный пептид Aβ в плазме; ОП: общее содержание пептида Aβ в плазме; СК: пептид Aβ, связанный с клетками; ПК: пул в крови (общее содержание пептида Aβ в плазме + пептид Aβ, связанный с клетками).

(А) Концентрация в пг/мл маркеров Aβ, полученная методом сэндвич ELISA для разных групп: ЗС>65 (здоровые субъекты старше 65 лет), возможно с УКН (субъекты с умеренным когнитивным нарушением с возможной или непродромальной формой БА), возможно с УКН (субъекты с умеренным когнитивным нарушением с возможной или продромальной формой БА) и умеренная форма БА (субъекты с умеренной формой болезни Альцгеймера).

(Б) и (В): диаграммы представляют поглощение, полученное методом ELISA, по нескольким маркерам в разных группах.

Фиг.4. Средние показатели некоторых маркеров в разных группах пациентов. СП: свободный пептид Aβ в плазме; ОП: общее содержание пептида Aβ в плазме; СК: пептид Aβ, связанный с клетками; ПК: пул в крови (общее содержание пептида Aβ в плазме + пептид Aβ, связанный с клетками).

(А) Соотношения концентраций (в пг/мл) маркеров Aβ, полученных методом сэндвич ELISA для разных групп: ЗС>65 (здоровые субъекты старше 65 лет), возможно с УКН (субъекты с умеренным когнитивным нарушением или с непродромальной формой БА), возможно с УКН (субъекты с умеренным когнитивным нарушением или с продромальной формой БА) и умеренная форма БА (субъекты с умеренной формой болезни Альцгеймера).

(Б) диаграммы представляют поглощение, полученное методом ELISA, по нескольким маркерам в разных группах.

Фиг.5. Средние показатели некоторых маркеров в разных группах пациентов. СП: свободный пептид Aβ в плазме; ОП: общее содержание пептида Aβ в плазме; СК: пептид Aβ, связанный с клетками; ПК: пул в крови (общее содержание пептида Aβ в плазме + пептид Aβ, связанный с клетками).

(А) Соотношения концентраций (в пг/мл) маркеров Aβ, полученных методом сэндвич ELISA для разных групп: ЗС>65 (здоровые субъекты старше 65 лет), возможно с УКН (субъекты с умеренным когнитивным нарушением или с непродромальной формой БА), предположительно с УКН (субъекты с умеренным когнитивным нарушением или с продромальной формой БА) и умеренная форма БА (субъекты с умеренной формой болезни Альцгеймера).

(Б) диаграммы представляют поглощение, полученное методом ELISA, по нескольким маркерам в разных группах.

Фиг.6. Соотношения между свободным пептидом Aβ17 в плазме (СП) и пептидом Aβ17, связанным с клетками (СК), для различия между группами субъектов.

(А) Концентрация в пг/мл маркеров Aβ, полученная методом сэндвич ELISA, для разных групп субъектов: ЗС>65 (здоровые субъекты старше 65 лет), возможно с УКН (субъекты с умеренным когнитивным нарушением или с непродромальной формой БА), предположительно с УКН (субъекты с умеренным когнитивным нарушением или с продромальной формой БА) и умеренная форма БА (субъекты с умеренной формой болезни Альцгеймера).

(Б) Диаграммы представляют поглощение, полученное методом ELISA, по указанному маркеру в разных группах.

Подробное описание изобретения

В настоящем изобретении получают антитело, высокоспецифичное в отношении пептида Aβ17, которое не распознает другие типы Aβ. Например, фиг.1 показывает антитело, которое специфически распознает Аβ17 без проявления какой-либо существенной перекрестной реакционной способности в отношении других типов Aβ, например, Aβ15, Aβ16, Aβ38, Aβ40 или Aβ42. В настоящем изобретении также описывают набор для обнаружения пептида Aβ17, позволяющий надежно подсчитать указанные типы молекул в каком-либо образце у какого-либо субъекта, в частности, в плазме субъектов, у которых предположительно БА. В настоящем изобретении также было показано, что можно различать разные группы субъектов: здоровых, с продромальной БА, с непродромальным умеренным когнитивным нарушением и умеренной формой БА путем измерения уровней разных параметров.

Антитело по настоящему изобретению

Один из объектов настоящего изобретения относится к антителу по настоящему изобретению, которое специфически связывает пептид Aβ(1-17) (SEQ ID NO:1).

Понятие «специфически связывает» в контексте настоящего изобретения относится к антителу, которое связывается с пептидом Aβ17 без формирования какой-либо дополнительной перекрестной реакционной способности с другими пептидами Aβ. В одном из вариантов осуществления настоящего изобретения специфичность в отношении пептида Aβ17 выше 50%, выше 60%, выше 70%, выше 80% или выше 90%. Более предпочтительно специфичность антитела в отношении пептида Aβ17 выше 95%. На фиг.1 показано, что в настоящем изобретении исследовали специфичность анти-Aβ17 антитела и что это антитело высоко специфично в отношении пептида Aβ17 и не проявляет существенной перекрестной реакционной способности в отношении других пептидов Aβ, выбранных из группы, включающей Aβ(1-15), Aβ(1-16), Aβ(1-38), Aβ(1-40), Aβ(1-42) и комбинацию одного или нескольких из них.

Практически нет ограничений относительно типа антитела по настоящему изобретению, поскольку оно содержит по меньшей мере один сайт связывания антигена, специфичный в отношении Aβ17. Таким образом, к соответствующим применимым молекулам антител относятся:

- «интактные антитела», которые включают антигенсвязывающую вариабельную область, а также константный домен легкой цепи (CL) и константные домены тяжелой цепи, СН1, СН2 и СН3,

- фрагменты «Fab», получаемые в результате расщепления папаином интактного антитела и содержащие один сайт связывания антигена и области CL и СН1,

- фрагменты «F(ab′)2», получаемые в результате расщепления папаином интактного антитела и содержащие два сайта связывания антигена,

- фрагменты «Fab», содержащие константный домен легкой цепи и первый константный домен (СН1) тяжелой цепи, а также только один сайт связывания антигена. Фрагменты Fab′ отличаются от фрагментов Fab дополнительно несколькими остатками с карбокси-конца домена тяжелой цепи СН1, включая один или несколько цистеинов из шарнирной области антитела.

- фрагмент «Fv» - минимальный фрагмент антитела, который полностью содержит антигенраспознающий и антигенсвязывающий сайт. Эта область состоит из димера одной тяжелой цепи и одного вариабельного домена легкой цепи в плотной нековалентной ассоциации. Он имеет такую конфигурацию, что три гипервариабельные области (CDR) каждого вариабельного домена взаимодействуют для определения антигенсвязывающего сайта на поверхности димера VH-VL. Совместно шесть гипервариабельных областей обусловливают специфичность связывания антигена с антителом. Однако даже один вариабельный домен (или половина Fv, включающая только три гипервариабельные области, специфичные в отношении антигена) обладает способностью распознавать и связывать антиген, хотя и с меньшим сродством по сравнению с целым сайтом связывания.

- одноцепочечный фрагмент FV («single-chain FV - scFv») включает VL и VH, домены антитела, причем эти домены содержатся в одноцепочечном полипептиде. Предпочтительно области VL и VH соединены полипептидным линкером, который позволяет фрагменту scFv формировать требуемую структуру для связывания антигена.

- «диантитела» включают вариабельный домен тяжелой цепи (VH), соединенный с вариабельным доменом легкой цепи (VL) на одной и той же полипептидной цепи (VH-VL), соединенные пептидным линкером, который слишком короткий, чтобы происходило спаривание двух доменов на одной цепи. Это заставляет спариваться с комплементарными доменами другой цепи и способствует сборке димерной молекулы с двумя функциональными сайтами связывания антигена.

- биспецифичные антитела (bispecific antibody - BAb) являются одиночными двухвалентными антителами (или их иммунотерапевтически эффективными фрагментами), которые имеют два сайта связывания антигена с разной специфичностью. Два антигенных сайта могут быть соединены вместе химически или методами генной инженерии, известными в данной области.

Все эти фрагменты антител могут быть дополнительно модифицированы с помощью обычных методов, известных в данной области, например, используя аминокислотную делецию (делеции), инсерцию (инсерции), дополнение (дополнения) и/или рекомбинацию (и/или какую-либо другую модификацию (модификации) (например, посттрансляционные и химические модификации, например, гликозилирование и фосфорилирование, известные в данной области), отдельно или в комбинации. Методы интродукции таких модификаций в последовательность ДНК, которая представляет основу аминокислотной последовательности цепи иммуноглобулина, известны специалистам в данной области; см., например, Sambrook и др. в кн.: «Molecular Cloning: A Laboratory Manual», 1989, 2е изд., издательство Cold Spring Harbor Laboratory Press; и Sambrook и др. в кн.: «Molecular Cloning: A Laboratory Manual», 2001, 3е изд., изд-во Cold Spring Harbor Laboratory Press.

К антителам, применимым в настоящем изобретении, относятся и поликлональные, и моноклональные антитела. Для получения поликлональных антител различные животные-хозяева, включая коз, кроликов, крыс, мышей, овец, собак, верблюдов, дромадеров, лам, людей, птиц и других животных, могут быть иммунизированы инъекцией пептида, соответствующего фрагменту Aβ17, обладающему иммуногенными свойствами. В зависимости от вида хозяина могут применяться разные адъюванты для усиления иммунологического ответа. К таким адъювантам относятся, но ими перечень не ограничивается, адъювант Фрейнда, минеральные гели, например гидроксид алюминия, и поверхностно-активные вещества, например лизолецитин, полианионы, пептиды, масляные эмульсии, гемоцианин моллюска блюдечка (KLH) и динитрофенол. Среди адъювантов, применяемых людьми, особенно предпочтительны BCG (Bacille Calmette-Guerin) и Corynebacterium parvum. В предпочтительном варианте осуществления настоящего изобретения адъювантами, применяемыми для получения антитела по настоящему изобретению, являются полный адъювант Фрейнда, неполный адъювант Фрейнда и Imject Alum.

Может быть полезным конъюгирование антигена с белком, который является иммуногенным для видов, подвергающихся иммунизации. К белкам, которые можно конъюгировать с пептидом, относятся, но ими перечень не ограничивается, гемоцианин моллюска блюдечка (KLH), голубой носитель (гемоцианин, выделенный из моллюска Concholepas concholepas), бычий тироглобулин или ингибитор соевого трипсина, с использованием бифункционального или дериватизирующего агента, например, сложного эфира малеимидобензоилсульфосукцинимида (сопряжение через остатки цистеина), N-гидроксисукцинимида (через остатки лизина), глутарового альдегида, янтарного ангидрида или SOCl2. В предпочтительном варианте осуществления настоящего изобретения белком, используемым для конъюгации, является KLH. В предпочтительном варианте осуществления настоящего изобретения конъюгацию между пептидом и KLH проводят за счет перекрестного линкера NHS-PEG4-малеимид и пептидов, содержащих цистеин с N-конца, для осуществления конъюгации пептида с KLH.

Для получения моноклональных антител могут применяться обычные методы. Например, моноклональные антитела могут быть получены методом с применением гибридом, описанным Kohler и др., Nature, 256, 1975, с.495, используя процедуру, детально описанную в единицах от 11,4 до 11,11 of Ausubel, F.M. и др. (в кн.: Current Protocols in Molecular Biology, John Wiley & Sons Inc; ring-bound edition, 2003). В другом варианте моноклональные антитела могут быть выделены методами рекомбинации ДНК из фаговых библиотек антител, которые получают методами, описанными McCafferty и др., Nature, 348, 1990, cc.552-554. Clacksoii и др., Nature, 352, 1991, cc.624-628, и Marks и др., J. Mol. Biol., 222, 1991, cc.581-597, описывают выделение антител мыши и человека, соответственно, используя библиотеку фагов. Последующие публикации описывают получение антител человека с высокой степенью сродства (в диапазоне нМ) путем перетасовки цепи (Marks и др., Bio/Technology, 10, 1992, cc.779-783), а также комбинаторной инфекции и рекомбинации in vivo в качестве стратегии для конструирования очень крупных библиотек фагов (Waterhouse и др., Nucl. Acids. Res., 21, 1993, cc.2265-2266). Таким образом, эти методы представляют жизнеспособные замещающие варианты традиционным методам гибридом миноклональных антител для выделения моноклональных антител.

Поликлональные антитела могут применяться непосредственно в качестве антисыворотки, полученной в организмах иммунизированных хозяев после забора крови и удаления сгустка фибрина. Моноклональные антитела могут применяться непосредственно в качестве супернатанта культуры гибридом или в качестве асцитной жидкости после имплантации гибридом в брюшную полость соответствующего хозяина. В другом варианте молекулы иммуноглобулина, поликлональные или моноклональные, могут быть очищены до их применения обычными средствами, например, аффинной очисткой, используя пептиды, полученные от Aβ17, очисткой с помощью неденатурирующего геля, ВЭЖХ или ОФ-ВЭЖХ, эксклюзионной хроматографии, очистки на колонке с белком А или какой-либо комбинации этих методов.

В предпочтительном варианте осуществления настоящего изобретения антитело по настоящему изобретению является поликлональным антителом. В предпочтительном варианте осуществления настоящего изобретения способ получения антитела по настоящему изобретению включает следующие стадии:

- 1я доза: иммунизация кролика с помощью 100 мкг пептида, используя в качестве адъюванта полный адъювант Фрейнда.

- 2я доза: иммунизация кролика с помощью 100 мкг пептида, используя в качестве адъюванта неполный адъювант Фрейнда.

- 3я доза: иммунизация кролика с помощью 100 мкг пептида, используя в качестве адъюванта квасцы.

- 3 дополнительные дозы с помощью 200 мкг пептида с попеременной сменой адъювантов: неполный адъювант Фрейнда - квасцы - полный адъювант Фрейнда

В предпочтительном варианте осуществления настоящего изобретения область пептида Aβ или иммуногена, применяемого для получения антитела по настоящему изобретению, выбрана из группы, состоящей из пептида Aβ(12-17), соответствующего последовательности VHHQKL (SEQ ID NO:2), и пептида Aβ(11-17), соответствующего последовательности EVHHQKL (SEQ ID NO:3).

Набор по настоящему изобретению

Второй объект настоящего изобретения относится к набору для выявления или для определения пептида Aβ(1-17), который в настоящем изобретении называется набором по настоящему изобретению, включающему:

(i) первое антитело, которое является антителом, специфичным в отношении Aβ(1-17), по настоящему изобретению, и

(ii) второе антитело, которое распознает область в пептиде Aβ(1-17), отличную от области, распознаваемой первым антителом.

Понятие «амилоидный бета-пептид» в контексте настоящего изобретения, взаимозаменяемый с обозначениями «Aβ», «амилоидный бета-пептид», «А бета», «бета АР» или «пептид А бета», относится к семейству пептидов, которые составляют основное химическое составляющее сенильных бляшек и отложений амилоидов в сосудах (амилоидная ангиопатия), обнаруженных в мозге пациентов с болезнью Альгеймера (БА), синдромом Дауна и наследственной церебральной геморрагией с амилоидозом голландского типа (hereditary cerebral hemorrhage with amyloidosis of the Dutch type - HCHWA-D). В любой форме амилоидный бета-пептид является фрагментом бета-амилоидного белка-предшественника (beta-amyloid precursor protein - АРР), который включает варьирующее число аминокислот, что получается за счет последовательного протеолитического расщепления амилоидного белка-предшественника под действием β- и γ-секретаз или β- и α-секретаз.

Амилоидные бета-пептиды обычно обозначают «Aβ(x-y)», причем x обозначает номер аминокислоты с амино-конца амилоидных бета-пептидов, а y обозначает номер аминокислоты с карбокси-конца. В контексте настоящего изобретения обозначения «Aβ(1-17)» или «Aβ17» относятся к пептиду длиной 17 аминокислот, соответствующих аминокислотам с 672 по 688 последовательности SEQ ID NO:1 амилоидного белка-предшественника, причем указанный пептид получается последовательным протеолитическим расщеплением амилоидного белка-предшественника (SEQ ID NO:4) β- и α-секретазами.

В контексте настоящего изобретения понятие «иммобилизованное антитело» означает антитело, которое применяют для обнаружения в образце всех типов молекул, с которыми специфически связывается антитело. Практически нет ограничений касательно типа антитела, которое можно использовать в качестве иммобилизованного антитела до тех пор, пока оно содержит по меньшей мере один сайт связывания антигена, специфичный в отношении Aβ17. В принципе какое-либо антитело, специфичное в отношении пептида Aβ17, может применяться в качестве иммобилизованного антитела. Иммобилизованное антитело связывается с областью, отличающейся от области захвата вторым антителом. В предпочтительном варианте осуществления настоящего изобретения иммобилизованное антитело направлено против эпитопа N-концевой области пептида Aβ17. В другом более предпочтительном варианте осуществления настоящего изобретения к эпитопам, на которые может нацеливаться иммобилизованное антитело, относятся эпитопы, расположенные между аминокислотами 1-10 в Aβ17. В еще одном более предпочтительном варианте осуществления настоящего изобретения иммобилизованное антитело является моноклональным антителом. В другом предпочтительном варианте осуществления настоящего изобретения иммобилизованное антитело распознает область, соответствующую аминокислотам 1-16 в пептиде Aβ. В другом более предпочтительном варианте осуществления настоящего изобретения моноклональным антителом, применяемым в качестве иммобилизованного антитела, является mAb 6E10, что было описано Kim K.S. (Neuroscience Res. Comm. 2, 1988, 121-130).

Второй компонент набора по настоящему изобретению соответствует описанному антителу по настоящему изобретению. В контексте настоящего изобретения «антителом для обнаружения» является антитело, которое может быть применено для обнаружения количества антигена, которое удерживается иммобилизованным антителом. Первое антитело распознает область, отличную от области распознавания первым антителом, поскольку оно должно связываться с областью антигена, которая не покрывается иммобилизованным антителом.

Первое и второе антитела могут применяться в наборе по настоящему изобретению без четкого деления на иммобилизующее антитело и антитело для обнаружения.

Одно из двух антител (первого и второго) могут быть соединены с первым представителем связывающей пары для того, чтобы допустить выявление антитела, связывающегося с антигеном, иммобилизованным иммобилизующим антителом. Антитело, которое может быть спарено, может действовать в качестве антитела для обнаружения и может быть или первым, или вторым антителом.

В одном из вариантов осуществления настоящего изобретения набор дополнительно включает антитело или комбинацию антител, которые специфически связываются с Aβ40 и/или Aβ42. Таким образом, в одном из вариантов осуществления настоящего изобретения набор может применяться для обнаружения пептида Aβ17 и пептида/пептидов Aβ40 и/или Aβ42.

В контексте настоящего изобретения обозначение «Aβ42» относится к пептиду из 42 аминокислот, соответствующих аминокислотам с 672 по 713 (SEQ ID NO:5), который образуется последовательным протеолитическим расщеплением амилоидного белка-предшественника (SEQ ID NO:4) под действием β- и γ-секретаз.

В контексте настоящего изобретения обозначение «Aβ40» относится к пептиду из 40 аминокислот, соответствующих аминокислотам с 672 по 711 (SEQ ID NO:6), который образуется последовательным протеолитическим расщеплением амилоидного белка-предшественника (SEQ ID NO:4) под действием β- и γ-секретаз.

В предпочтительном варианте осуществления настоящего изобретения первое и второе антитело в зависимости от обстоятельств соединено с первым представителем связывающей пары. Если дело обстоит именно так, то второй представитель связывающей пары, соединенный с выявляемой меткой, также включен в набор. В одном из вариантов осуществления настоящего изобретения если выявляемая метка, соединенная со вторым представителем связывающей пары, является ферментной меткой, тогда набор дополнительно включает субстрат, который может быть преобразован указанным ферментом в выявляемый продукт.

Соответствующие первый и второй представители связывающей пары включают без ограничения:

гаптен или антиген/антитело, например, дигоксин и антитела к дигоксину,

биотин или аналоги биотина (например, аминобиотин, иминобиотин или детиобиотин)/авидин или стрептавидин,

сахар/лектин,

фермент и кофактор,

фолиевую кислоту/фолат,

двухцепочечные олигонуклеотиды, избирательно связывающиеся с белками/факторами транскрипции,

нуклеиновую кислоту или аналогичную/комплементарную нуклеиновую кислоту, и

рецептор/лиганд, например, рецептор стероидного гормона/стероидный гормон.

Следует иметь ввиду, что понятия «первый» и «второй» применительно к представителям связывающей пары в контексте настоящего изобретения относительны и что каждый из указанных выше представителей может рассматриваться в качестве первого или второго представителя связывающей пары. В предпочтительном варианте осуществления настоящего изобретения первым представителем связывающей пары является биотин или его функционально эквивалентный вариант, а второй представитель связывающей пары является авидином, стрептавидином или их функциональным вариантом. В предпочтительном варианте осуществления настоящего изобретения вторым представителем связывающей пары является стрептавидин.

Соответствующими выявляющими метками являются, но ими перечень не ограничивается, флуоресцентные компоненты (например, флуоресцеин, родамин, фикоэритрин, кумарин, оксазин, резофурин, цианин их производные), люминесцентные компоненты (например, продукт наночастицы Qdot™ фирмы Quantum Dot Corporation, Palo Alto, Калифорния). Если выявляемой меткой является фермент, тогда этот фермент должен вырабатывать фиксируемый сигнал, например, при добавлении активатора, субстрата, амплифицируемого агент и др. К ферментам, применимым в качестве выявляемых меток для настоящего изобретения и их соответствующим субстратам относятся:

- Щелочная фосфатаза:

Хромогенные субстраты: субстраты, основанные на p-нитрофенилфосфате (p-NPP), 5-бром-4-хлор-3-индолилфосфате/нитросиний тетразолий (BCIP/NBT), быстрый красный/нафтол-AS-TS фосфат

Флуорогенные субстраты: 4-метилумбеллиферил фосфат (4-MUP), 2-(5′-хлор-2′-фосфорилоксифенил)-6-хлор-4-(3Н)-хиназолинон (CPPCQ), 3,6-флуоресцеин дифосфат (3,6-FDP), быстрый синий ВВ, быстрый красный TR, или диазониевые соли быстрый красный фиолетовый LB (Fast Red Violet LB)

- Пероксидазы:

Хромогенные субстраты, основанные на 2,2-азинобис(3-этилбензотиазолин-6-сульфоновой кислоте) (ABTS), о-фенилендиамине (ОРТ), 3,3′,5,5′-тетраметилбензидине (ТМВ), о-дианизидине, 5-аминосалициловой кислоте, 3-диметиламинобензойной кислоте (DMAB) и 3-метил-2-бензотиазолингидразоне (МВТН), 3-амино-9-этилкарбазоле (АЕС) и 3,3′-диаминобензидинтетрагидрохлориде (DAB).

Флуорогенные субстраты: 4-гидрокси-3-метоксифенилуксусная кислота, восстановленные феноксазины и восстановленные бензотиазины, включая продукт Amplex® Red reagent, краситель Amplex UltraRed и восстановленные дигидроксантены.

- Гликозидазы:

Хромогенные субстраты: о-нитрофенил-β-D-галактозид (o-NPG), p-нитрофенил-β-D-галактозид и 4-метилумбеллиферил-β-D-галактозид (MUG) для β-D-галактозидазы.

Флуорогенные субстраты: резофурин β-D-галактопиранозид, флуоресцеин дигалактозид (FDG), флуоресцеин диглюкуронид, 4-метилумбеллиферил β-D-галактопиранозид, карбоксиумбеллиферил β-D-галактопиранозид и фторированные кумарин β-D-галактопиранозиды.

- Оксидоредуктазы (люцифераза):

Субстраты для люминесценции: люциферин.

В одном из вариантов осуществления настоящего изобретения выявляемой меткой является флуоресцирующая молекула, люминесцентная молекула или фермент. В предпочтительном варианте осуществления настоящего изобретения выявляемой меткой является пероксидаза хрена, а выявляющим реагентом - ТМВ.

В предпочтительном варианте осуществления настоящего изобретения набор дополнительно включает плотную основу. Понятие «основа» в контексте настоящего изобретения относится к твердой фазе, которая представляет пористый или непористый нерастворимый в воде материал, который может иметь какую-либо из перечисленных форм - полосок, палочек, частиц, в том числе латексных частиц, магнитных частиц, микрочастиц, гранул, мембран, лунок для микротитрования и пластиковых пробирок. В принципе, применим какой-либо материал, который представляет плотную основу, способную связывать достаточные количества иммобилизованного антитела. Таким образом, выбор материала для плотной основы основывают, исходя из требуемого формата исследования. К материалам, пригодным в качестве плотной основы, относятся полимерные материалы, особенно целлюлозные материалы и материалы, производные от целлюлозы, например, с волокнами бумаги, например, фильтровальной бумаги, хроматографической бумаги, бумаги со стеклянным волокном и др.; синтетические или модифицированные природные полимеры, например, нитроцеллюлоза, ацетат целлюлозы, поли(винилхлорид), полиакриламид, декстран с поперечными сшивками, агароза, полиакрилат, полиэтилен, полипропилен, поли(4-метилбутен), полистирен, полиметакрилат, поли(этилентерефталат), нейлон, поливинилбутират) и др.; материалы используют сами по себе, или в соединении с другими материалами; стекло, например, стекло, называемое биокерамикой, керамика, металлы и др. Предпочтительными являются полимеры стирена и карбоксилированного стирена или стирена, функционально несущего другие активные группы, например, амино-, карбокси-, гало-группы и другие, без поперечных сшивок. В некоторых случаях могут применяться сополимеры замещенных стирен с диенами, например, бутадиен.

В одном из вариантов осуществления настоящего изобретения антитело, не соединенное с первым представителем связывающей пары, предварительно связывают с плотной основой; им может быть первое или второе антитело. Плотная основа и первое или второе антитело могут быть раздельно представлены в наборе или, в другом варианте, основа может быть представлена уже с нанесенным антителом. В этом случае основа может быть обработана блокирующим раствором после связывания антитела. Если на основу предварительно нанесено покрытие, предпочтительно, если основа обработана концентрированным раствором трегалозы и высушена, в этом случае формы с сухой трегалозой формируют на основе ореол. Эти основы, содержащие сухую трегалозу, чрезвычайно стабильны и могут сохраняться до двух лет при 4°С в темноте.

К дополнительным компонентам набора могут относиться:

- Средства для получения образца от исследуемого пациента.

- Буферы и растворы, необходимые для получения стандартных кривых целевых пептидов.

- Буферы и растворы для промывки и блокирования плотной основы на время проведения анализа.

- Буферы и растворы для нанесения покрытия из антитела на плотную основу.

- Реагенты для формирования окрашенного или флуорогенного сигнала от выявляемой метки.

- Реагенты для прекращения формирования окрашенного или флуорогенного продукта от выявляемой метки (например, 1н H2SO4).

- Средства для поддержания пептидов в развернутом состоянии (например, концентрированный гуанидиний гидрохлорид).

- Образец, содержащий исходный раствор пептида Aβ17, а также пептида Aβ40 и/или Aβ42, или их комбинацию.

Иммобилизация антитела на плотной основе может производиться перед связыванием искомого целевого пептида или когда пептид/белок связан с антителом. В любом случае при использовании плотной основы удобно блокировать избыток сайтов связывания белка на носителе до добавления образца, искомый содержащего целевой пептид. Предпочтительно, блокирование или гашение сайтов связывания пептидов на основе проводят, используя тот же буфер, который применяют для промывки комплексов после каждой реакции связывания (например, буфер 50 мм Tris-HCl, pH 8, ФСБ или TBS, необязательно включающий Tween 20), обогащенный макромолекулярным соединением (например, бычьим сывороточным альбумином, обезжиренным молоком, блокирующим раствором western, казеином, лактоальбумином, овальбумином) в концентрациях примерно 0,05-10%, предпочтительно 1-5%, более предпочтительно примерно 3%. Если основа, включающая иммобилизованное антитело, должна храниться в течение некоторого времени, предпочтительно, если основа обработана концентрированным раствором трегалозы и высушена, в этом случае формы с сухой трегалозой формируют на основе ореол. Эти основы, содержащие сухую трегалозу, чрезвычайно стабильны и могут сохраняться до двух лет при 4°С в темноте.

Набор по настоящему изобретению позволяет выявить или определить с высокой степенью чувствительности и специфичности пептид или пептиды, которые специфически распознаются первым и вторым компонентами-антителами набора. Таким образом, другой объект настоящего изобретения относится к применению набора по настоящему изобретению для выявления в образце пептида Aβ17. В одном из вариантов осуществления настоящего изобретения набор применяют для обнаружения по выбору пептидов Aβ40 и/или Aβ42 или их комбинации в образце.

Поскольку набор по настоящему изобретению обеспечивает высокую степень чувствительности и специфичности при определении концентрации пептида Aβ17 в каком-либо образец, он может быть использован для диагностики какого-либо заболевания, при котором изменена концентрация какого-либо из указанных пептидов в какой-либо жидкости или ткани, в частности, дегенеративных заболеваний и, более конкретно, нейродегенеративных заболеваний. К примерам дегенеративных заболеваний, которыми перечень не ограничивается, и которые могут быть диагностированы на основе появления изменений в уровнях Aβ17, или Aβ40, или Aβ42, относятся:

- костные дегенеративные расстройства, например, остеопения, остеомаляция, остеопороз, остеомиелома, остеодистрофия, болезнь Педжета, несовершенный остеогенез, остеосклероз, апластическое костное расстройство, гуморальная гиперкальцемическая миелома, множественная миелома и истончение костей после метастазирования.

- дегенеративные расстройства хрящей, например, синдром Горхэма-Стоута, артриты, остеоартрит, ревматоидный артрит, псориатический артрит, ревматоидный артрит и болезнь хрупких костей.

- дегенеративные заболевания мышц, например, мышечная дистрофия, мышечная атрофия, застойная обструктивная болезнь легких, синдром истощения мышц, саркопения, кахексия.

- дегенеративные заболевания сердца, включающие гибель клеток сердца вследствие ишемии, гибели тканей и органов из-за отторжения трансплантата, потери слуха из-за аутотоксичности.

- дегенеративные расстройства сетчатки, например, пигментная дистрофия сетчатки.

- дегенеративные заболевания нервной системы, например, болезнь Александра, синдром Альперса, болезнь Альцгеймера, боковой амиотрофический склероз, атаксия-телеангиэктазия, губчатая энцефалопатия крупного рогатого скота (ГЭ КРС), болезнь Канаван, синдром Коккейна, кортикобазальная дегенерация, болезнь Крейтцфельда-Якоба, болезнь Хантингтона, ВИЧ-ассоциированная деменция, болезнь Кеннеди, болезнь Краббе, деменции с тельцами Леви, болезнь Мачадо-Джозефа (спиноцеребеллярная атаксия 3 типа), рассеянный склероз, мультисистемная атрофия, нейроборрелиоз, болезнь Паркинсона, болезнь Пелицеуса-Мерцбахера, болезнь Пика, первичный латеральный склероз, прионные заболевания, синдром Рефсума, болезнь Сандхоффа, болезнь Шильдера, шизофрении, болезнь Шпильмейера-Фогта-Шегрена (синоним - болезнь Баттена), атаксия Сенджера-Брауна (расстройство координации движений), спинальная мышечная атрофия, прогрессирующая надъядерная офтальмоплегия Стила-Ричардсона-Олыпевского, Стила-Ричардсона-Олыпевского заболевания, спинная сухотка. В предпочтительном варианте осуществления настоящего изобретения нейродегенеративным заболеванием, которое диагностируют с помощью набора по настоящему изобретению, является болезнь Альцгеймера.

Способ определения или выявления пептида Aβ17

Набор по настоящему изобретению позволяет осуществлять способ определения или выявления в образце пептида Aβ17. Таким образом, другой объект настоящего изобретения относится к способу определения или выявления в образце пептида Aβ17, включающему стадии:

(i) иммобилизации пептида Aβ(1-17), имеющегося в образце, первым антителом, которое специфически связывается с указанным пептидом,

(ii) контакта иммунных комплексов, сформированных на стадии (i), со вторым антителом, причем указанное второе антитело является каким-либо из антител по пунктам 1-4, и указанное второе антитело распознает другую область, отличающуюся от области распознавания первым антителом, и соединено с первым представителем комплекса связывающей пары;

(iii) контакта комплексов, сформированных на стадии (ii), со вторым представителем связывающей пары, который соединен с выявляемой меткой, и

(iv) обнаружения или выявления действия или количества выявляемой метки.

Понятие «образец» в контексте настоящего изобретения означает какую-либо культуру ткани, плазму, сыворотку, слюну, семенную жидкость, спинномозговую жидкость (СМЖ), слезы, слизь, пот, молоко, мозг или экстракты периферийных тканей и др. В предпочтительном варианте осуществления настоящего изобретения образец выбран из группы, включающей кровь, сыворотку, плазму и СМЖ. В более предпочтительном варианте осуществления настоящего изобретения образцом является образец плазмы.

В предпочтительном варианте осуществления настоящего изобретения выявляемые пептиды соответствуют нсолигомерным формам указанного пептида, более предпочтительно, мономерным формам Аβ17.

Реагенты и антитела, применяемые на каждой стадии способа, подробно описаны выше для набора по настоящему изобретению.

На первой стадии способа по настоящему изобретению образец, содержащий пептиды Aβ17, контактирует с первым антителом таким образом, что формируется первый иммунный комплекс. В предпочтительном варианте осуществления настоящего изобретения первое антитело является моноклональным антителом. В более предпочтительном варианте осуществления настоящего изобретения моноклональным антителом является антитело 6Е10.

После проведения первой стадии связывания комплексы могут быть промыты для удаления каких-либо избытков белка/пептида, обнаруженных в исходном образце, которые не связаны с иммобилизованным антителом. К предпочтительным буферам для промывки, которые могут применяться в контексте настоящего изобретения, относятся какие-либо буферы, у которых величина рН близка к физиологическим значениям (например, 50 мМ Tris-HCl) и которые необязательно включают соли (например, 150 мМ NaCl) и необязательно включают низкие концентрации детергента (например 0,05% Tween-20).

На второй стадии комплексы, сформированные между иммобилизованным антителом и пептидом Aβ в образце, затем контактируют со вторым антителом таким образом, что формируют иммунный комплекс «типа сэндвич». Первое антитело и второе антитело связываются с разными областями пептида Aβ17, поэтому между ними нет интерференции.

Первая и вторая стадии настоящего способа могут быть обменены друг на друга, и иммобилизация пептида Аβ17 может быть осуществлена вторым антителом (антителом по настоящему изобретению). Затем комплекс контактирует с первым антителом, которое связывает область, отличную от области связывания второго антитела. Одно из двух антител может быть соединено с первым представителем связывающей пары, который может соответствовать антителу, не применяемому на стадии иммобилизации.

После осуществления второй стадии иммунный комплекс может быть промыт для уничтожения неспецифически связанных антител, используя по существу те же буферы и процедуры, что и описанные ранее.

На третьей стадии способ по настоящему изобретению включает контактирование комплексов, сформированных между иммобилизованным антителом и антигеном, и выявление антитела, соединенного с первым представителем связывающей пары, со вторым представителем связывающей пары, который соединен с выявляемой меткой. В предпочтительном варианте осуществления настоящего изобретения первым представителем связывающей пары является биотин, а второй представитель связывающей пары является авидин, стрептавидин или их функционально эквивалентный вариант.

На четвертой стадии способ по настоящему изобретению включает обнаружение выявляемой метки. Следует учитывать, что выявление и/или количественное определение выявляемой метки зависит от природы метки и методов, известных в данной области. Если интактный субстрат или выявляемая метка содержит люминесцентный компонент или краситель, выявление может наблюдаться визуально на УФ-трансилюминаторе, или используя основанную на УФ камеру детекции с обратной зарядной связью (charge-coupled device - CCD), лазерный гелевый сканер, камеру детекции на основе аргоновой дуги (xenon-arc-based) CCD, камеру Polaroid, комбинированную с УФ-трансиллюминатором, а также разнообразные другие устройства, применимые для выявления люминесценции. Если выявляемая метка является ферментом, четвертая стадия способа по настоящему изобретению включает экспозицию иммунокомплексов, меченых меткой (например, иммобилизованный пептид, антитело для выявления и реагент, меченый выявляемый меткой), активаторами, субстратами или амплифицирующими агентами фермента, применяемого в качестве выявляемой метки. К известным выявляемым меткам, способным вырабатывать выявляемый сигнал, относятся антитела, меченные ферментом. К примерам ферментов, известных для этой цели, относятся пероксидаза хрена, щелочная фосфатаза и гликозидазы, включая β-галактозидазу, β-глюкозидазу и β-глюкуронидазу. В качестве примера реагент, специфически связывающийся с выявляемым антителом, может быть снабжен меткой с пероксидазой хрена. После формировании комплекса «иммобилизованная часть - выявляемое антитело-реагент» выявление может быть произведено, используя какой-либо из широкого диапазона известных субстратов для фермента, используемого в качестве выявляемой метки. В предпочтительном варианте осуществления настоящего изобретения выявляемой меткой является флуоресцентная молекула, люминесцентная молекула или фермент.

В одном из вариантов осуществления настоящего изобретения способ выявления по настоящему изобретению дополнительно включает выявление пептидов Aβ40 и/или Aβ42.

Способ мониторинга прогрессирования нейродегенеративного заболевания Другой объект настоящего изобретения относится к способу мониторинга нейродегенеративного заболевания у субъекта, в дальнейшем «способ мониторинга по настоящему изобретению», включающему определение в образце в первой временной точке уровня свободного пептида Aβ17 в плазме и уровня пептида Aβ17, связанного с клетками в образце указанного субъекта, и сравнение уровней с указанными уровнями во второй временной точке; если соотношение свободного пептида Aβ17 в плазме и пептида Aβ17, связанного с клетками, повышается во второй временной точке относительно первой временной точки, это является показателем ухудшения болезни Альцгеймера у субъекта.

Понятие «нейродегенеративное заболевание» в контексте настоящего изобретения означает состояние или расстройство, при котором нейрональные клетки утрачиваются из-за гибели клеток, обусловленной повсеместным ухудшением когнитивных функций, или вызывается повреждение, дисфункция или осложнения, которые могут быть описаны нейрологически, нейродегенеративно, физиологически, психологически или в виде нарушений в поведении. К соответствующим нейродегенеративным заболеваниям, диагноз которых может быть поставлен способами настоящего изобретения, относятся, но ими перечень не ограничивается, возрастная дегенерация желтого пятна, болезнь Крейтцфельда-Якоба, болезнь Альцгеймера, церебральная ангиопатии с амилоидозом, сосудистая деменция, индуцированная лучевой терапией деменция, повреждение аксонов, острая распространяющаяся корковая депрессия, альфа-синуклеопатия, ишемия головного мозга, болезнь Гантингтона, перманентная фокальная церебральная ишемия, регенерация периферических нервов, модель пост-эпилептического статуса, повреждение спинного мозга, спорадический боковой амиотрофический склероз и трансмиссивная спонгиоформная энцефалопатия.

В предпочтительном варианте осуществления настоящего изобретения нейродегенеративным заболеванием, подвергаемым мониторингу по способу настоящего изобретения, является болезнь Альцгеймера или ее продромальные формы, в том числе умеренное когнитивное нарушение, умеренное когнитивное нарушение с предполагаемой болезнью Альцгеймера или умеренное когнитивное нарушение с возможной болезнью Альцгеймера.

Способ мониторинга по настоящему изобретению применим для оценки прогрессирования болезни Альцгеймера у субъекта. Таким образом, в настоящем изобретении установлено, что повышение соотношения уровня свободного пептида Aβ17 в плазме к уровню пептида Aβ17, связанного с клетками, является показателем ухудшения состояния при болезни Альцгеймера.

В одном из вариантов осуществления настоящего изобретения способ мониторинга по настоящему изобретению включает следующие стадии:

(а) определение концентрации свободного пептида Aβ17 в плазме и уровня пептида Aβ17, связанного с клетками, в образце субъекта в первой временной точке; (СП Aβ17/СК Aβ17),

(б) определение концентрации свободного пептида Aβ17 в плазме и уровня пептида Aβ17, связанного с клетками, в образце того же субъекта во второй временной точке; (СП Aβ17/СК Aβ17);

Временные точки выбирает специалист, учитывая характеристики субъекта.

(в) сравнение соотношения уровня свободного пептида Aβ17 в плазме к уровню пептида Aβ17, связанного с клетками, полученными в первой и во второй временной точке,

(г) если соотношение указанных параметров выше во второй временной точке относительно первой временной точки, следует вывод, что происходит ухудшение состояния субъекта с болезнью Альцгеймера.

Понятие «ухудшение состояния при болезни Альгеймера» в контексте настоящего изобретения означает, что заболевание прогрессирует к более поздней стадии относительно стадии, установленной в первой временной точке. Опытный специалист может распознать и подтвердить прогрессирование заболевания путем исследования также других характерных признаков. Свойствами или признаками, появляющимися на более поздней стадии и являющимися показателями прогрессирования заболевания, являются, но ими перечень не ограничивается, появление амилоидных бляшек, нейрофибриллярных сплетений и более быстрое снижение когнитивных функций. В предпочтительном варианте осуществления настоящего изобретения если соотношение уровня свободного пептида Aβ17 в плазме к уровню пептида Aβ17, связанного с клетками, повысилось во второй временной точке относительно первой временной точки, это является показателем повышенных темпов когнитивных повреждений у субъекта. Таким образом, повышенный уровень свободного пептида Aβ17 в плазме является показателем повышенного когнитивного повреждения.

Какой-либо способ, применимый для определения пептидов, может применяться в настоящем изобретении. Например, концентрацию амилоидного бета-пептида можно определить с помощью одного или нескольких методов из числа следующих: вестерн-блоттинга, иммунопреципитации, связанного с ферментом иммуносорбентного анализа (enzyme-linked immunosorbent assay - ELISA), поверхностного плазменного резонанса, реакции преципитации, иммунодиффузии в геле, радиоиммуноанализа (radioimmunoassay - RIA), сортировки клеток с активированной флуоресценцией (fluorescent activated cell sorting - FACS), двухмерного гель-электрофореза, капиллярного электрофореза, масс-спектроскопии (mass spectroscopy - MS), ионизации лазерной десорбцией с использованием матрицы/ лазерной десорбции/ионизации при содействии матрицы времяпролетной масс-спектрометрии (time-of-flight mass spectrometry - MALDI-TOF-MS), времяпролетной масс-спектрометрия с усиливаемой поверхностью лазерной десорбцией-ионизацией (surface-enhanced laser desorption/ionization-time of flight-mass spectrometry - SELDI-TOF-MS), высокоэффективной жидкостной хроматографии (ВЭЖХ), быстрой жидкостной хроматографии белков (fast protein liquid chromatography - FPLC), многомерной жидкостной хроматографии (liquid chromatography - LC) с последующей тандемной масс-спектрометрией (tandem mass spectrometry - MS/MS), тонкослойной хроматографии, анализа экспрессии белкового чипа и лазерной денситометрии. В одном из вариантов осуществления настоящего изобретения уровень указанных параметров устанавливают методом ELISA. В предпочтительном варианте осуществления настоящего изобретения одним из антител, применяемых в методе ELISA, является антитело по настоящему изобретению, направленное на C-концевую область пептида Aβ17.

Понятие «свободный пептид Aβ17 в плазме» в контексте настоящего изобретения (в дальнейшем обозначаемый «СП Aβ17») относится к уровню амилоидных бета-пептидов, не ассоциированных с каким-либо компонентом биологического образца и легко доступных для связывания со специфическим антителом. Этот пептид может быть определен традиционными иммунологическими методами путем контакта биологического образца со специфическим антителом в отношении указанного пептида. В предпочтительном варианте осуществления настоящего изобретения уровень свободного амилоидного пептида определяют в плазме.

Понятие «уровень пептида Aβ17, связанного с клетками (который в настоящем изобретении обозначается СК Aβ17)» в контексте настоящего изобретения означает бета-амилоидные пептиды, которые нековалентно ассоциированы с поверхностью клеток, имеющихся в биологическом образце, и которые недоступны для связывания с антителами, добавленными в образец, и, следовательно, недоступны для иммунологического выявления. Обычно, если биологическим образцом является кровь, амилоидный бета-пептид ассоциирован с эритроцитами, лейкоцитами, включая нейтрофилы, эозинофилы, базофилы, лимфоциты и моноциты, а также с тромбоцитами. Количество амилоидного бета-пептида, ассоциированного с клетками в данном образце, может быть определено и эта величина может использоваться одна или в комбинации с другими параметрами, связанными с амилоидными бета-пептидами, в способах настоящего изобретения. Для этого сначала требуется выделить клеточную фракцию из биологического образца. Это может быть выполнено, используя какой-либо метод, известный специалистам, например, центрифугирование, осаждение, фильтрацию и др. После выделения клеточной фракции биологического образца клетки контактируют с агентом солюбилизации белка.

Количество бета-амилоидного пептида, ассоциированного с клетками в данном образце, может быть определено, и эта величина может быть применена одна или в комбинации с другими параметрами, связанными с бета-амилоидными пептидами, в способах настоящего изобретения. Для этого сначала требуется выделить клеточную фракцию из биологического образца. Это может быть выполнено, используя какой-либо метод, известный специалистам, например, центрифугирование, осаждение, фильтрацию и др. После выделения клеточной фракции биологического образца клетки контактируют с агентом солюбилизации белка.

В предпочтительном варианте осуществления настоящего изобретения образец от субъекта выбран из группы, включающей кровь, сыворотку, плазму и СМЖ. В более предпочтительном варианте осуществления настоящего изобретения образцом является образец плазмы.

Способы определения, имеется ли у пациента болезнь Альцгеймера или ранние стадии болезни Альцгеймера

В настоящем изобретении установлено, что уровни определенных популяций амилоидных бета-пептидов, определенные или непосредственно, или за счет проведения среди них определенных расчетов, могут применяться для определения, имеется ли у пациента умеренная форма болезни Альцгеймера, или у субъекта продромальная форма болезни Альцгеймера, для того, чтобы различить субъекта с непродромальным умеренным когнитивным нарушением от субъекта с продромальной формой болезни Альцгеймера, для того, чтобы различить субъекта с непродромальным умеренным когнитивным ухудшением от субъекта с умеренной формой болезни Альцгеймера, или чтобы различить субъекта с продромальной формой болезни Альцгеймера от субъекта с умеренной формой болезни Альцгеймера.

Таким образом, другой объект настоящего изобретения относится к способу определения, имеется ли у субъекта умеренная форма болезни Альцгеймера, включающему определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови, взятом от образца указанного субъекта,

(б) дополнительных величин уровней суммарных пептидов Аβ17, Aβ40 и Aβ42 в плазме образца от указанного субъекта и уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками, в образце крови указанного субъекта,

(в) дополнительной величины суммарного уровня пептида Aβ42 в образце плазмы субъекта и уровня пептида Aβ42, связанного с клетками в образце крови субъекта,

(г) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в полученном от субъекта образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови субъекта, и

(д) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы указанного субъекта и пептида Aβ17, связанного с клетками в образце крови субъекта,

причем если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце здорового субъекта, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

Таким образом, параметры, измеряемые для того, чтобы отличить здорового субъекта от субъекта с умеренной формой болезни Альцгеймера, следующие:

(а) СК Aβ17 + СК Aβ40 + СК Aβ42

(б) (СК Aβ17 + СК Aβ40 + СК Aβ42) + (ОП Aβ17 + ОП Aβ40 + ОП Aβ42)

(в) ОП Aβ42 + СК Aβ42

(г) (ОП Aβ40 + ОП Aβ42) + (СК Aβ40 + СК Aβ42)

(д) СП Aβ17/СК Aβ17

Способ определения, имеется ли у субъекта УКН с продромальной формой болезни Альцгеймера, включающий определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин суммарного уровня пептида Aβ42 в образце плазмы указанного субъекта и уровня пептида Aβ42, связанного с клетками в образце крови указанного субъекта,

(б) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в образце плазмы субъекта и уровней пептидов Aβ40 и Aβ42, связанных с клетками, в образце крови указанного субъекта,

(в) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы субъекта и уровнем пептида Aβ17, связанного с клетками в образце крови указанного субъекта,

(г) величины соотношения между уровнем пептида Aβ17, связанного с клетками, в образце крови и уровнем пептида Aβ42, связанного с клетками в образце крови,

(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным уровням суммарного пептида Aβ17 в образце плазмы и уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным уровням суммарного пептида Aβ42 в образце плазмы и уровню пептида Aβ42, связанного с клетками в образце крови,

(е) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине уровней пептида Aβ40, связанного с клетками в образце крови, и пептида Aβ42, связанного с клетками в образце крови, и

(ж) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровням пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

причем если величина одного или нескольких из параметров (а), (б) или (в) повышена и/или величина одного или нескольких из параметров (г), (д), (е) или (ж) понижена относительно величины в контрольном образце от здорового субъекта, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

Таким образом, параметры, измеряемые для того, чтобы отличить здорового субъекта от субъекта с УКН с продромальной формой болезни Альцгеймера, следующие:

(а) ОП Aβ42 + СК Aβ42

(б) (ОП Aβ40 + ОП Aβ42) + (СК Aβ40 + СК Aβ42)

(в) СП Aβ17/СК Aβ17

(г) СК Aβ17/СК Aβ42

(д) (ОП Aβ 17 + СК Aβ17)/(ОП Aβ42 + СК Aβ42)

(е) СК Aβ17/(СК Aβ40 + СК Aβ42)

(ж) (ОП Aβ17 + СК Aβ17)/(ОП Aβ40 + ОП Aβ42) + (СК Aβ40 + СК Aβ42)

Другой объект настоящего изобретения относится к способу, позволяющему отличить субъекта с УКН с непродромальной формой болезни Альцгеймера от субъекта с УКН с продромальной формой болезни Альцгеймера, включающему определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови указанного субъекта,

(б) величины соотношения между уровнем пептида Aβ17, связанного с клетками в образце крови субъекта, и уровнем пептида Aβ42, связанного с клетками в образце крови указанного субъекта,

(в) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровня суммарного пептида Aβ42 в образце плазмы указанного субъекта и уровня пептида Aβ42, связанного с клетками в образце крови,

(г) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

причем если величина (а) повышена и/или величина одного или нескольких из указанных параметров (б), (в), (г) или (д) понижена относительно величины в контрольном образце от субъекта с УКН с непродромальной формой болезни Альцгеймера, у субъекта имеется УКН с продромальной формой болезни.

Таким образом, параметры, измеряемые для того, чтобы отличить субъекта с УКН с непродромальной формой болезни Альцгеймера от субъекта с УКН с продромальной формой болезни Альцгеймера, следующие:

(а) СК Aβ17 + СК Aβ40 + СК Aβ42

(б) СК Aβ17/СК Aβ42

(в) (ОП Aβ17 + СК Aβ17)/(ОП Aβ42 + СК Aβ42)

(г) СК Aβ17/(СК Aβ40 + СК Aβ42)

(д) (ОП Aβ17 + СК Aβ17)/(ОП Aβ40 + ОП Aβ42) + (СК Aβ40 + СК Aβ42)

Другой объект настоящего изобретения относится к способу, позволяющему отличить субъекта с УКН с непродромальной формой болезни Альцгеймера от субъекта с умеренной формой болезни Альцгеймера, включающему определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови,

(б) дополнительных величин суммарных уровней пептидов Aβ17, Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови,

(в) дополнительных величин суммарного пептида Aβ42 в образце плазмы и уровня пептида Aβ42, связанного с клетками в образце крови,

(г) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

(д) дополнительных величин суммарных уровней пептида Aβ40 в образце плазмы и уровня пептида Aβ40, связанного с клетками в образце крови,

(е) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови, и

(ж) величины соотношения между уровнем пептида свободного пептида Aβ17 в образце плазмы и уровнем пептида Aβ17, связанного с клетками в образце крови,

причем если величина одного или нескольких из указанных параметров повышена относительно величины в контрольном образце от субъекта с УКН с непродромальной формой болезни Альцгеймера, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

Таким образом, параметры, измеряемые для того, чтобы отличить субъекта с УКН с непродромальной формой болезни Альцгеймера от субъекта с умеренной формой болезни Альцгеймера, следующие:

(а) СК Aβ17 + СК Aβ40 + СК Aβ42

(б) (ОП Aβ 17 + ОП Aβ40 + ОП Aβ42) + (СК Aβ17 + СК Aβ40 + СК Aβ42)

(в) ОП Aβ42 + СК Aβ42

(г) (ОП Aβ40 + ОП Aβ42) + (СК Aβ40 + СК Aβ42)

(д) ОП Aβ40 + СК Aβ40

(е) СК Aβ17/(СК Aβ40 + СК Aβ42)

(ж) СП Aβ17/СК Aβ17

Другой объект настоящего изобретения относится к способу, позволяющему отличить субъекта с УКН с продромальной формой болезни Альцгеймера от субъекта с умеренной формой болезни Альцгеймера, включающему определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы и уровнем свободного пептида Aβ40 в образце плазмы,

(б) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню свободного пептида Aβ17 в образце плазмы, и второй параметр соответствует уровню свободных пептидов Aβ40 и Aβ42 в образце плазмы,

причем если величина одного или нескольких из указанных параметров повышена относительно величины в контрольном образце субъекта с УКН с продромальной формой болезни Альцгеймера, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

Таким образом, параметры, измеряемые для того, чтобы отличить субъекта с УКН с продромальной формой болезни Альцгеймера от субъекта с умеренной формой болезни Альцгеймера, следующие:

(а) СП Aβ17/СП Aβ40

(б) СП Aβ17/СП Aβ40 + СП Aβ42

Понятие «диагноз» в контексте настоящего изобретения включает оценку чувствительности субъекта к заболеванию, определение, болен ли субъект в настоящее время, а также прогноз, заболеет ли он данным заболеванием. Специалистам в данной области очевидно, что такая оценка в норме не может быть точной для 100% диагностируемых субъектов, хотя в большинстве случаев она правильная. Понятие «диагноз» в контексте настоящего изобретения, однако, требует, чтобы статистически существенная часть субъектов могла быть идентифицирована в качестве имеющих заболевание или обладающих предрасположенность к нему. Если часть статистически значима, диагноз может быть поставлен специалистами в данной области с помощью известных методов статистической оценки, например, определения доверительных интервалов, определения величин p, t-теста Стьюдента, теста Манна-Уитни и др. Подробнее с методами можно ознакомиться в кн.: Dowdy, Wearden, «Statistics for Research», 1983, изд-во John Wiley & Sons, Нью-Йорк. Предпочтительные доверительные интервалы составляют по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%. Предпочтительно величины p составляют 0,2, 0,1 или 0,05.

Понятие «субъект» в контексте настоящего изобретения относится ко всем животным, классифицированным в качестве млекопитающих, и включает, но ими не ограничивается, домашних и сельскохозяйственных животных, приматов и людей, например, людей, обезьян, коров, лошадей, свиней, овец, коз, собак, кошек или грызунов. Предпочтительно субъектом является мужчина или женщина какой-либо расы или какого-либо возраста.

Понятие «болезнь Альцгеймера (или старческое слабоумие)» в контексте настоящего изобретения означает психическое нарушение, ассоциированное со специфическим дегенеративным заболеванием мозга, которое отличается сенильными бляшками, невритическими узлами и прогрессирующей потерей нейронов, причем клиническое проявление заключается в прогрессирующем нарушении памяти, помрачении сознания, проблемам в поведении, неспособности обслуживать себя, постепенном физическом изнашивании и, в конечном счете, в смерти.

Понятие «умеренная форма болезни Альцгеймера» в контексте настоящего изобретения относится к ранней стадии болезни Альцгеймера, на которой субъект испытывает:

- Потерю памяти на недавние события.

- Сложности в разрешении проблем, сложных задач, а также отсутствие здравого смысла.

- Изменения личности

- Сложности в планировании и выражении мыслей.

- Субъект может заблудиться или потерять вещи.

Пациентов с умеренной формой болезни Альцгеймера выявляют с помощью критериев NINCDS-ADRDA (CDR=1, краткая шкала оценки психического статуса (Mini-mental State Examination - MMSE) от 16 до 24 единиц и средняя временная атрофия (по данным МРТ)>3 единиц по шкале Шелтенса).

Понятие «умеренное когнитивное нарушение или УКН» в контексте настоящего изобретения означает переходную стадию когнитивного нарушения между нормальным старением и ранней стадией болезни Альцгеймера. Пациентам обычно ставят диагноз УКН, если они полностью соответствуют критериям клиники Мейо (CDR=0,5, средняя временная атрофия (по данным МРТ)>3 единиц по шкале Шелтенса, состояние теменного и/или временного гипометаболизма по данным позитронной эмиссионной томографии с 18-фтордезоксиглюкозой (Positron Emission Tomography with 18-fluorodeoxyglucose - PET-FDG) (подтверждение БА)).

Понятие «продромальная форма болезни Альцгеймера» относится к пациентам с УКН, которых относят к пациентам с высоким риском конверсии состояния в болезнь Альцгеймера. Критерии для выявления пациента, у которого предположительно имеется БА, те же, что и критерии NINCDS-ADRDA (McKhann G. и др., Neurology, 34, 1984, cc.939-944), а именно, слабоумие, установленное на основании клинической и нейропсихологической оценки, прогрессирующее когнитивное расстройство, которое наблюдают в двух или более областях сознания, начало поражения в возрасте 40-90 лет и отсутствие других заболеваний, способных вызвать синдром слабоумия.

Понятие «непродромальная форма болезни Альцгеймера» или «УКН с возможной болезнью Альцгеймера» относится к пациентам, у которых выражена УКН и которые рассматриваются в качестве пациентов с низкой степенью риска развития болезни Альцгеймера. Критерии для выявления пациента, у которого возможна болезнь Альцгеймера, те же, что и критерии NINCDS-ADRDA (McKhann G. и др., Neurology, 34, 1984, cc.939-944), а именно, синдром слабоумия с атипичным началом, проявлением или прогрессированием и без известной этиологии, но без сопутствующих заболеваний, способных вызывать слабоумие, предположительно лежат в начале заболевания.

Понятие «здоровый субъект» в контексте настоящего изобретения означает субъекта с хорошим здоровьем. В предпочтительном варианте осуществления настоящего изобретения указанный субъект старше 65 лет. Это понятие относится к субъекту без нейродегенеративного заболевания или без какого-либо нейродегенеративного заболевания в истории болезни. Предпочтительно здоровыми субъектами являются пациенты, у которых нет осложнений с памятью, которые нормально выполняют нейропсихологические тесты и у которых нет структурных изменений по результатам анализа ЯМР. У здорового субъекта могут отсутствовать какие-либо заболевания или у него могут быть заболевания, отличные от УКН и БА.

Понятие «способность отличать здорового субъекта от субъекта с продромальной формой болезни Альцгеймера» в контексте настоящего изобретения относится к способности отличать субъекта, не имеющего симптомов болезни Альцгеймера (БА), от субъекта с продромальной формой болезни Альцгеймера.

Понятие «способность отличать здорового субъекта от субъекта с умеренной формой болезни Альцгеймера» в контексте настоящего изобретения относится к способности отличать субъекта, не имеющего симптомов болезни Альцгеймера (БА), от субъекта, находящегося на ранних стадиях болезни Альцгеймера (умеренная форма болезни Альцгеймера).

Понятие «способность отличать субъекта с непродромальной формой УКН от субъекта с продромальной формой болезни Альцгеймера» в контексте настоящего изобретения относится к способности отличать субъекта с симптомами непродромальной формы УКН от субъекта с продромальной формой болезни Альцгеймера.

Понятие «способность отличать субъекта с непродромальной формой УКН от субъекта с умеренной формой болезни Альцгеймера» в контексте настоящего изобретения относится к способности отличать субъекта с симптомами непродромальной формы УКН от субъекта, находящегося на ранних стадиях БА (умеренная форма болезни Альцгеймера).

Понятие «способность отличать субъекта с продромальной формой БА от субъекта с умеренной формой болезни Альцгеймера» в контексте настоящего изобретения относится к способности отличать субъекта с симптомами продромальной формы БА от субъекта, находящегося на ранних стадиях БА (умеренная форма болезни Альцгеймера).

Понятие «плазма» в контексте настоящего изобретения означает жидкий компонент цельной крови. В зависимости от применяемого способа разделения плазма может быть полностью свободной от клеточных компонентов, или может содержать различные количества тромбоцитов и/или небольшое количество других клеточных компонентов.

Понятие «уровни пептидов Aβ17, Аβ40 или Aβ42, связанных с клетками (обозначаемых ниже в настоящем изобретении СВ Aβ17, СВ Aβ40 или СВ Aβ42, соответственно)» в контексте настоящего изобретения относится к амилоидным бета-пептидам, нековалентно ассоциированным с поверхностью клеток, присутствующих в биологическом образце, и неспособным связываться с антителами, добавленными в образец, и, следовательно, выявляться иммунологически. Обычно, если биологическим образцом является кровь, амилоидный бета-пептид ассоциирован с эритроцитами, лейкоцитами, включая нейтрофилы, эозинофилы, базофилы, лимфоциты и моноциты, а также с тромбоцитами. Количество амилоидного бета-пептида, ассоциированного с клетками в данном образце, может быть установлено, и эта величина может использоваться отдельно или в комбинации с другими параметрами, связанными с амилоидными бета-пептидами, в способах по настоящему изобретению. Для этой цели, во-первых, требуется выделить клеточную фракцию из биологического образца. Это можно осуществить, используя какую-либо методику, известную специалистам в данной области, например, центрифугирование, осаждение, фильтрацию и др. После выделения клетки контактируют с агентом солюбилизации белка.

Количество амилоидного бета-пептида, ассоциированного с клетками в данном образце, может быть определено и эта величина может использоваться отдельно или в комбинации с другими параметрами, связанными с амилоидными бета-пептидами, в способах по настоящему изобретению. Для этой цели, во-первых, требуется выделить клеточную фракцию из биологического образца. Это можно осуществить, используя какую-либо методику, известную специалистам в данной области, например, центрифугирование, осаждение, фильтрацию и др. После выделения клетки контактируют с агентом солюбилизации белка.

К соответствующим агентам, солюбилизирующим белок, относятся описанные ниже детергенты, хаотропные агенты и восстанавливающие агенты, которые обычно содержатся в буферном растворе в соответствующей концентрации. Соответствующие агенты, буферные растворы и концентрации агентов в буферном растворе описаны ниже. Стадию контактирования проводят в значительной степени согласно описанному в способе выделению амилоидного пептида, который соединен с компонентами (белками и липидами) биологического образца. В предпочтительном варианте осуществления настоящего изобретения агентом, солюбилизирующим белок, является детергент. В другом более предпочтительном варианте осуществления настоящего изобретения детергентом является Tween 20. Описанные выше соответствующие концентрации Tween 20 для его применения в качестве агента, солюбилизирующего белок, составляют 0,004-0,02 мас.%, более предпочтительно 0,005-0,01 мас.%.

Стадию контактирования проводят предпочтительно при низкой температуре для подавления протеолитических активностей в образце. Соответствующая температура составляет примерно 0-10°С, предпочтительно примерно 3-5°С, например, примерно 4°С.

Обычно стадию контактирования проводят путем ресуспендирования клеточной фракции в биологическом образце с раствором, включающим агент солюбилизации белка. Указанное ресуспендирование может проводиться осторожным затягиванием в пипетку и выдуванием из пипетки, перемешиванием, предпочтительно взбалтыванием, более предпочтительно взбалтыванием на высокой скорости, наиболее предпочтительно на встряхивателе Vortex в течение по меньшей мере 5 сек, предпочтительно в течение по меньшей мере 10 сек, более предпочтительно в течение по меньшей мере 15 сек (например, в течение 15-50 сек). Предпочтительная скорость для такого перемешивания, встряхивания, взбалтывания, взбалтывания на высокой скорости или на встряхивателе Vortex составляет по меньшей мере 250 об/мин, предпочтительно по меньшей мере 500 об/мин, более предпочтительно по меньшей мере 1000 об/мин, наиболее предпочтительно примерно 2000-2500 об/мин.

Стадию контактирования проводят в условиях, соответствующих достижению частичной или, предпочтительно, полной диссоциации амилоидного бета-пептида из клеток, имеющихся в биологическом образце. Условия могут быть должным образом определены каким-либо специалистом в данной области путем мониторинга количества амилоидного бета-пептида, выявляемого до стадии контактирования и последовательно в разные временные точки после стадия контактирования.

Понятие «общее содержание Aβ пептида в плазме» (ниже пептид обозначается ОП Aβ17, ОП Aβ40 или ОП Aβ42) в контексте настоящего изобретения означает «свободный пептид Aβ в плазме» плюс «амилоидный бета-пептид, ассоциированный с макромолекулярными компонентами». Понятие «амилоидный бета-пептид, ассоциированный с макромолекулярными компонентами» в контексте настоящего изобретения означает амилоидный бета-пептид, который нековалентно связан или присоединен к молекулам, обнаруживаемым в исследуемом биологическом образце. Доступность этого пептида для иммунологического выявления обычно усложнена и таким образом требуется предварительная обработка биологического образца для достижения отделения пептида от таких компонентов. В таких условиях амилоидный бета-пептид, соединенный с макромолекулярными компонентами, может быть высвобожден от указанных компонентов и может стать доступным для иммунологического выявления с помощью специфических антител. Поскольку биологический образец уже содержит определенное количество свободного амилоидного бета-пептида, общее содержание свободного амилоидного пептида после контактирования образца с агентом, солюбизизирующим белок, может быть совокупным уровнем первоначально имеющегося свободного амилоидного бета-пептида, высвобожденного при обработке агентом, солюбизизирующим белок. Если требуется определить уровень имеющегося в образце амилоидного бета-пептида, ассоциированного с макромолекулярными компонентами, обычно определяют уровень свободного амилоидного бета-пептида до обработки агентом, солюбизизирующим белок, и уровень свободного амилоидного бета-пептида после обработки агентом, солюбизизирующим белок, и вычитают первую величину из второй. Для задач, решаемых в настоящем изобретении, обычно требуется определить совокупный уровень свободных амилоидных бета-пептидов, к которым относятся исходно свободные амилоидные бета-пептиды, а также уровень амилоидных бета-пептидов, высвобождающихся из макромолекулярных компонентов после обработки агентом, солюбизизирующим белок. Таким образом, параметр, который обычно определяют, когда обрабатывают образец так, чтобы диссоциировать амилоидный пептид от макромолекулярных компонентов, соответствует добавлению свободного пептида, имеющегося в образце, и пептида, ассоциированного с макромолекулярными компонентами.

К макромолекулярным компонентам образца, которые могут связывать амилоидные бета-пептиды и которые вносят вклад в общий пул амилоидного бета-пептида, ассоциированного с макромолекулярными компонентами, относятся и белки, и липиды. В отдельном случае, когда способ по настоящему изобретению применяют к образцам крови или плазмы, макромолекулярными компонентами являются, но ими перечень не ограничивается, белки и липиды крови. К примерам белков крови относятся альбумин, иммуноглобулин G, иммуноглобулин Е, иммуноглобулин М, иммуноглобулин А, фибриноген (фибрин и продукты его разрушения), альфа-1 антитрипсин, преальбумин, альфа-1 кислый гликопротеин, альфа-1 фетопротеин, альфа-2 гаптоглобин, макроглобулин, церулоплазмин, трансферрин, С3/С4 бета-2 микроглобулин, бета-липопротеин, альфа-, бета- и гамма-глобулины, C-реактивный белок (С-reactive protein - CRP), протромбин, тироксин-связывающий белок, транстиретин и др. К примерам липидов крови относятся свободные жирные кислоты, холестерин, триглицериды, фосфолипиды, сфинголипиды и др.

Количество амилоидного бета-пептида, ассоциированного с макромолекулярными компонентами, может быть определено путем контактирования образца без клеток от биологического образца с агентом, солюбилизирующим белок, в условиях, способствующих индукции высвобождения указанных амилоидных бета-пептидов от указанных макромолекулярных компонентов.

Следует иметь ввиду, что в настоящем изобретении с помощью контактирования путем добавления к образцу достаточного количества раствора, включающего агент, солюбилизирующий белок, таким образом, что концентрация агента, солюбилизирующего белок, в смеси достаточна для эффективного растворения амилоидного бета-пептида, связанного с белками и клетками в образце. Предпочтительно агент, солюбилизирующий белок, обнаруженный в растворе, в буферном растворе, таким образом, что добавление агента, солюбилизирующего белок, не вызывает существенной модификации рН образца.

Понятие «агент, солюбилизирующий белок» в контексте настоящего изобретения означает какое-либо соединение композиции, способное изменять вторичную, третичную и/или четвертичную структуру полипептидов, сохраняя интактной первичную структуру. Благодаря этим свойствам агенты, солюбилизирующие белок, способны повышать растворимость белков в образце и предупреждать внутреннюю и межмолекулярную агрегацию белков. К агентам, солюбилизирующим белок, которые могут применяться в настоящем изобретении, относятся, но ими не ограничиваются, детергенты, хаотропные агенты, восстанавливающие агенты или их смеси.

В контексте настоящего изобретения понятие «детергент» в общем смысле является синонимом поверхностно активных агентов и относится к амфипатическим поверхностно-активным агентам, которые при добавлении к жидкости снижают поверхностное натяжение жидкости по сравнению с той же жидкостью при отсутствии детергента. Детергенты также способны предупреждать агрегирование белков и предупреждать неспецифическое взаимодействие или связывание контаминантов с целевым белком. Детергенты, применимые в настоящем изобретении, включают, но ими перечень не ограничивается, неионные (нейтральные), анионные, катионные или цвиттер-ион детергенты.

К примерам неионных или нейтральных детергентов относятся, но ими перечень не ограничивается, детергенты серии Tween, например, Tween® 20, Tween® 21, Tween® 40, Tween® 60, Tween® 61, Tween® 65, Tween® 80, Tween® 81, Tween® 85, детергенты серии Span®, например. Span® 20; детергенты серии Tergitol, например, Tergitol Type 15-S-12; детергенты серии Brij®, например, Brij® 35, Brij® 56, Brij® 72, Brij® 76, Brij® 92V, Brij® 97, Brij® 58P; детергенты серии Triton®, например, Triton® Х-100, Triton® X-114, Triton® CF-21, Triton® CF-32, Triton® DF-12, Triton® DF-16, Triton® GR-5M, Triton® X-102, Triton® X-15, Triton® X-151, Triton® X-207, Triton® X-165, Triton® X-305, Triton® X-405, Triton® X-45, Triton® X-705-70 или неионный консервативный вариант по меньшей мере одного из указанных детергентов.

К примерам анионных детергентов относятся, но ими перечень не ограничивается, холевая кислота и ее производные, таурохолевая кислота, Triton Х-200, Triton W-30, Triton-30, Triton-770, диоктилсульфосукцинат, N5N-диметилдодециламин N-оксид, 1-алкилсульфонаты натрия, соли N-лауроилсаркозина или жирных кислот.

К примерам катионных детергентов относятся, но ими перечень не ограничивается, моно- и ди-метил амины жирных кислот, алкилтриметиламмонийные соли, диалкилдиметиламмонийные соли, ацетаты алкиламина, ацетаты триалкиламмония, алкилдиметилбензиламмонийные соли, диалкилдиметилбензиламмонийные соли, соли галогенида алкилпиридиния и алкил(замещенный алкил)пиридиния, соли алкилтиометилпиридиния, соли алкиламидометилпиридиния, соли алкилхинолиния, соли алкилизохинолиния, соли N,N-алкилметилпироллидония, соли 1,1-диалкилпиперидиния, соли 4,4-диалкилтиаморфолиния, соли 4,4-диалкилтиаморфолиния-1-оксида, сульфат (и другие соли) метил his (алкил этил)-2-алкилимидазолинияметила, сульфат (и другие соли) метил bis (алкиламидо этил)-2-гидроксиэтиламмонияметила, соли алкиламидопропилдиметилбензиламмония, соли карбоксиалкил-алкилдиметиламмония, оксиды алкиламина, оксиды алкилдиметиламина, соли поли(винилметилпиридиния), соли поли(винилпиридина), полиэтиленимины, бикарбонаты (и другие соли) триалкилфосфония, соли триалкилметилфосфония, соли алкилэтилметилсульфония и соли алкилметилсульфоксония.

К примерам цвиттер-ионных детергентов относятся, но ими перечень не ограничивается, 3-[(3-хлорамидопропил)диметиламмония]-1-пропансульфонат (CHAPS); 3-[(3-хлорамидопропил)диметиламмония]-2-гидрокси-1-роропансульфонат (CHAPSO); N-(алкил С10-С16)-N,N-диметилглицинбетаин (EMPIGEN ВВ); каприлилсульфобетаин (SB3-10); 3-[N,N-диметил(3-миристоиламинопропил)аммония]пропансульфонат (амидосульфобетаин-14; ASB-14); N-тетрадецил-N,N-диметил-3-аммоний-1-пропансульфонат(3-14 детергент; ZWITTERGENT); N-додецил-N,N′-диметил-3-аммоний-1-пропансульфонат; N-октадецил-N,N-диметил-3-аммоний-1-пропансульфонат; N-децил-N,N-диметил-3-аммоний-1-пропан сульфонат; продукт Mirataine СВ; продукт Mirataine ВВ; продукт Mirataine CBR; продукт Mirataine ACS; продукт Miracare 2MHT и продукт Miracare 2MCA.

В предпочтительном варианте осуществления настоящего изобретения реагентом, солюбилизирующим белок, является детергент. В другом предпочтительном варианте осуществления настоящего изобретения детергентом является Tween 20. В более предпочтительном варианте осуществления настоящего изобретения Tween 20 применяют в концентрации 0,5%.

Понятие «хаотропный агент» в контексте настоящего изобретения означает соединение или смесь соединений, разрушающих водородные связи и гидрофобные взаимодействия и между белками, и внутри белков. В больших концентрациях хаотропные агенты разрушают вторичную структуру белка и привносят в раствор белки, которые иным образом не растворяются. К соответствующим хаотропным агентам относятся, но ими перечень не ограничивается, мочевина, гуанидиний изотиоцианат, натрий тиоцианат (NaSCN), гуанидин HCl, гуанидиний хлорид, гуанидиний тиоцианат, литий тетрахлорацетат, натрий перхлорат, рубидий тетрахлорацетат, калий иодид или цезий трифторацетат.

Понятие «восстанавливающий агент» в контексте настоящего изобретения означает какое-либо соединение или материал, который поддерживает сульфгидрильные группы в восстановленном состоянии и восстанавливает внутримолекулярные и межмолекулярные дисульфидные связи. К примерам восстанавливающих агентов, применимых в способе настоящего изобретения, относятся агенты, восстанавливающие и сульфгидрил, и фосфин. К примерам сульфгидрильных восстановителей относятся дитиотреит (dithiothreitol - DTT), дитиоэритрит (dithioerythritol - DTE) и β-меркаптоэтанол. К примерам фосфиновых восстановителей относятся трибутилфосфин (tributylphosphine - ТВР) и трис-карбоксиэтилфосфин (tris-carboxyethylphosphine - ТСЕР).

Обычно биологический образец сначала обрабатывают для удаления клеточной фракции. Образец, не содержащий клетки, затем приводят в контакт с агентом, солюбилизирующим белок. В предпочтительном варианте осуществления настоящего изобретения образец разводят, используя буфер, включающий агент, солюбилизирующий белок. Обычно образец разводят в 5 раз в буферном растворе, включающем Tween 20.

В контексте настоящего изобретения понятие «буферный раствор» означает какое-либо вещество или смесь соединений в растворе, которые могут нейтрализовать и кислоты, и основания, без существенного изменения исходной кислотности или щелочности раствора. К соответствующим буферным растворам, применяемым в способе по настоящему изобретению, относятся, но ими перечень не ограничивается, буферный раствор Tris, фосфатный буферный раствор, боратный буферный раствор, карбонатный буферный раствор, буферный раствор глицина-натрия гидрохлорида или др. Предпочтительно буферным раствором является фосфатный буферный раствор, например, фосфатносолевой буфер (ФСБ).

Количество раствора, содержащего агент солюбилизации белка, которое добавляют к биологическому образцу не является определяющим, до тех пор пока не достигается существенная диссоциации амилоидного бета-пептида. Например, биологическая жидкость может быть разведена в растворе, содержащем агент солюбилизации белка в разведении по меньшей мере 1/2 (объем/объем), 1/3 (объем/объем), 1/4 (объем/объем), 1/5 (объем/объем), 1/6 (объем/объем), 1/7 (объем/объем), 1/8 (объем/объем), 1/9 (объем/объем), 1/10 (объем/объем), 1/20 (объем/объем), 1/50 (объем/объем), 1/60 (объем/объем), 1/80 (объем/объем), 1/90 (объем/объем), 1/100 (объем/объем) или более. Специалисту следует учитывать, что может применяться какая-либо комбинация указанных разведении и концентрации указанного агента, солюбилизирующего белок, до тех пор, пока итоговая концентрация агента, солюбилизирующего белок, соответствует достижению требуемого эффекта. Например, раствор, содержащий агент, солюбилизирующий белок, может включать указанный выбранный агент (агенты) солюбилизации белка в концентрации от 0,001 мас% до 0,5 мас%. После разведения в указанном растворе, содержащем агент солюбилизации белка, указанная биологическая жидкость обычно содержит указанное поверхностно-активное вещество (вещества) в количестве менее 0,1 мас%, предпочтительно менее 0,6 мас%, более предпочтительно не более чем 0,5 мас%, наиболее предпочтительно не более чем 0,45 мас% и еще более предпочтительно 0,5 мас%.

К соответствующим буферным системам для применения в настоящем изобретении относятся буферы Tris-HCl, включающие соль, например, NaCl или KCl, и необязательно БСА. В частности к буферным системам относятся, но ими перечень не ограничивается, следующие:

50 мМ Tris-HCl рН 8, 0,5М NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl рН 8, 0,5М NaCl, 0,05% БСА, 0,05% Tween-20, 1М GuHCl;

50 мМ Tris-HCl рН 8, 0,5М KCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl рН 8, 0,5М KCl, 0,05% БСА, 0,05% Tween-20, 1М GuHCl;

50 мМ Tris-HCl рН 8, 0,5М NaCl, 0,05% БСА, 0,05% Tween-80;

50 мМ Tris-HCl рН 8, 0,5М KCl, 0,05% БСА, 0,05% Tween-80;

50 мМ Tris-HCl рН 8, 0,5М NaCl; 0,05% БСА, 0,05% Triton X-100;

50 мМ Tris-HCl рН 8, 0,5М KCl, 0,05% БСА, 0,05% Triton Х-100;

50 мМ Tris-HCl рН 8, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl рН 8, 0,5M NaCl, 0,1% БСА, 0,05% Tween-20;

50 мМ Tris-HCl рН 8, 0,5М NaCl, 0,05% БСА, 0,1% Tween-20;

50 мМ Tris-HCl pH 8, 0,5M NaCl, 0,1% БСА, 0,1% Tween-20;

50 мМ Tris-HCl pH 8, 1М NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 8, 1,5М NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 8, 2М NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 8, 2,5М NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 8, 3М NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 8, 0,5М NaCl, 0,05% БСА, 0,05% Tween-20, 10% ДМСО;

50 мМ Tris-HCl pH 8, 0,5М NaCl, 0,05% БСА, 0,05% Tween-20, 0,5 М GuHCl;

50 мМ Tris-HCl pH 6, 0,5M NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 7, 0,5M NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 9, 0,5M NaCl, 0,05% БСА, 0,05% Tween-20;

50 мМ Tris-HCl pH 8, 0,5M NaCl, 0,05% БСА.

Например, если Tween 20 применяют в качестве агента, солюбилизирующего белок, предпочтительна концентрация 0,004-0,02 мас%, более предпочтительна концентрация 0,005-0,01 мас.%.

Стадию контактирования проводят предпочтительно при низкой температуре для подавления протеолитических активностей в образце. Соответствующая температура составляет примерно 0-10°С, предпочтительно примерно 3-5°С, например, примерно 4°С.

После контакта биологической жидкости с раствором, содержащим агент солюбилизации белка, обе жидкости могут быть перемешаны. Перемешивание может проводиться взбалтыванием, предпочтительно встряхиванием, более предпочтительно встряхиванием на высокой скорости, наиболее предпочтительно на встряхивателе Vortex в течение по меньшей мере 5 сек, предпочтительно в течение по меньшей мере 10 сек, более предпочтительно в течение по меньшей мере 15 сек (например, в течение 15-50 сек). Предпочтительная скорость для такого перемешивания, встряхивания, взбалтывания, взбалтывания на высокой скорости или на встряхивателе Vortex составляет по меньшей мере 250 об/мин, предпочтительно по меньшей мере 500 об/мин, более предпочтительно по меньшей мере 1000 об/мин, наиболее предпочтительно примерно 2000-2500 об/мин.

Стадию контакта проводят в условиях, соответствующих частичной или, предпочтительно, полной диссоциации амилоидного бета-пептида с белка или липидов в биологическом образце. Условия могут быть должным образом установлены специалистом в данной области путем мониторинга количества амилоидного бета-пептида, которое определяют до стадии контактирования и последовательно в разные временные точки после стадии контактирования. Длительность эксперимента может быть определена согласно описанному в примере в экспериментальной части.

Специалисту следует учитывать, что если уровень амилоидного бета-пептида определяют разведением биологического образца буфером, содержащим реагент солюбилизации белка, уровень свободного амилоидного бета-пептида, полученный методом иммунологического определения, может быть откорректирован, учитывая фактор разведения, ранее примененный к биологическому образцу.

Понятие «свободные пептиды Aβ17, Aβ40 или Aβ42 в плазме» (которые ниже обозначены СП Aβ17, СП Aβ40 или СП Aβ42, соответственно) в контексте настоящего изобретения относятся к уровню амилоидных бета-пептидов, которые не ассоциированы с каким-либо компонентом биологического образца и которые легко доступны для связывания со специфическим антителом. Такой пептид может быть определен обычными иммунологическими методами путем контактирования биологического образца с антителом, специфичным в отношении указанного пептида. В предпочтительном варианте осуществления настоящего изобретения уровень свободного амилоидного пептида определяют в плазме.

Понятие «контрольное значение» в контексте настоящего изобретения означает величину параметра, который используют для сравнения и который определяют у субъекта, не имеющего нейродегенеративного заболевания или нейродегенеративного заболевания в истории болезни. Предпочтительно субъектами, от которых получают контрольные значения для разных параметров и расчетные параметры, являются пациенты, у которых нет осложнений с памятью, которые нормально выполняют нейропсихологические тесты и у которых нет структурных изменений по результатам анализа ЯМР.

В частности выбирают контрольные значения, которые предоставляют чувствительность выше 85% и специфичность выше 75%. В другом предпочтительном варианте осуществления настоящего изобретения отбирают значения таким образом, чтобы получить чувствительность выше 70% и специфичность выше 70%. Предпочтительно контрольные значения, которые позволяют получить правильный и точный прогноз, составляют по меньшей мере 80%.

После того, как определена величина параметра, выясняют, болен ли субъект умеренной формой болезни Альцгеймера, если есть изменение величины параметра или величины параметра, рассчитанного относительно контрольной величины.

Какой-либо способ, применимый для определения пептидов, может применяться в настоящем изобретении. Например, концентрацию амилоидного бета-пептида можно определить с помощью одного или нескольких методов из числа следующих: вестерн-блоттинга, иммунопреципитации, связанного с ферментом иммуносорбентного анализа (enzyme-linked immunosorbent assay - ELISA), поверхностного плазменного резонанса, реакции преципитации, иммунодиффузии в геле, радиоиммуноанализа (radioimmunoassay - RIA), сортировки клеток с активированной флуоресценцией (fluorescent activated cell sorting - FACS), двухмерного гель-электрофореза, капиллярного электрофореза, масс-спектроскопии (mass spectroscopy - MS), ионизации лазерной десорбцией с использованием матрицы/ лазерной десорбции/ионизации при содействии матрицы времяпролетной масс-спектрометрии (time-of-flight mass spectrometry - MALDI-TOF-MS), времяпролетной масс-спектрометрия с усиливаемой поверхностью лазерной десорбцией-ионизацией (surface-enhanced laser desorption/ionization-time of flight-mass spectrometry - SELDI-TOF-MS), высокоэффективной жидкостной хроматографии (ВЭЖХ), быстрой жидкостной хроматографии белков (fast protein liquid chromatography - FPLC), многомерной жидкостной хроматографии (liquid chromatography - LC) с последующей тандемной масс-спектрометрией (tandem mass spectrometry - MS/MS), тонкослойной хроматографии, анализа экспрессии белкового чипа и лазерной денситометрии.

В предпочтительном варианте осуществления настоящего изобретения в способе по настоящему изобретению применяют иммунологический метод. В контексте настоящего изобретения понятие «иммунологический метод», применяемый для определения, относится к какому-либо методу, который включает применение одного или нескольких антител, специфичных в отношении целевого вещества, для того, чтобы определить количество/концентрацию указанного целевого вещества, исключая другие вещества, содержащиеся в образце. К соответствующим иммунологическим методам относятся, но ими перечень не ограничивается, вестерн-блоттинг, иммунопреципитация, связанный с ферментом иммуносорбентный анализ (enzyme-linked immunosorbent assay - ELISA), поверхностный плазменный резонанс, радиоиммуноанализ (RIA). В предпочтительном варианте осуществления настоящего изобретения определение или выявление амилоидного бета-пептида осуществляют методом ELISA.

Специалисту в данной области известно, что какой-либо тип антител применим для осуществления способов иммунологического обнаружения по настоящему изобретению при условии, что антитело достаточно специфично для эффективного различения типов амилоидных бета-пептидов в образце от других веществ.

Аббревиатура «ELISA (enzyme-linked immunosorbent assay)» в контексте настоящего изобретения означает связанный с ферментом иммуносорбентный анализ и относится к анализу, с помощью которого неизвестное количество целевого вещества (амилоидного бета-пептида) закреплено на поверхности, над которой затем пропускают специфическое таким образом, что оно связывается с антигеном; Это антитело связано с ферментом и на заключительной стадии вещество добавляют таким образом, что фермент может конвертировать в некий выявляемый сигнал. Известны различные типы методом ELISA, которые могут быть применены в способе по настоящему изобретению, включая прямой метод ELISA, сэндвич-ELISA, конкурентный метод ELISA и обратный ELISA метод и устройство (ELISA-R m&d).

Прямой метод ELISA осуществляют путем контактирования исследуемого образца, содержащего амилоидный бета-пептид, с твердым носителем, который был предварительно покрыт концентрированным раствором невзаимодействующего белка или реагента (бычьего сывороточного альбумина, казеина). После того, как амилоидный бета-пептид из исследуемого образца адсорбируется на носителе, антитело, специфичное в отношении амилоидного бета-пептида, добавляют в соответствующих условиях, пригодных для связывания с амилоидным бета-пептидом. Связанные антитела затем выявляют с помощью вторичного антитела, которое соединено с выявляемой меткой или с ферментом, модифицирующим субстрат. Сигнал, поступающий от выявляемой метки или от субстрата, пропорционален количеству антитела, связанного с носителем, которое, в свою очередь, непосредственно коррелирует с количеством амилоидного бета-пептида в образце.

Конкурентный метод ELISA, в котором на первой стадии исследуемый образец, содержащий неизвестное количество амилоидного бета-пептида, контактирует с первым антителом согласно описанному выше. В лунку с нанесенным антигеном добавляют комплексы антитела-антигена. После того, как носитель промывают для удаления каких-либо неспецифически связанных комплексов, количество первого антитела выявляют с помощью второго антитела, которое соединено с выявляемым компонентом. В исследованиях этого типа чем выше концентрация исходного антигена, тем слабее возникающий сигнал. Другой вариант конкурентного метода ELISA заключается в том, что включает фермент-связанный антиген, а не фермент-связанное антитело. Меченый антиген конкурирует за сайты связывания первичного антитела с антигеном образца (без метки). С помощью данного типа метода данные по концентрации антигена в образце обратно коррелируют с количеством меченого антигена, удерживаемого в лунке, и, соответственно, выражаются в более слабом сигнале.

Обратный метод и устройство ELISA (ELISA-R m&d) основаны на использовании нововведения - твердой фазы, состоящей из полистирольного иммуносорбентного стержня с 4-12 выступающими огивами; все устройство может быть внесено в пробирку, содержащую отобранный образец, и последующие стадии (промывка, инкубация в конъюгате и инкубация в хромогене) легко осуществляются путем помещения огив в микролунки стандартных микропланшетов, предварительно заполненных реагентами, запечатанных и сохраняемых до использования.

В предпочтительном варианте осуществления настоящего изобретения методом ELISA является метод сэндвич-ELISA. Метод сэндвич-ELISA включает нанесение на основу первого антитела, специфичного в отношении амилоидного бета-пептида, применение образца, содержащего амилоидный бета-пептид, что может привести к связыванию амилоидного бета-пептида с первым антителом, и применение второго антитела, также специфичного в отношении амилоидного бета-пептида, причем указанное второе антитело обычно соединено с выявляемой меткой или с ферментом, модифицирующим субстрат. Сигнал, вырабатываемый меткой, или конвертированный субстрат пропорциональны количеству антигена в образце.

Предпочтительно выполнять разные стадии способа, используя параллельно исследуемые образцы и ряд контрольных образцов с известной концентрацией определяемого соединения. Стандартная кривая для пептида Aβ17 должна быть получена с использованием возрастающих концентраций для определения концентрации указанных выше параметров. Стандартная кривая служит двойной цели (i) установить диапазон концентрации, в котором сигнал возрастает линейно с концентрацией целевого пептида, и (ii) определить концентрацию пептидов в исследуемом образце путем интерполяции сигнала, полученного от исследованных и стандартных образцов, по кривой для определения концентрации. Ввиду высокой чувствительности анализа по настоящему изобретению предпочтительными концентрациями тестируемого образца являются, например, 3,125, 6,25, 12,5, 25, 50, 100 и 200 пг/мл. Следует иметь в виду, что концентрации образцов, использованных для получения стандартной кривой, могут варьировать для каждого исследуемого субстрата. Однако практикующий специалист может легко определить линейный диапазон обычными методами.

Понятие «изменение» в контексте настоящего изобретения означает статистически значимое повышение или понижение величины исследуемого параметра относительно контрольной величины.

Понятие «статистически значимый» в контексте настоящего изобретения относится к статистическому анализу вероятности, подтверждающему, что это не случайная ассоциация между двумя или более результатами, конечными данными или выходами, т.е. что существует определенная степень математической гарантии, что величина параметра относительно контрольной величины ассоциирована с определенной группой пациентов.

Статистическая значимость изменения в величинах может быть определена с использованием p-величины. Например, при использовании p-величины определяют параметр в качестве показывающего существенное изменение, если p-величина меньше 0,1, предпочтительно менее 0,05, более предпочтительно менее 0,01, еще более предпочтительно менее чем 0,005, наиболее предпочтительно менее 0,001.

Обычно величина рассматриваемого параметра может быть определена в качестве «увеличенной», если она выше контрольного значения по меньшей мере в 1,1 раза, 1,5 раза, 5 раз, 10 раз, 20 раз, 30 раз, 40 раз, 50 раз, 60 раз, 70 раз, 80 раз, 90 раз, 100 раз или даже более по сравнению с контрольным значением. С другой стороны, величина рассматриваемого параметра может быть определена в качестве «уменьшенной», если она меньше по меньшей мере 0,9 раза, 0,75 раза, 0,2 раза, 0,1 раза, 0,05 раза, 0,025 раза, 0,02 раза, 0,01 раза, 0,005 раз или даже еще меньше, по сравнению с эталонным значением. В одном из вариантов осуществления настоящего изобретения изменение величины параметра или величины рассчитанного параметра относительно контрольного значения повышено.

Другие варианты осуществления настоящего изобретения следующие:

[1] Антитело, которое специфически связывается с пептидом Aβ(1-17).

[2] Антитело по пункту [1], которое не проявляет в значительной степени перекрестной реакционной способности в отношении пептида Aβ, выбранного из группы, включающей Aβ(1-15), Aβ(1-16), Aβ(1-38), Aβ(1-40), Aβ(1-42) и комбинацию одного или нескольких из этих пептидов.

[3] Антитело по пункту [1] или [2], являющееся поликлональным антителом.

[4] Антитело по одному из пунктов [1]-[3], причем указанное антитело получают, используя в качестве иммуногена пептид Aβ, выбранный из группы, включающей SEQ ID NO:1 или SEQ ID NO:2.

[5] Набор для обнаружения пептида Aβ(1-17), включающий:

(i) первое антитело, которое является антителом по одному из пунктов [1]-[3], и

(ii) второе антитело, распознающее область пептида Aβ(1-17), которая отличается от области, распознаваемой первым антителом.

[6] Набор по пункту [5], в котором первое или второе антитела соединены с первым представителем связывающей пары.

[7] Набор по пункту [6], дополнительно включающий второго представителя указанной связывающей пары, причем указанный второй представитель связывающей пары соединен с выявляемой меткой.

[8] Набор по пункту [7], причем если выявляемая метка, соединенная со вторым представителем связывающей пары, является ферментной меткой, тогда набор дополнительно включает субстрат, который может быть конвертирован указанным ферментом в выявляемый продукт.

[9] Набор по одному из пунктов [5]-[8], дополнительно включающий антитело или комбинацию антител, которые специфически связываются с Аβ40 и/или Aβ42.

[10] Набор по одному из пунктов [5]-[9], дополнительно включающий плотную основу.

[11] Набор по пункту [10], в котором антитело, которое не соединено с первым представителем связывающей пары, предварительно связано с плотной основой.

[12] Набор по одному из пунктов [5]-[11], дополнительно включающий образец, содержащий пептиды Aβ17, Aβ40 и/или Aβ42.

[13] Способ определения или выявления пептида Aβ(1-17) в образце, включающий стадии:

(i) захвата пептида Aβ(1-17), имеющегося в образце, первым антителом, которое специфически связывается с указанным пептидом,

(ii) контактирования иммунных комплексов, сформированных на стадии (i), со вторым антителом, причем указанным вторым антителом является антитело по одному из пунктов [1]-[4], и указанное второе антитело распознает область, отличающуюся от области распознавания первым антителом, и соединено с первым представителем связывающей пары,

(iii) контактирования комплексов, сформированных на стадии (ii), со вторым представителем связывающей пары, соединенным с выявляемой меткой, и

(iv) выявления или обнаружения действия или количества выявляемой метки.

[14] Способ по одному из пунктов [13]-[17], в котором биологический образец выбран из группы, включающей кровь, сыворотку, плазму и СМЖ.

[15] Набор по одному из пунктов [1]-[12] или способ по пункту [13] или [14], в котором первым антителом является моноклональное антитело.

[16] Набор или способ по пункту [15], причем моноклональным антителом является антитело 6Е10.

[17] Набор или способ по одному из пунктов [1]-[16], причем указанным первым представителем связывающей пары является биотин и вторым представителем связывающей пары является авидин, стрептавидин или их функциональные эквиваленты.

[18] Набор или способ по одному из пунктов [1]-[17], причем выявляемой меткой является флуоресцентная молекула, люминесцентная молекула или фермент.

[19] Способ мониторинга нейродегенеративного заболевания у субъекта, включающий:

(а) определение в образце от указанного субъекта в первой временной точке уровня свободного пептида Aβ17 в образце плазмы и уровня пептида Aβ17, связанного с клетками в образце крови, в образце от указанного субъекта,

(б) определение в образце от указанного субъекта во второй временной точке уровня свободного пептида Aβ17 в образце плазмы и уровня пептида Aβ17, связанного с клетками в образце крови, в образце от указанного субъекта, и

(в) сравнение соотношения уровня свободного пептида Aβ17 в образце плазмы и уровня пептида Aβ17, связанного с клетками в образце крови, в указанных первой и второй временной точках,

причем если указанное соотношение повышено во второй временной точке относительно первой временной точки, это является показателем ухудшения тяжести болезни Альцгеймера у субъекта в период между указанными первой и второй временными точками.

[20] Способ по пункту [19], в котором нейродегенеративным заболеванием является болезнь Альцгеймера.

[21] Способ по одному из пунктов [19] или [20], в котором определяют уровень пептида Aβ17 методом ELISA.

[22] Способ по пункту [21], в котором определяют уровень пептида Aβ17, используя способ по одному из пунктов [13]-[18].

[23] Способ определения, болен ли субъект умеренной формой болезни Альцгеймера, включающий определение величины одного или более параметров, выбранных из группы, включающей:

(а) дополнительные величины уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови, взятом от образца указанного субъекта,

(б) дополнительные величины суммарных уровней пептидов Aβ17, Aβ40 и Aβ42 в плазме образца от указанного субъекта и уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками, в образце крови указанного субъекта,

(в) дополнительную величину суммарного уровня пептида Aβ42 в образце плазмы субъекта и уровня пептида Aβ42, связанного с клетками в образце крови субъекта,

(г) дополнительные величины суммарных уровней пептидов Aβ40 и Aβ42 в полученном от субъекта образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови субъекта, и

(д) величину соотношения между уровнем свободного пептида Aβ17 в образце плазмы указанного субъекта и пептида Aβ17, связанного с клетками в образце крови субъекта,

причем если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце здорового субъекта, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

[24] Способ определения, имеется ли у субъекта УКН с продромальной формой болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин суммарного уровня пептида Aβ42 в образце плазмы указанного субъекта, и уровня пептида Aβ42, связанного с клетками, в образце крови указанного субъекта,

(б) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в полученном от субъекта образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови указанного субъекта,

(в) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы указанного субъекта и пептида Aβ17, связанного с клетками в образце крови указанного субъекта,

(г) величины соотношения между уровнем пептида Aβ17, связанного с клетками в образце крови субъекта, и уровнем пептида Aβ42, связанного с клетками в образце крови,

(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным уровням суммарного пептида Aβ17 в образце плазмы и уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным уровням суммарного пептида Aβ42 в образце плазмы и уровню пептида Aβ42, связанного с клетками в образце крови,

(е) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине уровней пептида Aβ40, связанного с клетками в образце крови, и пептида Aβ42, связанного с клетками в образце крови, и

(ж) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровням пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

причем если величина одного или нескольких из параметров (а), (б) или (в) повышена и/или величина одного или нескольких из параметров (г), (д), (е) или (ж) снижена относительно величины тех же параметров в контрольном образце здорового субъекта, тогда у субъекта имеется УКН с продромальной формой болезни Альцгеймера.

[25] Способ, позволяющий отличить субъекта с УКН с непродромальной формой болезни Альцгеймера от субъекта с УКН с продромальной формой болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин суммарного уровней пептидов Аβ17, Aβ40 и Aβ42, связанных с клетками в образце крови, из образца указанного субъекта,

(б) величины соотношения между уровнем пептида Aβ17, связанного с клетками в образце крови субъекта, и уровнем пептида Aβ42, связанного с клетками в образце крови от указанного субъекта,

(в) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам суммарного уровня пептида Aβ42 в образце плазмы и уровня пептида Aβ42, связанного с клетками в образце крови,

(г) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ17 в образце плазмы указанного субъекта и уровня пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровням пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

причем если величина (а) повышена и/или величина одного или нескольких из параметров (б), (в), (г) или (д) снижена относительно величины тех же параметров в контрольном образце от субъекта с УКН с непродромальной формой болезни Альцгеймера, тогда у субъекта имеется УКН с продромальной формой болезни Альцгеймера.

[26] Способ, позволяющий отличить субъекта с УКН с непродромальной формой болезни Альцгеймера от субъекта с умеренной формой болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) дополнительных величин уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови,

(б) дополнительных величин суммарных уровней пептидов Aβ17, Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками в образце крови,

(в) дополнительных величин суммарного уровня пептида Aβ42 в образце плазмы и уровня пептида Aβ42, связанного с клетками в образце крови,

(г) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

(д) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,

причем если величина одного или нескольких из параметров повышена относительно величины в контрольном образце субъекта с УКН с непродромальной формой болезни Альцгеймера, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

[27] Способ, позволяющий отличить субъекта с УКН с продромальной формой болезни Альцгеймера от субъекта с умеренной формой болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:

(а) величины соотношения между уровнем свободного пептида Aβ17 в образце плазмы и уровнем свободного пептида Aβ40 в образце плазмы, и

(б) соотношения между двумя параметрами, причем первый параметр соответствует уровню свободного пептида Aβ17 в образце плазмы, и второй параметр соответствует дополнительным уровням пептидов Aβ40 и Aβ42 в образце плазмы,

причем если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце субъекта с умеренным когнитивным нарушением, тогда у субъекта имеется умеренная форма болезни Альцгеймера.

[28] Способ по одному из пунктов [23]-[27], в котором определяют уровень одного или нескольких из пептидов Aβ17, Aβ40 и Aβ42 методом ELISA.

Приводимые ниже примеры служат иллюстрацией настоящего изобретения, но никак не ограничивают его области охвата.

Примеры

Пример 1. Получение анти-Aβ17 антитела

Четырех кроликов иммунизируют следующими пептидами: VHHQKL, соответствующий Aβ(12-17) (SEQ ID NO:2), и EVHHQKL, соответствующий Aβ(11-17) (SEQ ID NO:3), двух из них иммунизируют первым пептидом и двух других - вторым. Оба пептида содержат N-концевую дополнительную аминокислоту цистеин для конъюгации.

В качестве носителя для конъюгации применяют гемоцианин моллюска блюдечка (Keyhole limpet hemocyanin - KLH) (фирма Pierce, номер в каталоге 77600). Конъюгацию проводят с применением перекрестного сшивателя NHS-PEG4-Maleimide (фирма Pierce, номер в каталоге 22104). В качестве адъювантов применяют три типа: полный адъювант Фрейнда (фирма Sigma, номер в каталоге F5881), неполный адъювант Фрейнда (фирма Sigma, номер в каталоге F5506) и инъекционные квасцы (Imject Alum, фирма Pierce, номер в каталоге 77161).

Протокол иммунизации следующий:

- Четырех кроликов иммунизируют еженедельно 100 мкг пептидов.

- Первую дозу вводят с использованием в качестве адъюванта полного адъюванта Фрейнда, затем дозу вводят в неполном адъюванте Фрейнда и третью дозу вводят с квасцами.

- После первых трех введений полученный титр антитела слишком низкий для проведения очистки. Соответственно дозу увеличивают до 200 мкг пептидов за три дополнительных введения, изменяя порядок адъювантов: полный адъювант Фрейнда - алюминиевый квасцы - неполный адъювант Фрейнда.

- Титры антител, полученных для четырех кроликов, очень высокие и проводят очистку аффинной хроматографией (с пептидом Aβ17).

Метод дот-блоттинга применяют для определения специфичности анти-Aβ17 антитела, причем включают в исследование другие пептиды Aβ(фиг.1). Анти-Aβ17 антитело вносят в двух разведениях (1:1000 и 1:2000) и вторым применяемым антителом является козье антитело anti-rabbit-HRP 1:2000. По 500 нг каждого пептида вводят в 2,5 мкл. Дот-блот анализ проводят с применением электрохемолюминесценции и метода направленного нейтронного зонда (Shielded Neutron Assay Probe - SNAP) при экспозиции 1 мин и 3 мин. Из представленной фигуры следует, что антитело высоко специфично в отношении пептида Aβ17 и специфически не распознает Aβ15, Аβ16, Aβ38, Aβ40 и Aβ42.

Пример 2. Определение пептида Aβ17 в образцах

(1) Определение методом масс-спектрометрии

Реагенты

От фирмы Sigma (Steimheim, Германия) получают муравьиную кислоту, натрий хлорид, α-циано-4-оксикоричная кислота (α-СНСА), трифторуксусная кислота (ТФУ), DL-дитиотреит (dithiothreitol - DTT), триэтаноламин, Tris и бычий сывороточный альбумин (БСА). Ацетонитрил получают от фирмы Carlo-Erba (Родано, Милан, Италия). Диметилпимелимидат·2 HCl (Dimethyl pimelimidate·2 HCl - DMP) приобретают на фирме Pierce (Рокфорд, Иллинойс, США). Трициновый буфер для образцов приобретают на фирме Bio-Rad (Геркулес, Калифорния, США).

Процедура иммунопреципитации (Immunoprecipitation - IP)

Процедуру IP-MALDI проводят согласно методу, описанному Portelius и др. (J. Proteome. Res. 6 (11), 2007, 4433-4439), с некоторыми модификациями для адаптации процедуры для анализа образцов от собак. Сначала применяют разные количества Aβ специфических антител (6Е10 и 408-специфические в отношении эпитопов Aβ в аминокислотах 4-9 и 18-22, соответственно, фирма Signet Laboratories, Inc., Dedham, Массачусетс, США) и SAR2 (специфично в отношении эпитопа анти-Aβ40 с карбокси-конца, фирма Araclon Biotech S.L., Сарагоса, Испания) для того, чтобы определить оптимальное количество каждого антитела методом вестерн-блоттинга. Процедура оптимизации включает разные стадии. Каждое антитело отдельно добавляют к 50 мкл продукта Dynabeads Protein G (фирма Invitrogen Dynal AS, Осло, Норвегия) согласно описанию производителя. Гранулы инкубируют с разными количествами антитела, промывают и затем антитела элюируют, кипятят гранулы в трициновом буфере для образцов с DTT. Насыщающее количество каждого антитела определяют методом вестерн-блоттинга.

Кроме того, также оптимизируют время инкубирования (1 ч и в течение ночи) и температуру (4°С, комнатная температура и 37°С) гранул с антителом и комплексы гранул-антитела с образцами. Другой оптимизированный параметр представляет условие элюции (0,5, 2,5 и 5% муравьиная кислота, а также несколько процентов органических растворителей, например, ацетонитрила).

В настоящем исследовании применяют два разных протокола. Первый протокол по существу основан на инструкциях производителя с оптимизированными параметрами: аликвоту специфичного в отношении Aβ антитела (4 мкг 6Е10, или 8 мкг 4G8, или 6 мкг SAR 2) инкубируют с 50 мкл Dynabeads Protein G в течение 1 ч при комнатной температуре на роторной качалке. Затем трижды промывают фосфатно-солевым буфером (ФСБ: 1 мМ NaH2PO4·H2O, 5 мМ Na2HPO4·2Н2О, 138 мМ NaCl). Добавляют 1 мл СМЖ и инкубируют в течение ночи при комнатной температуре на роторной качалке. СМЖ отдаляют от гранул после инкубирования с помощью магнита (DynaMag-2 или DynaMag-15, фирма Invitrogen Dynal AS, Осло, Норвегия) и выбрасывают. Гранулы промывают трижды 1 мл 100 мМ Tris pH=6,8 и в итоге проводят элюцию 25 мкл 5% муравьиной кислоты. Элюат инкубируют 5 мин при комнатной температуре в Thermomixer. Элюированные соединения обессоливают с помощью наконечников ZipTip C18 (фирма Millipore, Billerica, Массачусетс, США). Протокол ZipTip C18 состоит из нескольких стадий: сольватации наконечников ацетонитрилом, создавая условия с помощью 0,1% ТФУ (повторяя эту стадию несколько раз), загрузки образца (осторожным затягиванием в пипетку и выдуванием из пипетки несколько раз), промывкой 0,1% ТФУ и в итоге элюцией 3 мкл α-СНСА (5 мг/мл).

Во втором протоколе применяют цитрат-фосфатный буфер, рН 5,0 (24,5 мМ лимонная кислота, 52 мМ Na2HPO4·2Н2О) для стадий промывки и связывания вместо ФСБ. Перед элюцией гранулы промывают ФСБ вместо 100 мМ Tris pH 6,8. Данный второй протокол позволяет получать масс-спектры с меньшим фоновым шумом и с более четкими пиками; этот протокол был использован в оставшихся экспериментах.

Для иммунопреципитации образцов человека применяют 50 мкл гранул Dynabeads с антителом овцы против мыши (фирма Invitrogen Dynal AS, Осло, Норвегия). Гранулы промывают трижды ФСБ и инкубируют с оптимизированным количеством специфического антитела (8 мкг of 6E10 или 8 мкг 4G8) в течение 1 ч при комнатной температуре на роторной качалке. Затем супернатант отбрасывают, а гранулы промывают 1 мл 0,2 М триэтаноламина рН 8,2. Реакция формирования перекрестных сшивок происходит после добавления 1 мл 20 мМ DMP (гомобифункциональный агент перекрестного сшивания с аминными реакционноспособными группами (Greg Т. Hermanson, 2010) в 0,2 М триэтаноламине рН 8,2. Гранулы и антитела инкубируют в течение 30 мин при комнатной температуре, затем супернатант выбрасывают и реакцию прекращают добавлением 1 мл 50 мМ Tris pH 7,5 в течение 15 мин на роторной качалке. Перекрестно сшитые гранулы трижды промывают 1 мл ФСБ с 0,1% БСА. Добавляют 1 мл объединенной СМЖ человека и инкубируют в течение ночи при комнатной температуре. Супернатант отбрасывают, а гранулы промывают несколько раз в ФСБ. Разные типы Aβ элюируют 25 мкл 5% муравьиной кислоты. Элюированные соединения обессоливают с помощью ZipTip С18, используя тот же описанный выше протокол.

MALDI-TOF и MALDI-TOF/TOF масс-спектрометрия (MS)

Помещают 0,7 мкл элюированного образца непосредственно на мишень MALDI до полного выпаривания. Все спектры получают с помощью масс-спектрометра ABI4800 MALDI-TOF/TOF (AB/Sciex), оборудованного твердотельным лазером Nd:YAG с диодной накачкой (355 нм) с частотой 200 Гц. Для получения масс-спектра прибор работает в режиме отражателя, и все эксперименты проводят в режиме положительных ионов. Через 400 нс после облучения лазером применяют возрастающее напряжение 20 кВ. Ионы перефокусируют на двустадийный рефлектор и в итоге проводят детекцию на втором детекторе. Разницу в напряжении зеркала 2 к источнику 1 сохраняют постоянной при величине соотношения 1,105. Для получения MS/MS поддерживают напряжение источника 1 в 8 кВ, а значение лазера устанавливают на 1000 единиц выше, чем в экспериментах MS. Ионы-предшественники отбирают для фрагментации посредством Timed Ion Selector при разрешении 250 (полная ширина при половине максимума). Отобранные ионы тормозятся перед поступлением в камеру столкновения на замедлении стека и диссоциируют при столкновении с воздухом при кинетической энергии 1 keV (индуцированная столкновениями диссоциация с высокой энергией). Фрагментированные ионы заново ускоряются во втором источнике при 15 кВ после короткой задержки. Активируют Metastable Suppressor во всех экспериментах MS/MS, чтобы избежать детекции оставшихся предшествующих ионов и нежелательных фрагментов метастабильного распада. Программное обеспечение Data Explorer применяют для спектральной обработки (сглаживания и/или фильтрации шума). Рассматривают только моноизотопные соотношения m/z. Масс-спектрометр калибруют поверхностно смесью пептидов от производителя, покрывающих диапазон масс 900-4000 Да. При необходимости прибор калибруют инсулином (М+Н+=5730,609 Da).

Результаты масс-спектрометрии показаны на фиг.2 для образца спинномозговой жидкости (СМЖ) и для образца плазмы; пик, соответствующий Aβ17, показан стрелкой.

(2) Определение методом ELISA

Реагенты и растворы

- Стандарт β-амилоида 1-17 (получен от человека). Концентрация исходного раствора составляет 20 нг/мл.

- Микропланшет оптимизируют для адсорбции на его поверхности антител.

- Иммобилизованное моноклональное антитело, специфичное в отношении NH2-конца пептида Aβ человека (антитело 6Е10).

- Детекция конъюгированного поликлонального антитела-биотина, которое специфически распознает пептиды Aβ человека, оканчивающиеся на 17 аминокислоте.

- Усилитель раствора конъюгата стрептавидин-пероксидаза хрена.

- Стабилизированный хромоген ТМВ.

- Буфер для нанесения покрытия: 100 мМ Na2CO3/NaHCO3 pH 9,6.

- Буфер для промывки: 50 мМ Tris, 0,05% Tween20, 150 мМ NaCl, pH 8,0.

- Блокирующий буфер: 50 мМ tris, 0,2% Tween20, 0,5% БСА, pH 8,0.

- Раствор для хранения: 20 мг/мл трегалозы, 50 мМ tris, pH 8,0.

- Разбавитель для антител: 50 мМ tris, 0,05% БСА, 0,5М NaCl, 0,05% Tween20, pH 8,0.

- PBST: 80 мМ Na2HPO4, 20 мМ NaH2PO4, 100 мМ NaCl, 0,5% Tween20, pH 7,5.

- Разбавитель стандарт/образец: синтетический блокирующий реагент 1:100 в PBST.

- Стоп-раствор: 1 н. H2SO4.

Способ

На планшет наносят покрытие, используя моноклональное иммобилизованное антитело 6Е10, распознающее аминокислоты 1-17 в амилоидном пептиде Аβ. Применяют концентрацию в зависимости от насыщающей концентрации антитела, чтобы антитело не было ограничивающим фактором в реакции антиген-антитело. Для этой цели связывают поглощение при 450 нм с концентрацией антитела в каждой лунке путем мониторинга антитела, абсорбированного в лунке антителом Anti-Mouse IgG, конъюгированным с HRP, инкубируют при перемешивании в течение 1 ч при комнатной температуре и проводят стадию инкубирования с хромогенным субстратом с последующим торможением реакции. Выбирают концентрацию, при которой сигнал не возрастает вместе с концентрацией антитела.

После выбора насыщающей концентрации в микропланшеты вносят 100 мкл иммобилизованного антитела в буфере для покрытия и инкубируют в течение ночи при 4°С примерно 20 ч.

Затем планшеты промывают 5 раз буфером для промывки и в лунки вносят по 300 мкл блокирующего буфера. Планшеты инкубируют в течение 3 ч при комнатной температуре. Затем планшеты промывают 5 раз буфером для промывки и вносят 100 мкл раствора для хранения. Планшеты оставляют для выпаривания до тех пор, пока не появятся характерные для трегалозы белые ореолы (2-3 суток при комнатной температуре). После такой обработки планшеты могут стабильно храниться под алюминиевой фольгой при 4°С в течение двух лет.

Приготовление образцов

Образцы могут применяться неразведенными или разведенными от 1:2 до 1:10 в разбавителе Стандарт/Образец. Разведение 1:3 рекомендуют для образцов плазмы и 1:5 для образцов с клетками крови. Для точности результатов стандартные кривые и чистые контроли должны быть в тех же разбавителях или буферах, что и образцы.

Образцы для стандартной кривой Aβ17 человека (human Aβ17 - hAβ17) получают из исходного раствора 200 пг/мл пептидов Аβ17 на планшетах, покрытых моноклональным антителом 6Е10 и обработанных трегалозой. Из этих растворов производят серийные разведения 1:2 в разбавителе Стандарт/Образец для получения концентраций 200, 100, 50, 25, 12,5, 6,25 и 3,125 пг/мл. Добавляют по 100 мкл каждого образца и инкубируют в течение ночи при 4°С (или в течение 2 ч при 37°С).

Стадия обнаружения

Антителом для обнаружения является поликлональное антитело, конъюгированное с биотином, против пептида человека Aβ, заканчивающегося 17 аминокислотой 17. Конъюгация антитела с биотином происходит после стадии активации и инкубации в течение ночи при комнатной температуре в темноте. Избыток биотина инактивируют на последующей стадии. Антитело для обнаружения добавляют разведенным в разбавителе для антител. По 100 мкл вносят в каждую лунку и инкубируют в течение 1 ч в условиях перемешивания при комнатной температуре. Затем по 100 мкл пероксидазы хрена, соединенной со стрептавидином, в разведении 1/50 в разбавителе для антител (фирма SIGMA) вносят в каждую лунку и инкубируют при перемешивании в течение 1 ч при комнатной температуре. Для реакции в планшете применяют 100 мкл хромогенного субстрата ТМВ (фирма ZEU Inmunotec). Добавляют ТМВ и инкубируют в темноте 45 мин. По 50 мкл стоп-раствора добавляют в каждую лунку. Считывают поглощение при 450 нм в ридере для планшет Synergy НТ (фирма BioTek Instruments).

Количественная оценка Aβ17

Результаты могут быть подсчитаны, используя какое-либо программное обеспечение для иммуноисследований. Способом, используемым для построения кривой, является линейная регрессия и концентрацию Aβ17 подсчитывают следующим образом:

(i) Рассчитывают среднюю чистую оптическую плотность (ОП) для каждого стандартного разведения и для образцов следующим образом:

Средняя чистая ОП (нм) = Средняя связанная ОП (нм) - Средняя нулевая ОП (нм).

(ii) На графике отмечают точками среднюю чистую оптическую плотность стандартного разведения (нм) против концентраций (пг/мл) пептида Аβ, используемого в качестве стандарта. Проводят кривую по этим точкам для построения стандартной кривой.

(iii) Концентрации Аβ в образцах с неизвестной концентрацией и в контролях могут быть определены путем интерполяции по стандартной кривой.

(iv) Определяют величины концентраций для образцов, учитывая разведение каждого образца.

(v) Образцы, у которых сигналы выше 200 пг/мл стандарта, дополнительно разводят и исследуют.

Пример 3. Воспроизводимость и определение предела обнаружения и количественного предела

Для исследования воспроизводимости иммуноанализа измеряют вариабельность внутри планшета, вариабельность в рамках анализа, вариабельность между анализами в образцах плазмы и вариабельность в образцах клеток между анализами.

Вариабельность внутри планшета рассчитывают путем анализа различий между лунками в трех повторностях в образцах, стандартных образцах и контрольных образцах в одном и том же планшете. Для определения воспроизводимости в рамках анализа определяют и сравнивают концентрацию для 4 контрольных образцов плазмы, исследуемых в 11 разных планшетах в одном анализе. Для определения вариабельности в образцах плазмы при сопоставлении анализов измеряют различия в установленных концентрациях при анализе двух образцов плазмы в двух разных и независимых исследованиях. Вариабельность в образцах клеток при сопоставлении анализов относится к сравнению уровней Aβ17 между двумя разными и независимыми определениями 8 контрольных образцов клеток.

Полученные результаты представлены в табл.1.

Таблица 1
Вариабельность внутри планшета (%) 5,11
Вариабельность в рамках анализа (%) 11,50
Вариабельность образцов плазмы при сопоставлении анализов (%) 9,51
Вариабельность образцов клеток при сопоставлении анализов (%) 21,55

Предел обнаружения (ПО) и количественный предел (КП) рассчитывают двумя разными способами:

(а) Способ 1:

ПО = концентрацияконтроль + 3σ контроль

КП = концентрацияконтроль + 10σ контроль

(б) Способ 2:

ПО = 3,3 σ контроль/m

КП = 10σ контроль/m

где σ контроль означает стандартное отклонение контроля и m означает наклон линии калибровки.

Полученные обоими способами предел обнаружения (ПО) и количественный предел (КП) представлены в табл.2.

Таблица 2
Способ 1 Способ 2
Предел обнаружения (пг/мл) 21,883 2,914
Количественный предел (пг/мл) 21,904 8,830

Пример 4. Корреляция между диагнозом БА и уровнями Aβ17/Аβ40/Aβ42

Уровни Aβ17, Aβ40 и Aβ42 определяют, используя метод сэндвич-ELISA, описанный в примере 1 в образцах плазмы из группы контрольных здоровых субъектов старше 65 лет (19 субъектов), из группы субъектов с умеренной формой болезни Альцгеймера (умеренная БА) (17 субъектов), из группы субъектов с продромальным или предполагаемым умеренным когнитивным нарушением (УКН) (16 субъектов) и из группы субъектов с непродромальным или возможным умеренным когнитивным нарушением (УКН) (16 субъектов). Концентрации в пг/мл, полученные для пептидов, показаны в таблицах фиг.3А, фиг.4А, фиг.5А и фиг.6А.

Уровни пептидов Aβ17, Aβ40 и Aβ42 в плазме (суммарный пептид в плазме + пептид, связанный с клетками) (ПК (17+40+42)) у субъектов с умеренной формой БА существенно отличаются как от уровней у контрольных здоровых субъектов и субъектов с возможной УКН, так и от уровней у непродромальных субъектов относительно субъектов с умеренной формой болезни Альцгеймера. Однако пул маркерных пептидов в крови (ПК (17+40+42)) не отличаются у здоровых контрольных субъектов старше 65 лет и у субъектов с предполагаемой УКН, но ПК (40+42) отличается существенно (фиг.3Б).

Другими значимыми измеряемыми параметрами, на основании которых можно различать группы, являются следующие (фиг.3, 4, 5 и 6):

- Уровни пептидов Aβ17, Aβ40 и Aβ42, связанных с клетками (СК (17+40+42)). На фиг.3 показано, что уровни этих пептидов, связанных с клетками, выше у субъектов с предполагаемой УКН и у субъектов с умеренной формой БА, в отличие от субъектов с возможной УКН и от здоровых субъектов. Можно отличить с высокой достоверностью здоровых субъектов от субъектов с умеренной формой БА, возможной УКН и предполагаемой УКН, и субъектов с возможной УКН от субъектов с умеренной формой БА.

- Суммарные уровни пептидов Aβ42 в плазме + уровни пептида Aβ42, связанного с клетками (ОП42+СК42). Из фиг.3 следует, что уровни этих маркеров выше у субъектов с предполагаемой УКН и с умеренной формой БА по сравнению с субъектами с возможной УКН и со здоровыми субъектами. Можно отличить с высокой достоверностью здоровых субъектов от субъектов с умеренной формой БА и субъектов с возможной УКН от субъектов с умеренной формой БА.

- Суммарные уровни пептида Aβ40 в плазме добавляют к уровням пептида Aβ40, связанного с клетками (ОП40+СК40). Из фиг.3 следует, что уровни этих маркеров выше у субъектов с предполагаемой УКН и у субъектов с умеренной формой БА по сравнению с субъектами с возможной УКН и со здоровыми субъектами. Можно отличить с высокой достоверностью возможную УКН от умеренной формы БА.

- Соотношение между уровнями свободного пептида Aβ17 в плазме и уровнями свободного пептида Aβ40 в плазме (СП 17/40) позволяет отличить предполагаемое УКН от умеренной формы БА (фиг.4).

- Соотношение между уровнями пептида Aβ17, связанного с клетками, и уровнями пептида Aβ42, связанного с клетками (СВ 17/42), позволяет отличить здоровых субъектов или субъектов с возможной УКН от субъектов с предполагаемой УКН (фиг.4).

- Соотношение между суммарными уровнями пептида Aβ17 в плазме + уровнями пептида Aβ17, связанного с клетками, и суммарными уровнями пептида Aβ42 в плазме, дополнительными к уровням пептида Aβ42, связанного с клетками (ОП17+СВ17/ОП42+СВ42), позволяет отличить здоровых субъектов или субъектов с возможной УКН от субъектов с предполагаемой УКН (фиг.4).

- Соотношение между уровнями свободного пептида Aβ17 в плазме и уровнями свободных пептидов Aβ40 и Aβ42 в плазме (СП17/СП40+СП42) позволяет отличить субъектов с предполагаемой УКН от субъектов с умеренной БА (фиг.5).

- Соотношение между уровнями пептида Aβ17, связанного с клетками, и уровнями пептидов Aβ40 и Aβ42, связанных с клетками (СК17/СВ40+СК42), позволяет отличить здоровых субъектов или субъектов с возможной УКН от субъектов с предполагаемой УКН, и здоровых субъектов от субъектов с умеренной формой БА (фиг.5).

- Соотношение между суммарными уровнями пептида Aβ17 в плазме + уровнями пептида Aβ17, связанного с клетками, и суммарными уровнями пептидов Aβ40 и Aβ42 в плазме (ПК (40+42)) позволяет отличить здоровых субъектов или субъектов с возможной УКН от субъектов с предполагаемой УКН (фиг.5).

- Соотношение между уровнями свободного пептида Aβ17 в плазме и уровнями пептида Aβ17, связанного с клетками (СП17/СК17), позволяет отличить здоровых субъектов или субъектов с возможной УКН от субъектов с умеренной формой БА и здоровых субъектов от субъектов с предполагаемой УКН (фиг.6). Статистический анализ (U-критерий Манна-Уитни) всех соотношений Aβ17 показывает статистически значимые различия только с уровнями маркерного свободного пептида Aβ17 в плазме/уровней пептида Aβ17, связанного с клетками (СП17/СК17) (см. табл.3).

Подобным образом есть связь между соотношением уровней свободного пептида Aβ17 в плазме и уровней пептида Aβ17, связанного с клетками, с развитием БА. Чем более продвинута стадия когнитивного нарушения, тем выше уровень свободного пептида Aβ17 в плазме, и таким образом также выше соотношение уровней свободного пептида Aβ17 в плазме и уровней пептида Aβ17, связанного с клетками (СП17/СК17).

Таблица 3
СП17/ОП17 ОП17/СК17 СП17/СК17 СП17/ПК17 ОП17/ПК17 СК17/ПК17
Здоровые субъекты старше 65 лет против субъектов с возможной УКН 0,313 0,987 0,296 0,282 0,987 0,987
Здоровые субъекты старше 65 лет против субъектов с предполагаемой УКН 0,169 0,608 0,020 0,082 0,608 0,608
Здоровые субъекты старше 65 лет против субъектов с умеренной формой БА 0,113 0,296 <0,001 0,004 0,296 0,296
Возможная УКН против предполагаемой УКН 0,749 0,720 0,109 0,462 0,720 0,720
Возможная УКН против умеренной формы БА 0,615 0,397 0,002 0,075 0,397 0,397
Предполагаемая УКН против умеренной формы БА 0,815 0,439 0,228 0,288 0,439 0,439

1. Способ определения пептида Aβ(1-17) в образце, включающий стадии:
(i) захвата содержащегося в образце пептида Aβ(1-17) первым антителом, которое специфически связывается с указанным пептидом,
(ii) контакта иммунных комплексов, сформированных на стадии (i), со вторым антителом, где указанное второе антитело распознает область, отличную от области, распознаваемой первым антителом, и соединено с первым членом связывающей пары,
(iii) контакта комплексов, сформированных на стадии (ii), со вторым членом связывающей пары, который соединен с выявляемой меткой, и
(iv) определения действия или уровня пептида на основании количества выявляемой метки.

2. Способ по п. 1, в котором образец выбран из группы, включающей кровь, сыворотку, плазму и цереброспинальную жидкость.

3. Способ мониторинга болезни Альцгеймера у субъекта, включающий:
(a) определение в образце, полученном от указанного субъекта в первой временной точке, уровня свободного пептида Aβ(1-17) в образце плазмы и уровня пептида Aβ(1-17), связанного с клетками в образце крови из образца указанного субъекта,
(б) определение в образце, полученном от указанного субъекта во второй временной точке, уровня свободного пептида Aβ(1-17) в образце плазмы и уровня пептида Aβ(1-17), связанного с клетками в образце крови из образца указанного субъекта,
(в) сравнение соотношения уровня свободного пептида Aβ(1-17) в образце плазмы и уровня пептида Aβ(1-17), связанного с клетками в образце крови, в указанные первую и вторую временную точки,
причем определение уровней пептида Aβ(1-17) осуществляют, используя способ по одному из пп. 1 или 2, а повышение указанного соотношения во второй временной точке относительно первой временной точки означает усугубление болезни Альцгеймера между первой и второй временной точками.

4. Способ определения, имеется ли у субъекта умеренная форма болезни Альцгеймера, который включает определение величины одного или нескольких параметров, выбранных из группы, состоящей из:
(а) дополнительных величин уровней пептидов Aβ(1-17), Aβ40 и Aβ42, связанных с клетками в образце крови из образца указанного субъекта,
(б) дополнительных величин суммарных уровней пептидов Aβ(1-17), Aβ40 и Aβ42 в плазме образца от указанного субъекта и уровней пептидов Aβ(1-17), Aβ40 и Aβ42, связанных с клетками в образце крови от указанного субъекта,
(в) дополнительных величин суммарных уровней пептидов Aβ40 и Aβ42 в образце плазмы субъекта и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови субъекта, и
(г) величины соотношения между уровнем свободного пептида Aβ(1-17) в образце плазмы указанного субъекта и пептида Aβ(1-17), связанного с клетками в образце крови субъекта,
причем определение уровней пептида Aβ(1-17) осуществляют, используя способ по одному из пп. 1 или 2, и если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце здорового субъекта, тогда у этого субъекта имеется умеренная форма болезни Альцгеймера.

5. Способ определения, имеется ли у субъекта умеренное когнитивное нарушение (УКН) с продромальной формой болезни Альцгеймера, включающий определение величины одного или нескольких параметров, выбранных из группы, состоящей из:
(а) величины соотношения между уровнем свободного пептида Aβ(1-17) в образце плазмы указанного субъекта и пептида Aβ(1-17), связанного с клетками в образце крови указанного субъекта,
(б) величины соотношения между уровнем пептида Aβ(1-17), связанного с клетками в образце крови субъекта, и уровнем пептида Aβ42, связанного с клетками в образце крови,
(в) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным уровням суммарного пептида Aβ(1-17) в образце плазмы и уровню пептида Aβ17, связанного с клетками в образце крови, и второй параметр соответствует дополнительным уровням суммарного пептида Aβ42 в образце плазмы и уровню пептида Aβ42, связанного с клетками в образце крови,
(г) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ(1-17), связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине уровней пептида Aβ40, связанного с клетками в образце крови, и пептида Aβ42, связанного с клетками в образце крови, и
(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ(1-17) в образце плазмы указанного субъекта и уровня пептида Aβ(1-17), связанного с клетками в образце крови, и второй параметр соответствует дополнительной величине суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровням пептидов Aβ40 и Aβ42, связанных с клетками в образце крови, причем определение уровней пептида Aβ(1-17) осуществляют, используя способ по одному из пп. 1 или 2, и если величина одного или нескольких из параметров (а) повышена и/или величина одного или нескольких из параметров (б), (в), (г) или (д) понижена относительно величины тех же параметров в контрольном образце здорового субъекта, тогда у этого субъекта имеется УКН с продромальной формой болезни Альцгеймера.

6. Способ определения, имеется ли у субъекта УКН с продромальной формой болезни Альцгеймера, включающий определение величины одного или нескольких параметров, выбранных из группы, состоящей из:
(а) дополнительных величин уровней пептидов Aβ(1-17), Aβ40 и Aβ42, связанных с клетками в образце крови от образца указанного субъекта,
(б) величины соотношения между уровнем пептида Aβ(1-17), связанного с клетками в образце крови субъекта, и уровнем пептида Aβ42, связанного с клетками в образце крови указанного субъекта,
(в) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ(1-17) в образце плазмы указанного субъекта и уровня пептида Aβ(1-17), связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровня суммарного пептида Aβ42 в образце плазмы указанного субъекта и уровня пептида Aβ42, связанного с клетками в образце крови,
(г) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ(1-17), связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,
(д) величины соотношения между двумя параметрами, причем первый параметр соответствует дополнительным величинам уровня суммарного пептида Aβ(1-17) в образце плазмы указанного субъекта и уровня пептида Aβ(1-17), связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней суммарных пептидов Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови,
причем определение уровней пептида Aβ(1-17) осуществляют, используя способ по одному из пп. 1 или 2, и если величина (а) повышена и/или величина одного или нескольких из указанных параметров (б), (в), (г) и (д) понижена относительно величины тех же параметров в контрольном образце субъекта с УКН с непродромальной формой болезни Альцгеймера, тогда у этого субъекта имеется УКН с продромальной формой болезни Альцгеймера.

7. Способ определения, имеется ли у субъекта умеренная форма болезни Альцгеймера, включающая определение величины одного или нескольких параметров, выбранных из группы, состоящей из:
(а) дополнительных величин уровней пептидов Aβ(1-17), Aβ40 и Aβ42, связанных с клетками в образце крови,
(б) дополнительных величин суммарных уровней пептидов Aβ(1-17), Aβ40 и Aβ42 в образце плазмы и уровней пептидов Aβ(1-17), Aβ40 и Aβ42, связанных с клетками в образце крови,
(в) величины соотношения между двумя параметрами, причем первый параметр соответствует уровню пептида Aβ(1-17), связанного с клетками в образце крови, и второй параметр соответствует дополнительным величинам уровней пептидов Aβ40 и Aβ42, связанных с клетками в образце крови, и
(г) величины соотношения между уровнем свободного пептида Aβ(1-17) в образце плазмы и уровнем пептида Aβ(1-17), связанного с клетками в образце крови,
причем определение уровней пептида Aβ(1-17) осуществляют, используя способ по одному из пп. 1 или 2, и если величина одного или нескольких из указанных параметров повышена относительно величины тех же параметров в контрольном образце субъекта с УКН с непродромальной формой болезни Альцгеймера, тогда у этого субъекта имеется умеренная форма болезни Альцгеймера.

8. Способ определения, имеется ли у субъекта умеренная форма болезни Альцгеймера, включающий определение величины одного или нескольких параметров, выбранных из группы, состоящей из:
(а) величины соотношения между уровнем свободного пептида Aβ(1-17) в образце плазмы и уровнем свободного пептида Aβ40 в образце плазмы, и
(б) соотношения между двумя параметрами, причем первый параметр соответствует уровню свободного пептида Aβ(1-17) в образце плазмы, и второй параметр соответствует дополнительным уровням свободных пептидов Aβ40 и Aβ42 в образце плазмы;
причем определение уровней пептида Aβ(1-17) осуществляют, используя способ по одному из пп. 1 или 2, и если величина одного или нескольких из указанных параметров повышена относительно величин тех же параметров в контрольном образце от субъекта с продромальным умеренным когнитивным нарушением, тогда у этого субъекта имеется умеренная форма болезни Альцгеймера.



 

Похожие патенты:

Настоящее изобретение относится к области медицины и биотехнологии. Предложен способ ингибирования метастазирования G-CSF секретирующей первичной опухоли in vivo.

Изобретение относится к области биохимии, в частности к лекарственному средству для лечения или профилактики рака, содержащему антитело в качестве активного ингредиента, которое обладает иммунологической реактивностью по отношению к белку CAPRIN-1.

Настоящее изобретение относится к области биотехнологии. Предложено гуманизированное антитело и его фрагмент, способные специфически связывать бета-амилоид, охарактеризованные фрагментами последовательностей на основе антитела мыши 8F5, и Fc-областью человеческого IgG1, содержащей аминокислотную замену D265A; а также кодирующая нуклеиновая кислота, вектор экспрессии, продуцирующие антитело или его фрагмент клетки, способ продуцирования антитела или его фрагмента; композиция, применение антитела и его фрагмента для изготовления лекарственного средства, способ предупреждения, лечения или облегчения эффектов амилоидоза; способ диагностики амилоид-ассоциированных заболеваний или состояний, способ определения степени нагрузки амилоидогенных бляшек и тест-набор для выявления и диагностики амилоид-ассоциированных бляшек.

Изобретение относится к биохимии. Описаны способы определения наличия или метастазов опухоли, скрининга наличия опухоли среди популяции высокого риска, прогноза для пациента, имеющего опухоль, определения эффективности хирургического вмешательства, радиационной терапии или химиотерапии.

Изобретение относится к биохимии. Описано моноклональное антитело или его антигенсвязывающий фрагмент с очень высокой иммуносупрессивной активностью, которое связывается с пептидом, содержащим аминокислотную последовательность SSVLYGGPPSAA, или с конъюгатом данного пептида с фармацевтически приемлемым носителем, где моноклональное антитело или его антигенсвязывающий фрагмент имеет более высокую аффинность связывания с коровым гистоном, чем с гистоном H1.

Настоящее изобретение относится к биотехнологии. Предложены варианты антител против Bv8 человека или макака, каждое из которых характеризуется тем, что содержит 6 CDR.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к способу получения иммуноглобулинов подкласса IG1 и IG4 из супернатантов культивированных клеток. За счет подведения значения рН в кислую сторону и последующего инкубирования закисленного раствора нуклеиновые кислоты и белки клетки хозяина могут преципитировать, но искомый полипептид остается в растворе.

Изобретение относится к биохимии. Описаны антитела и их фрагменты, обладающие высокой аффинностью по отношению к человеческим α-синуклеиновым протофибриллам и низкой способностью к связыванию с α-синуклеиновыми мономерами.

Изобретение относится к области биотехнологии, а именно к способу разделения лактоферринов человека и козы. Способ включает иммуноафинную хроматографию с использованием мини-антител a-hLF-1 и a-hLF-4, аминокислотные последовательности которых представлены как SEQ ID NO:1 и SEQ ID NO:2.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены варианты антитела или его эпитоп-связывающего фрагмента, специфичных в отношении бета-амилоидного пептида 1-40. Каждый из вариантов характеризуется тем, что включает области VH и VL, либо 6 CDR из лёгкой и тяжёлой цепи. Описаны: кодирующая НК; варианты депонированных линий клеток (гибридом) с коллекционными номерами DSM ACC2844, DSM ACC2845, DSM ACC2846 и линия клеток, включающая указанный полинуклеотид, для получения антитела. Предложены: терапевтическая композиция для лечения заболеваний или расстройств, вызванных или связанных с амилоидом или амилоидоподобными белками, и набор для обнаружения амилоидного белка в биологическом образце, - использующие антитело. Раскрыты варианты способа получения антитела: с использованием гибридом или кодирующей НК. Описаны: способ диагностирования предрасположенности к заболеванию или состоянию, связанному с амилоидозом; способ определения степени нагрузки амилоидогенными бляшками в ткани; способ мониторинга минимального остаточного заболевания, связанного с амилоидом; способ прогнозирования восприимчивости субъекта; способ лечения или облегчения заболеваний, связанных с амилоидозом; способ снижения количества бляшек или их нагрузки в мозге; способ снижения общего количества растворимого белка амилоида и способ сохранения или повышения когнитивного объема памяти субъекта - использующие антитело или его эпитоп-связывающий фрагмент. Описаны варианты применения антитела или его эпитоп-связывающего фрагмента для приготовления лекарственного средства. Предложенные изобретения обеспечивают новые антитела, что может найти применение в терапии и диагностике болезни Альцгеймера и других перечисленных амилоидозов. 28 н. и 26 з.п. ф-лы, 20 ил., 13 табл., 3 пр.

Изобретение относится к биохимии. Описаны способы диагностики глазного заболевания, диагностики или определения предрасположенности к глазному заболеванию, мониторинга минимального остаточного глазного заболевания. Способы включают использование высокоспецифических и высокоэффективных антител, которые специфически распознают и связывают специфические эпитопы из диапазона β-амилоидных белков. Изобретение может быть использовано для глазных заболеваний, ассоциированных с патологическими нарушениями/изменениями тканей зрительной системы, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы. 3 н. и 41 з.п. ф-лы, 20 ил., 7 табл., 18 пр.

Изобретение относится к области биохимии, в частности к способам получения гликозилированного конъюгата молекулы с повторяющимся мотивом для связывания с антителом, включающим стадии: 1) получение клеток; 2) культивирование клеток; 3) выделение гликозилированного конъюгата молекулы с повторяющимся мотивом из клеток; 4) необязательную очистку выделенного гликозилированного конъюгата молекулы с повторяющимся мотивом. Изобретение позволяет снижать содержание побочных продуктов при получении гликозилированного конъюгата молекулы с повторяющимся мотивом. 2 н. и 3 з.п. ф-лы, 19 ил., 7 пр.

Изобретение относится к иммунологии. Предложено гуманизированное антитело против Аβ-олигомера, которое не связывается с Аβ-мономерами, характеризующееся наличием вариабельной области тяжелой цепи и вариабельной области легкой цепи. Описаны: средство против когнитивной дисфункции, лекарственный препарат для лечения болезни Альцгеймера, средство для подавления образования сенильных бляшек и ингибитор образования β-амилоидных волокон, содержащие гуманизированное антитело в качестве активного ингредиента. Предложены также: способ профилактики и/или лечения болезни Альцгеймера и способ подавления прогрессирования болезни Альцгеймера, включающие стадию введения гуманизированного антитела. Описан способ получения антитела с помощью рекомбинантного вектора с ДНК, кодирующей гуманизированное антитело, путем культивирования трансформанта с образованием и накоплением гуманизированного антитела в культуре. Использование изобретения обеспечивает новое гуманизированное антитело против Аβ-олигомера, которое не связывается с Аβ-мономерами, что может найти применение в медицине. 9 н.п. ф.-лы, 3 ил., 1 табл., 3 пр.

Предложенное изобретение относится к иммунологии. Предложено антитело, которое специфически связывается с альфа-синуклеином человека, содержащее зрелые вариабельные области тяжелой и легкой цепей с соответствующими аминокислотными последовательностями. Раскрыта фармацевтическая композиция для лечения или профилактики заболевания с тельцами Леви, содержащая эффективное количество антитела. Использование изобретения обеспечивает новое антитело, которое специфично связывается с человеческим альфа-синуклеином и может быть использовано для иммунотерапии заболевания с тельцами Леви. 2 н. и 3 з.п. ф-лы, 6 ил., 4 табл., 4 пр.

Изобретение относится к биохимии. Представлены гуманизированные антитела анти-IL-4 и анти-IL-13 и их фрагменты, которые специфическим образом связываются с IL-4 и IL-13. Изобретение также включает использование антител для лечения или профилактики заболеваний или нарушений, опосредованных IL-4 и (или) IL-13, в том числе аллергической астмы и дерматита. 22 н. и 10 з.п. ф-лы, 2 ил., 8 табл., 8 пр.

Изобретение относится к области иммунологии. Предложено моноклональное антитело, способное специфически связываться с молекулой С3 комплемента человека с экспонированной тиоэфирной связью, и штамм гибридомы мыши РККК(П)764Д. Антитело по настоящему изобретению блокирует альтернативный путь активации комплемента и может найти дальнейшее применение в создании антител, пригодных для клинического применения. 2 н. и 2 з.п. ф-лы, 5 ил., 1 табл., 3 пр.

Настоящее изобретение относится к области иммунологии и биотехнологии. Предложены антитела к А2 домену тенасцина-С (TNC A2), а также выделенный полинуклеотид, вектор экспрессии, клетка-хозяин и способы получения антитела по изобретению. Кроме того, рассмотрена фармацевтическая композиция и применение антитела по изобретению для изготовления или производства лекарственного средства, в том числе применяемого для лечения заболевания, характеризующегося экспрессией TNC А2 или для индукции цитолиза опухолевой клетки или стромальной опухолевой клетки. Данное изобретение может найти дальнейшее применение в терапии и диагностике различных заболеваний, связанных с TNC А2. 11 н. и 25 з.п. ф-лы, 8 ил., 8 табл., 11пр.

Изобретение относится к области биотехнологии, генной и белковой инженерии. Предложены рекомбинантный полипептид, имеющий специфические иммуногенные свойства изоформ Oct-1, содержащий N-концевой участок Oct-1A человека, линкер и 6 остатков гистидина; а также способ получения поликлональных антител против изоформ Oct-1 с использованием такого полипептида. Полилипептид имеет последовательность MADGGAASQDESSAAAAAAADSRMNNPSETSKPSMESGDGNTGTQTNGLDFQK QPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPS QPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQ HSASQQHGAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQAFH ННННН. Данное изобретение позволяет получить антитела, связывающие изоформы Oct-1A, Oct-1L и Oct-1B человека, и, кроме того, могут быть использованы для получения антител, обладающих высокой аффинностью и специфичностью с другими изоформами Oct-1. 2 н.п. ф-лы, 6 ил.
Наверх