Антитела против нейропилина и способы их применения



Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения
Антитела против нейропилина и способы их применения

 


Владельцы патента RU 2571226:

ДЖЕНЕНТЕК, ИНК. (US)

Изобретения относятся к области биохимии. Описана группа изобретений, включающая выделенное антитело или его фрагмент, связывающееся с нейропилином 1 (варианты), способ получения антитела или его фрагмента, выделенная нуклеиновая кислота, кодирующая вышеуказанное антитело или его фрагмент, клетка-хозяин для экспрессии вышеуказанного антитела или его фрагмента, иммуноконъюгат, содержащий антитело или его фрагмент, способ обнаружения нейропилина 1. В одном варианте антитело содержит HVR-H1 с аминокислотной последовательностью SEQ ID NO: 3, HVR-H2 с SEQ ID NO: 4, HVR-H3 с SEQ ID NO: 5, HVR-L1 с SEQ ID NO: 8, HVR-L2 с SEQ ID NO: 9, и HVR-L3 с SEQ ID NO: 10. В другом варианте антитело содержит последовательности VH SEQ ID NO: 2 и VL SEQ ID NO: 7. Изобретение расширяет арсенал антител, связывающихся с нейропилином 1 (NRP1). 7 н. и 5 з.п. ф-лы, 2 ил., 1 табл., 2 пр.

 

РОДСТВЕННЫЕ ЗАЯВКИ

По настоящей заявке испрашивается приоритет предварительной заявки на патент США № 61/363121, поданной 9 июля 2010, описание которой в полном объеме включено в настоящий документ в качестве ссылки для любой цели.

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Настоящее изобретение относится к антителам против нейропилина и способам их применения.

ПРЕДПОСЫЛКИ СОЗДАНИЯ ИЗОБРЕТЕНИЯ

Нейропилин 1 (NRP1) является многофункциональным рецептором, который вносит вклад в развитие нервной и сердечнососудистой систем. Сначала NRP1 был описан как рецептор, который связывает лиганд семафорин 3A, действуя вместе с корецепторами плексинами для регулирования аксонального наведения (He and Tessier-Lavigne, Cell (1997) 90: 739-751). Позже было установлено, что NRP1 также связывает члены семейства лигандов факторов роста эндотелия сосудов (VEGF) для посредничества в развитии сосудов (Soker et al., Cell (1998) 92:735-45; Kawasaki et al., Development (1999) 126:4895-902). Кроме того, в результате нескольких исследований было сделано предположение о роли NRP1 в биологии опухолей в результате регулирования функций клеток сосудов и/или опухолевых клеток (Bielenberg et al., Exp Cell Res (2006) 312: 584-93).

Pan и др. (J. Biol Chem (2007) 282:24049-56) установили, что моноклональное антитело, которое связывается с NRP1, уменьшает VEGF-опосредованную миграцию эндотелиальных клеток in vitro (см. также публикацию PCT-заявки № WO2007/056470). Блокирование взаимодействия VEGF с NRP1 in vivo уменьшало ангиогенез и ремоделирование сосудов. Антитело против NRP1 в качестве единственного средства замедляло рост опухоли; предполагают, что это обусловлено опосредуемым антителом против NRP1 уменьшением прорастания сосудов благодаря VEGF-зависимому процессу. Антитело против NRP1 усиливало антиангиогенные и противоопухолевые эффекты блокировки VEGF с помощью антитела против VEGF. Эти данные указывают на то, что в результате уменьшения ремоделирования сосудов с помощью антитела против NRP1 сосуды, вероятно, сохраняют более незрелый фенотип. Поскольку незрелые сосуды, как полагают, являются более VEGF-зависимыми, может повыситься чувствительность кровеносных сосудов в подвергнутых лечению антителом против NRP1 опухолях к терапии с использованием антитела против VEGF, тем самым приводя к эффективности комбинированной терапии в моделях опухолей при объединении обеих терапий (Pan et al., Cancer Cell (2007) 11: 53-67). Принимая во внимание роль NRP1 в ангиогенезе, желательны дополнительные средства для обнаружения NRP1.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к антителам против NRP1 и способам их применения. В одном из вариантов осуществления настоящее изобретение относится к выделенному антителу, которое связывается с нейропилином 1 (NRP1), где антитело содержит (a) HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:3, (b) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:4, и (c) HVR-H3, содержащий аминокислотную последовательность SEQ ID NO:5. В некоторых вариантах осуществления антитело, кроме того, содержит (a) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:8; (b) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:9, и (c) HVR-L3, содержащий аминокислотную последовательность SEQ ID NO:10.

Также изобретение относится к выделенному антителу, которое связывается с нейропилином 1 (NRP1), где антитело содержит (a) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:8; (b) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:9; и (c) HVR-L3, содержащий аминокислотную последовательность SEQ ID NO:10.

В другом варианте осуществления настоящее изобретение относится к выделенному антителу, которое связывается с нейропилином 1 (NRP1), где антитело содержит (a) последовательность VH, которая по крайней мере на 95% идентична аминокислотной последовательности SEQ ID NO:2; (b) последовательность VL, которая по крайней мере на 95% идентична аминокислотной последовательности SEQ ID NO:7; или (c) последовательность VH как в (a) и последовательность VL как в (b). В некоторых вариантах осуществления антитело содержит последовательность VH SEQ ID NO:2. В некоторых вариантах осуществления антитело содержит последовательность VL SEQ ID NO:7. Также изобретение относится к выделенному антителу, которое связывается с нейропилином 1 (NRP1), где антитело содержит последовательность VH SEQ ID NO:2 и последовательность VL SEQ ID NO:7.

В некоторых вариантах осуществления антитело по настоящему изобретению представляет собой антитело изотипа IgG1. В некоторых вариантах осуществления антитело является фрагментом антитела, который связывает нейропилин, например, антителом, в котором отсутствует Fc-часть, структурой в виде F(ab')2, Fab или Fv. В другом аспекте настоящее изобретение относится к иммуноконъюгату, содержащему любое антитело по настоящему изобретению.

Настоящее изобретение также относится к выделенной нуклеиновой кислоте, кодирующей любое антитело против NRP1 по настоящему изобретению. В одном из вариантов осуществления изобретение относится к вектору, содержащему нуклеиновую кислоту. В одном из вариантов осуществления изобретение относится к клетке-хозяина, содержащей этот вектор или содержащей эту нуклеиновую кислоту. В одном из вариантов осуществления клетка-хозяин является эукариотической. В одном из вариантов осуществления клеткой-хозяином является клетка CHO. В одном из вариантов осуществления изобретение относится к способу получения антитела против NRP1, предусматривающему культивирование клетки-хозяина в условиях, подходящих для экспрессии нуклеиновой кислоты, кодирующей антитело, так что продуцируется антитело. В некоторых вариантах осуществления способ, кроме того, предусматривает выделение антитела, полученного с помощью этих способов.

В одном из аспектов изобретение относится к способу обнаружения NRP1 в биологическом образце, который предусматривает приведение биологического образца в контакт с антителом по настоящему изобретению в условиях, при которых возможно связывание антитела с NRP1, и обнаружение связанного антитела, например, путем определения образуется ли комплекс между антителом и NRP1. Таким образом, в настоящем описании описано антитело по настоящему изобретению, использующееся для обнаружения NRP1 в биологическом образце. В некоторых вариантах осуществления обнаружение NRP1 проводят иммуногистохимическим исследованием.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фиг. 1A-D представлены результаты иммуногистохимического исследования, используя моноклональное антитело против NRP1 -7130 (1A: клетки HEK-293, трансфицированные полноразмерным NRP1 человека (положительный контроль); 1B: клетки HEK-293, трансфицированные пустым вектором (отрицательный контроль); 1C: срез ткани почки; 1D: срез ткани плаценты).

На фиг. 2A-C представлены результаты иммуногистохимического исследования, используя моноклональное антитело против NRP1 -7130 (2A: срез ткани пациента с колоректальным раком (CRC); 2B: срез ткани пациента с раком молочной железы (BC); 2C: срез ткани пациента с немелкоклеточным раком легкого (NSCLC)).

ПОДРОБНОЕ ОПИСАНИЕ ВАРИАНТОВ ОСУЩЕСТВЛЕНИЯ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ

I. ОПРЕДЕЛЕНИЯ

Для целей настоящего изобретения «акцепторная каркасная область человека» представляет собой каркасную область, содержащую аминокислотную последовательность каркасной области вариабельного домена легкой цепи (VL) или каркасной области вариабельного домена тяжелой цепи (VH), полученную из каркасной области иммуноглобулина человека или консенсусной каркасной области человека, определенной ниже. Акцепторная каркасная область человека, «полученная из» каркасной области иммуноглобулина человека или консенсусной каркасной области человека, может содержать ту же самую аминокислотную последовательность, или она может содержать изменения аминокислотной последовательности. В некоторых вариантах осуществления число аминокислотных замен равно 10 или менее, 9 или менее, 8 или менее, 7 или менее, 6 или менее, 5 или менее, 4 или менее, 3 или менее, или 2, или менее. В некоторых вариантах осуществления последовательность акцепторной каркасной области VL человека идентична последовательности каркасной области VL иммуноглобулина человека или консенсусной последовательности каркасной области человека.

«Аффинность» относится к силе общей суммы нековалентных взаимодействий между одним сайтом связывания молекулы (например, антитела) и ее партнером по связыванию (например, антигеном). Кроме особо оговоренных случаев, используемый в настоящем описании термин «аффинность связывания» относится к присущей аффинности связывания, которая отражает взаимодействие в соотношении 1:1 между членами связывающейся пары (например, антителом и антигеном). Аффинность молекулы Х к ее партнеру Y может быть обычно представлена с помощью константы диссоциации (Kd). Аффинность можно измерить с помощью обычных способов, известных в данной области техники, включающих те, которые описаны в настоящем описании. Конкретные иллюстративные и приводимые в качестве примера варианты измерения аффинности связывания описываются ниже.

Антитело с «созревшей аффинностью» относится к антителу с одним или несколькими изменениями в одном или нескольких гипервариабельных участках (HVR) по сравнению с родительским антителом, в котором нет таких изменений, при этом такие изменения приводят к повышению аффинности антитела к антигену.

Термины «антитело против нейропилина 1», «антитело против NRP1» и «антитело, которое связывается с NRP1» относятся к антителу, которое способно к связыванию NRP1 с достаточной аффинностью, так что антитело применимо в качестве диагностического и/или терапевтического средства для воздействия на NRP1. В одном из вариантов осуществления величина связывания антитела против NRP1 с неродственным, не являющимся NRP1 белком составляет менее чем приблизительно 10% от связывания антитела с NRP1, как определено, например, с помощью радиоиммуноанализа (RIA). В некоторых вариантах осуществления антитело, которое связывается с NRP1, характеризуется константой диссоциации (Kd) ≤1 мкМ, ≤100 нМ, ≤10 нМ, ≤1 нМ, ≤0,1 нМ, ≤0,01 нМ или ≤0,001 нМ (например, 10-8 M или менее, например, от 10-8 M до 10-13 M, например, от 10-9 M до 1013 M). В некоторых вариантах осуществления антитело против NRP1 связывается с эпитопом NRP1, который является консервативным среди NRP1 различных видов.

Термин «антитело» используется в настоящем описании в самом широком значении и охватывает различные структуры антител, включающие, но ими не ограничиваются, моноклональные антитела, поликлональные антитела, полиспецифические антитела (например, биспецифические антитела) и фрагменты антител, если они проявляют желаемую антигенсвязывающую активность.

«Фрагмент антител» относится к отличной от интактного антитела молекуле, которая содержит часть интактного антитела, которая связывается с антигеном, с которым связывается интактное антитело. Примеры фрагментов антител включают, но ими не ограничиваются, Fv, Fab, Fab', Fab'-SH, F(ab')2; диатела; линейные антитела; одноцепочечные молекулы антител (например, scFv) и полиспецифические антитела, образованные из фрагментов антител.

«Антитело, которое связывается с тем же эпитопом», что и контрольное антитело, относится к антителу, которое блокирует связывание контрольного антитела со своим антигеном в анализе конкуренции на 50% или более, и наоборот, контрольное антитело блокирует связывание антитела со своим антигеном в анализе конкуренции на 50% или более. В описании представлен приводимый в качестве примера анализ конкуренции.

Термин «химерное» антитело относится к антителу, в котором часть тяжелой и/или легкой цепи происходит из конкретного источника или вида, в то время как оставшаяся часть тяжелой и/или легкой цепи происходит из отличного источника или вида.

«Класс» антитела относится к типу константного домена или константной области, который имеет его тяжелая цепь. Существует пять основных классов антител: IgA, IgD, IgE, IgG и IgM, и некоторые из них можно далее подразделить на подклассы (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2. Константные домены тяжелой цепи, которые соответствуют различным классам иммуноглобулинов, называются α, δ, ε, γ и µ, соответственно.

Используемый в настоящем описании термин «цитотоксическое средство» относится к веществу, ингибирующему или препятствующему функционированию клеток и/или приводящему к гибели или разрушению клеток. Цитотоксические средства включают, но ими не ограничиваются, радиоактивные изотопы (например, At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu), химиотерапевтические средства или лекарственные препараты (например, метотрексат, адриамицин, винкаалкалоиды (винкристин, винбластин, этопозид), доксорубицин, мелфалан, митомицин С, хлорамбуцил, даунорубицин или другие интеркалирующие средства), ингибирующие рост средства, ферменты и их фрагменты, такие как нуклеазы, антибиотики, токсины, такие как токсины в виде небольших молекул или ферментативно активные токсины бактериального, грибкового, растительного или животного происхождения, в том числе их фрагменты и/или варианты, и различные противоопухолевые или средства против злокачественных новообразований, раскрытые ниже.

«Эффекторные функции» относятся к таким биологическим активностям, которые можно отнести к Fc-области антитела и меняются в зависимости от изотипа антитела. Примеры эффекторных функций антител включают связывание C1q и комплементзависимую цитотоксичность (CDC); связывание с рецептором Fc; антителозависимую клеточноопосредованную цитотоксичность (ADCC); фагоцитоз; супрессию рецепторов клеточной поверхности (например, рецепторов В-клеток) и активацию В-клеток.

«Эффективное количество» средства, например, фармацевтического препарата, относится к количеству, эффективному, в требуемых дозах и в течение требуемых периодов времени, для достижения желаемого терапевтического или профилактического результата.

Термин «Fc-область» используется в настоящем описании для определения C-концевой области тяжелой цепи иммуноглобулина, которая содержит по крайней мере часть константной области. Термин включает Fc-области с природными последовательностями и варианты Fc-областей. В одном из вариантов осуществления Fc-область тяжелой цепи IgG человека простирается от Cys226, или от Pro230, до карбоксильного конца тяжелой цепи. Однако C-концевой лизин (Lys447) Fc-области может присутствовать или может не присутствовать. Кроме особо оговоренных в настоящем описании случаев, аминокислотные остатки в Fc-области или константной области пронумерованы в соответствии с системой нумерации EU, также называемой индексом EU, как описано в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.

«Каркасная область» или «FR» относится к остаткам вариабельного домена, отличным от остатков гипервариабельного участка (HVR). FR вариабельного домена, как правило, состоит из четырех FR-доменов: FR1, FR2, FR3 и FR4. Соответственно, последовательности HVR и FR, как правило, обнаруживаются в следующем порядке в VH (или VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.

Термины «полноразмерное антитело», «интактное антитело» и «полное антитело» используются в настоящем описании взаимозаменяемо для обозначения антитела, имеющего структуру, по существу схожую со структурой природного антитела, или имеющего тяжелые цепи, которые содержат Fc-область, определенную в настоящем описании.

Термины «клетка-хозяин», «линия клеток-хозяев» и «культура клеток-хозяев» используются взаимозаменяемо и относятся к клеткам, в которые была введена экзогенная нуклеиновая кислота, в том числе потомству таких клеток. Клетки-хозяева включают «трансформанты» и «трансформированные клетки», которые включают первоначально трансформированную клетку и полученное от нее потомство независимо от числа пассажей. Потомство может не быть полностью идентично по содержанию информации в нуклеиновой кислоте родительской клетке, но может содержать мутации. Сюда включены потомки-мутанты, которые имеют функцию или биологическую активность, одинаковую с таковой, отобранной для первоначальной трансформированной клетки.

«Антитело человека» представляет собой антитело, обладающее аминокислотной последовательностью, которая соответствует аминокислотной последовательности антитела, продуцируемого человеком или клеткой человека, или полученного из не являющегося человеком источника, который использует репертуары антител человека или добавочные кодирующие антитела человека последовательности. Это определение антитела человека, в частности, исключает гуманизированное антитело, содержащее нечеловеческие антигенсвязывающие остатки.

«Консенсусная каркасная область человека» представляет собой каркасную область, в которой представлен наиболее часто встречающийся аминокислотный остаток в выборке последовательностей каркасных областей VL или VH иммуноглобулинов человека. Как правило, выборка последовательностей VL или VH иммуноглобулинов человека происходит из подгруппы последовательностей вариабельных доменов. Как правило, эта подгруппа последовательностей является подгруппой как в Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3. В одном из вариантов осуществления подгруппой для VL является подгруппа каппа I как Kabat и др., выше. В одном из вариантов осуществления подгруппой для VH является подгруппа III как Kabat et al., выше.

«Гуманизированное антитело» относится к химерному антителу, содержащему аминокислотные остатки из нечеловеческих HVR и аминокислотные остатки из FR человека. В некоторых вариантах осуществления гуманизированное антитело будет содержать по существу все из по крайней мере одного и обычно двух вариабельных доменов, в которых все или по существу все HVR (например, CDR) соответствуют HVR нечеловеческого антитела, и все или по существу все FR соответствуют FR антитела человека. Необязательно гуманизированное антитело может содержать по крайней мере часть константной области антитела, происходящей из антитела человека. «Гуманизированная форма» антитела, например нечеловеческого антитела, относится к антителу, которое было подвергнуто гуманизации.

Используемый в настоящем описании термин «гипервариабельный участок» или «HVR» относится к каждому из участков вариабельного домена антитела, которые являются гипервариабельными по последовательности и/или образуют структурно определяемые петли («гипервариабельные петлевые участки»). Как правило, природные четырехцепочечные антитела содержат шесть HVR; три в VH (Н1, Н2, Н3) и три в VL (L1, L2, L3). Как правило, HVR содержат аминокислотные остатки из гипервариабельных петлевых участков и/или из «определяющих комплементарность участков» (CDR), при этом последние характеризуются наибольшей вариабельностью последовательности и/или вовлечены в распознавание антигена. HVR-участок, как в настоящем описании используется, содержит любое число остатков, находящихся в положениях 24-36 (в случае L1), 46-56 (в случае L2), 89-97 (в случае L3), 26-35B (в случае H1), 47-65 (в случае H2) и 93-102 (в случае H3). Следовательно, HVR включает остатки в положениях, описанных ранее:

A) 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2) и 96-101 (H3) (Chothia and Lesk, J. Mol. Biol. 196: 901-917 (1987);

B) 24-34 L1, 50-56 L2, 89-97 L3, 31-35B H1, 50-65 H2 и 95-102 H3 (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991);

C) За исключением CDR1 в VH, CDR, как правило, содержат аминокислотные остатки, которые образуют гипервариабельные петлевые участки. CDR также содержат «определяющие специфичность остатки» или «SDR», которые являются остатками, которые вступают в контакт с антигеном. SDR содержатся внутри районов CDR, называемых укороченными CDR или a-CDR. Примерные a-CDR (a-CDR-L1, a-CDR-L2, a-CDR-L3, a-CDR-H1, a-CDR-H2 и a-CDR-H3) соответствуют аминокислотным остаткам 31-34 L1, 50-55 L2, 89-96 L3, 31-35B H1, 50-58 H2 и 95-102 H3. (См. Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008).) За исключением особо оговоренных случаев, остатки HVR и другие остатки в вариабельном домене (например, остатки FR) пронумерованы в настоящем описании в соответствии с Kabat и др., выше.

«Иммуноконъюгат» представляет собой антитело, конъюгированное с одной или более гетерологичных молекул, включающих, но ими не ограничиваются, цитотоксическое средство.

«Индивидуумом» является млекопитающее. Млекопитающие включают, но ими не ограничиваются, одомашненных животных (например, коров, овец, кошек, собак и лошадей), приматов (например, людей и не являющихся людьми приматов, таких как обезьяны), кроликов и грызунов (например, мышей и крыс). В некоторых вариантах осуществления индивидуумом является человек.

«Выделенное» антитело представляет собой антитело, которое было отделено от компонента его природного окружения. В некоторых вариантах осуществления антитело очищено до превышающей 95% или 99% степени чистоты, как определено с помощью, например, электрофоретических методов (например, электрофора в SDS-ПААГ, изоэлектрофокусировки (IEF), капиллярного электрофореза) или хроматографических методов (например, ионообменной HPLC или HPLC с обращенной фазой). Для обзора способов оценки чистоты антитела см., например, Flatman et al., J. Chromatogr. B 848: 79-87 (2007).

«Выделенная» нуклеиновая кислота относится к молекуле нуклеиновой кислоты, которая была отделена от компонента ее природного окружения. Выделенная нуклеиновой кислоты включает молекулу нуклеиновой кислоты, содержащуюся в клетках, которые обычно содержат молекулу нуклеиновой кислоты, но молекула нуклеиновой кислоты присутствует экстрахромосомно или в положении в хромосоме, которое отличается от ее естественного положения в хромосоме.

«Выделенная нуклеиновая кислота, кодирующая антитело против NRP1», относится к одной или нескольким молекулам нуклеиновых кислот, кодирующим тяжелую и легкую цепи (или их фрагменты) антитела, включающим такую(ие) молекулу(ы) нуклеиновой(ых) кислоты (кислот) в одном векторе или отдельных векторах, и такую(ие) молекулу(ы) нуклеиновой(ых) кислоты (кислот), которая(ые) присутствует в одном или более положений в клетке-хозяине.

Используемый в настоящем описании термин «моноклональное антитело» относится к антителу, полученному из популяции по существу гомогенных антител, т.е. отдельные антитела, входящие в состав популяции, являются идентичными и/или связываются с одним и тем эпитопом, за исключением возможных вариантов антител, например, содержащих природные мутации или возникающих во время получения препарата моноклональных антител, при этом такие варианты, как правило, присутствуют в незначительных количествах. В отличие от препаратов поликлональных антител, которые обычно включают различные антитела, направленные против различных детерминант (эпитопов), каждое моноклональное антитело препарата моноклональных антител направлено против одной антигенной детерминанты. Таким образом, определение «моноклональное» указывает на то, что свойством антитела является то, что его получают из по существу гомогенной популяции антител, и его не следует рассматривать как требование получения антитела каким-либо конкретным способом. Например, моноклональные антитела, применимые в соответствии с настоящим изобретением, можно получить с помощью методов, включающих, но ими не ограничивающихся, гибридомную технологию, методы создания рекомбинантных ДНК, методы фагового дисплея и методы, в которых используются трансгенные животные, содержащие все локусы иммуноглобулинов человека или их часть, при этом такие методы и другие, приводимые в качестве примера методы получения моноклональных антител описываются в настоящем описании.

«Голое антитело» относится к антителу, которое не конъюгировано с гетерологичной составляющей (например, цитотоксической составляющей) или радиоактивной меткой. “Голое” антитело может присутствовать в фармацевтическом препарате.

«Природные антитела» относятся к природным молекулам иммуноглобулинов с меняющимися структурами. Например, природные антитела класса IgG представляют собой гетеротетрамерные гликопротеины с М.м., составляющей приблизительно 150000 дальтон, состоящие из двух идентичных легких цепей и двух идентичных тяжелых цепей, которые соединены дисульфидной связью. От N-конца к C-концу, каждая тяжелая цепь имеет вариабельную область (VH), также называемую вариабельным доменом тяжелой цепи, за которой следуют три константных домена (CH1, CH2 и CH3). Так же, от N-конца к C-концу, каждая легкая цепь имеет вариабельную область (VL), также называемую вариабельным доменом легкой цепи, за которой следует константный домен легкой цепи (CL). Легкую цепь антитела можно отнести к одному из двух типов, называемых каппа (κ) и лямбда (λ), на основе аминокислотной последовательности ее константного домена.

Термин «листовка-вкладыш», как используется в настоящем описании, относится к инструкциям, обычно включаемым в торговые упаковки терапевтических продуктов, которые содержат информацию о показаниях, применении, дозе, введении, комбинированной терапии, противопоказаниях и/или предостережениях, касающихся использования таких терапевтических продуктов.

«Процент (%) идентичности аминокислотной последовательности» по отношению к контрольной полипептидной последовательности определяется как процент аминокислотных остатков в отобранной для испытания последовательности, которые идентичны аминокислотным остаткам в контрольной полипептидной последовательности после совмещения последовательностей и введения пропусков, если необходимо, для получения максимального процента идентичности последовательности и не принятия во внимание любых консервативных замен в качестве части идентичности последовательности. Совмещения для целей определения процента идентичности аминокислотной последовательности можно достичь различными способами, которыми обладает данная область техники, например, используя общедоступное компьютерное программное обеспечение, такое как программное обеспечение BLAST, BALST-2, ALIGN или Megalign (DNASTAR). Квалифицированные в данной области специалисты могут определить соответствующие параметры для совмещения последовательностей, включающие любые алгоритмы, необходимые для достижения максимального совмещения на протяжении полной длины сравниваемых последовательностей. Для целей настоящего изобретения, однако, значения % идентичности аминокислотной последовательности получают с использованием компьютерной программы для сравнения последовательностей ALIGN-2. Компьютерная программа для сравнения последовательностей ALIGN-2 была создана Genentech, Inc., и исходный текст программы был подан вместе с документацией пользователя в Ведомство по охране авторских прав США, Washington D.C., 20559, где он был зарегистрирован под № регистрации авторского права в США - TXU510087. Программа ALIGN-2 находится в свободном доступе от Genentech, Inc., South San Francisco, California, или ее можно компилировать, исходя из исходного текста программа. Программу ALIGN-2 следует компилировать при использовании на операционной системе UNIX, предпочтительно, цифровой UNIX V4.0D. Все параметры сравнения последовательностей устанавливаются программой ALIGN-2 и не меняются.

В ситуациях, когда для сравнений аминокислотных последовательностей используется ALIGN-2, % идентичности данной аминокислотной последовательности А данной аминокислотной последовательности В (что можно альтернативно перефразировать как данная аминокислотная последовательность А, идентичная аминокислотной последовательности В на некий %) рассчитывают следующим образом:

100 × дроби X/Y,

где Х представляет собой число аминокислотных остатков, оцененных как идентичные сопоставления программой ALIGN-2 для совмещения последовательностей при совмещении этой программой А и В, и где Y представляет собой общее число аминокислотных остатков в В. Понятно, что если длина аминокислотной последовательности А не равна длине аминокислотной последовательности В, % идентичности аминокислотной последовательности А последовательности В не будет равен % идентичности аминокислотной последовательности В последовательности А. Если только специально не указано иное, все значения % идентичности аминокислотной последовательности, используемые в настоящем описании, получают, как описывается в непосредственно предшествующем параграфе, используя компьютерную программу ALIGN-2.

Термин «фармацевтический препарат» относится к препарату, который находится в такой форме, которая позволяет биологической активности активного ингредиента, содержащегося в нем, быть эффективной, и который не содержит дополнительные компоненты, которые являются неприемлемо токсичными для индивида, которому будут вводить препарат.

«Фармацевтически приемлемый носитель» относится к ингредиенту в фармацевтическом препарате, отличному от активного ингредиента, который является нетоксичным для индивида. Фармацевтически приемлемый носитель включает, но ими не ограничивается, буфер, наполнитель, стабилизатор или консервант.

Используемый в настоящем описании термин «нейропилин-1» или «NRP1» относится к любому природному NRP1 из любого являющегося позвоночным животным источника, включающего млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), кроме особо оговоренных случаев. Термин охватывает «полноразмерный», не подвергнутый процессированию NRP1, а также любую форму NRP1, которая является результатом процессирования в клетке. Этот термин также охватывает природные варианты NRP1, например варианты сплайсинга или аллельные варианты. Основная структура нейропилинов содержит пять доменов: три экстраклеточных домена (ala2, blb2 и c), трансмембранный домен и цитоплазматический домен. Домен ala2, который обычно содержит четыре остатка цистеина, которые образуют два дисульфидных мостика, гомологичен компонентам комплемента Clr и Cls (CUB). Домен blb2 гомологичен факторам V и VIII свертывания крови. Центральная часть домена c называется MAM вследствие ее гомологии с меприном, A5 и белками тирозинфосфатазами µ рецепторного типа. Домены ala2 и blb2 ответственны для связывания лиганда, тогда как домен c важен для гомодимеризации или гетеродимеризации (Gu et al. (2002) J. Biol. Chem. 277: 18069-76; He and Tessier-Lavigne (1997) Cell 90: 739-51).

Термин «вариабельная область» или «вариабельный домен» относится к домену тяжелой или легкой цепи антитела, который вовлечен в связывание антитела с антигеном. Вариабельные домены тяжелой цепи и легкой цепи (VH и VL, соответственно) природного антитела, как правило, имеют схожие структуры, при этом каждый домен содержит четыре консервативные каркасные области (FR) и три гипервариабельных участка (HVR). (См., например, Kindt et al. Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007).) Один VH- или VL-домен может быть достаточен для придания специфичности связывания с антигеном. Кроме того, антитела, которые связываются с конкретным антигеном, можно выделить, используя VH- или VL-домен антитела, которое связывает этот антиген, для скрининга библиотеки комплементарных VL- или VH-доменов, соответственно. См., например, Portolano et al., J. Immunol. 150: 880-887 (1993); Clarkson et al., Nature 352: 624-628 (1991).

Используемый в настоящем описании термин «вектор» относится к молекуле нуклеиновой кислоты, способной переносить другую нуклеиновую кислоту, с которой она связана. Термин включает вектор в виде самореплицирующейся структуры нуклеиновой кислоты, а также вектор, включаемый в геном клетки-хозяина, в которую он введен. Некоторые векторы способны к управлению экспрессией нуклеиновых кислот, с которыми они функционально связаны. Такие векторы называют в настоящем описании «векторами экспрессии».

II. КОМПОЗИЦИИ И СПОСОБЫ

Настоящее изобретение относится к новым антителам, которые связываются с NRP1. Антитела по настоящему изобретению применимы, например, для обнаружения NRP1, например, в биологических образцах.

А. Приводимые в качестве примера антитела против NRP1

Настоящее изобретение относится к антителам против NRP1, подходящим, например, для диагностических применений. В одном из вариантов осуществления настоящее изобретение относится к антителу против NRP1 со следующими последовательностями тяжелой и легкой цепей:

Тяжелая цепь:

Аминокислотная последовательность вариабельной области тяжелой цепи является следующей:

QLVEESGGGLVTPGGTLTLTCTASGFTISNYHMSWVRQAPGKGLEWIGIIYAVSAATWSA TWVKGRFTISKTLTTVDLKMTSLTAADTATYFCARVRAPGDSTYYDLWGPGTLVTVSS (SEQ ID NO:2).

Аминокислотные последовательности CDR Kabat тяжелой цепи являются следующими: CDR1: NYHMS (SEQ ID NO:3); CDR2: IIYAVSAATWSTWVKG (SEQ ID NO:4); CDR3: VRAPGDSTYYDL (SEQ ID NO:5).

Легкая цепь:

Аминокислотная последовательность вариабельной области легкой цепи является следующей: AVVMTQTASPVSAVVGGTVTINCQASQTISNNWLSWYQQKPGQPPKLLIYKASILASGVP SRFSGSGSGTEFTLTISGVQCDDAATYYCLYGHYITTSAHNAFGGGTEVVVKGD (SEQ ID NO: 7).

Аминокислотные последовательности CDR Kabat легкой цепи являются следующими: CDR1: QASQTISNNWLS (SEQ ID NO:8); CDR2: KASILAS (SEQ ID NO:9); CDR3: LYGHYITTSAHNA (SEQ ID NO:10).

В одном из аспектов настоящее изобретение относится к антителу против NRP1, содержащему по крайней мере один, два, три, четыре, пять или шесть HVR, выбираемых из (a) HVR-H1, содержащего аминокислотную последовательность SEQ ID NO:3; (b) HVR-H2, содержащего аминокислотную последовательность SEQ ID NO:4; (c) HVR-H3, содержащего аминокислотную последовательность SEQ ID NO:5; (d) HVR-L1, содержащего аминокислотную последовательность SEQ ID NO:8; (e) HVR-L2, содержащего аминокислотную последовательность SEQ ID NO:9; и (f) HVR-L3, содержащего аминокислотную последовательность SEQ ID NO:10.

В одном из аспектов настоящее изобретение относится к антителу, содержащему по крайней мере одну, по крайней мере две или все три последовательности HVR VH, выбираемые из (a) HVR-H1, содержащего аминокислотную последовательность SEQ ID NO:3; (b) HVR-H2, содержащего аминокислотную последовательность SEQ ID NO:4; и (c) HVR-H3, содержащего аминокислотную последовательность SEQ ID NO:5. В одном из вариантов осуществления антитело содержит HVR-H3, содержащий аминокислотную последовательность SEQ ID NO:5. В другом варианте осуществления антитело содержит HVR-H3, содержащий аминокислотную последовательность SEQ ID NO:3, и HVR-L3, содержащий аминокислотную последовательность SEQ ID NO:10. В дальнейшем варианте осуществления антитело содержит (a) HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:3; (b) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:4; и (c) HVR-H3, содержащий аминокислотную последовательность SEQ ID NO:5.

В другом аспекте настоящее изобретение относится к антителу, содержащему по крайней мере одну, по крайней мере две или все три последовательности HVR VL, выбираемые из (a) HVR-L1, содержащего аминокислотную последовательность SEQ ID NO:8; (b) HVR-L2, содержащего аминокислотную последовательность SEQ ID NO:9; и (c) HVR-L3, содержащего аминокислотную последовательность SEQ ID NO:10. В одном из вариантов осуществления антитело содержит (a) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:8; (b) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:9; и (c) HVR-L3, содержащий аминокислотную последовательность SEQ ID NO:10.

В другом аспекте антитело по настоящему изобретению содержит (a) VH-домен, содержащий по крайней мере одну, по крайней мере две или все три последовательности HVR VH, выбираемые из (i) HVR-H1, содержащего аминокислотную последовательность SEQ ID NO:3; (ii) HVR-H2, содержащего аминокислотную последовательность SEQ ID NO:4; и (iii) HVR-H3, содержащего аминокислотную последовательность SEQ ID NO:5; и (b) VL-домен, содержащий по крайней мере одну, по крайней мере две или все три последовательности HVR VL, выбираемые из (i) HVR-L1, содержащего аминокислотную последовательность SEQ ID NO:8; (ii) HVR-L2, содержащего аминокислотную последовательность SEQ ID NO:9; и (iii) HVR-L3, содержащего аминокислотную последовательность SEQ ID NO:10.

В другом аспекте настоящее изобретение относится к антителу, содержащему (a) HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:3; (b) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:4; (c) HVR-H3, содержащий аминокислотную последовательность SEQ ID NO:5; (d) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:8; (e) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:9; и (f) HVR-L3, содержащий аминокислотную последовательность, выбираемую из SEQ ID NO:10.

В другом аспекте антитело против NRP1 содержит последовательность вариабельного домена тяжелой цепи (VH), которая по крайней мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична аминокислотной последовательности SEQ ID NO:2. В некоторых вариантах осуществления последовательность VH, которая по крайней мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична, содержит замены (например, консервативные замены), вставки или делеции относительно контрольной последовательности (SEQ ID NO:2), но антитело против NRP1, содержащее эту последовательность, сохраняет способность к связыванию с NRP1. В некоторых вариантах осуществления всего 1-10 аминокислот заменено, вставлено в SEQ ID NO:2 и/или делетировано из нее. В некоторых вариантах осуществления замены, вставки или делеции встречаются в районах вне HVR (т.е. в FR). Необязательно антитело против NRP1 содержит последовательность VH, представленную в SEQ ID NO:2, включающую посттрансляционные модификации этой последовательности. В конкретном варианте осуществления VH содержит один, два или три HVR, выбираемых из: (a) HVR-H1, содержащего аминокислотную последовательность SEQ ID NO:3, (b) HVR-H2, содержащего аминокислотную последовательность SEQ ID NO:4, и (c) HVR-H3, содержащего аминокислотную последовательность SEQ ID NO:5.

В другом аспекте изобретение относится к антителу против NRP1, которое содержит вариабельный домен легкой цепи (VL), который по крайней мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентичен аминокислотной последовательности SEQ ID NO:7. В некоторых вариантах осуществления последовательность VL, которая по крайней мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична, содержит замены (например, консервативные замены), вставки или делеции относительно контрольной последовательности (SEQ ID NO:7), но антитело против NRP1, содержащее эту последовательность, сохраняет способность к связыванию с NRP1. В некоторых вариантах осуществления всего 1-10 аминокислот заменено, вставлено в SEQ ID NO:7 и/или делетировано из нее. В некоторых вариантах осуществления замены, вставки или делеции встречаются в районах вне HVR (т.е. в FR). Необязательно, антитело против NRP1 содержит последовательность VL, представленную в SEQ ID NO:7, содержащую посттрансляционные модификации этой последовательности. В конкретном варианте осуществления VL содержит один, два или три HVR, выбираемые из (a) HVR-L1, содержащего аминокислотную последовательность SEQ ID NO:8; (b) HVR-L2, содержащего аминокислотную последовательность SEQ ID NO:9; и (c) HVR-L3, содержащего аминокислотную последовательность SEQ ID NO:10.

В другом аспекте изобретение относится к антителу против NRP1, которое содержит VH как в любом из вариантов осуществления, представленных выше, и VL как в любом из вариантов осуществления, представленных выше. В одном из вариантов осуществления антитело содержит последовательности VH и VL, представленные в SEQ ID NO:2 и SEQ ID NO:7, соответственно, включающие посттрансляционные модификации этих последовательностей.

В дальнейшем аспекте настоящее изобретение относится к антителу, которое связывается с тем же эпитопом, что и антитело против NRP1 по настоящему изобретению. Например, в некоторых вариантах осуществления изобретение относится к антителу, которое связывается с тем же эпитопом, что и антитело против NRP1, содержащее последовательность VH SEQ ID NO:2 и последовательность VL SEQ ID NO:7.

В дальнейшем аспекте настоящего изобретения антителом против NRP1 в соответствии с любым из представленных выше вариантов осуществления является моноклональное антитело, включающее химерное антитело, гуманизированное антитело или антитело человека. В одном из вариантов осуществления антителом против NRP1 является фрагмент антитела, например, Fv-, Fab-, Fab'-, scFv-фрагмент, диатело или F(ab')2-фрагмент. В другом варианте осуществления антитело является полноразмерным антителом, например, интактным антителом изотипа IgG1 или антителом другого класса или изотипа, определенного в настоящем описании.

В дальнейшем аспекте антитело против NRP1 в соответствии с любым из представленных выше вариантов осуществления может включать любой из характерных признаков, отдельно или в комбинации, описанных в разделах 1-7 ниже.

1. Аффинность антител

В некоторых вариантах осуществления антитело по настоящему изобретению характеризуется константой диссоциации (Kd) ≤ 1 мкМ, ≤ 100 нМ, ≤ 10 нМ, ≤ 1 нМ, ≤ 0,1 нМ, ≤ 0,01 нМ или ≤ 0,001 нМ (например, 10-8 M или менее, например, от 10-8 M до 10-13 M, например, от 10-9 M до 1013 M).

В одном из вариантов осуществления Kd определяют с помощью анализа связывания меченного радиоактивным изотопом антигена (RIA), выполняемого с вариантом Fab представляющего интерес антитела и его антигеном, как описано, с помощью следующего анализа. Аффинность связывания в растворе Fab с антигеном определяют путем приведения в равновесие Fab с использованием минимальной концентрации (125I)-меченного антигена в присутствии титрационного ряда немеченого антигена, затем захвата связанного антигена на планшет, покрытый антителом против Fab (см., например, Chen et al., (1999) J. Mol. Biol. 293: 865-881). Для установки условий анализа многолуночные планшеты MICROTITER® (Thermo Scientific) покрывают в течение ночи 5 мкг/мл захватывающего антитела против Fab (Cappel Labs) в 50 мМ карбонате натрия (рН 9,6) и впоследствии блокируют 2% (вес/объем) бычьего сывороточного альбумина в PBS в течение двух-пяти часов при комнатной температуре (приблизительно 23ºС). В планшете без адсорбирующего средства (Nunc #269620) 100 пМ или 26 пМ [125I]-антигена смешивают с серийными разведениями представляющего интерес Fab (например, соответствующего определению антитела против VEGF, Fab-12, в Presta et al., (1997) Cancer Res. 57: 4593-4599). Представляющий интерес Fab затем инкубируют в течение ночи, однако инкубация может продолжаться в течение более длительного периода (например, приблизительно 65 часов), чтобы гарантировать достижение равновесия. После этого смеси переносят в захватывающий планшет для инкубации при комнатной температуре (например, в течение одного часа). Раствор затем удаляют, и планшет промывают восемь раз 0,1% полисорбата 20 (Tween-20ТМ) в PBS. После высыхания планшетов добавляют 150 мкл/лунку сцинтиллятора (MicroScint-20, Packard), и планшеты считают с помощью счетчика гамма-квантов Topcount (Packard) в течение десяти минут. Для использования в анализах конкурентного связывания выбирают концентрацию каждого Fab, которая обеспечивает связывание, меньшее или равное 20% от максимального связывания.

В соответствии с другим вариантом осуществления Kd определяют с помощью анализов с использованием поверхностного плазмонного резонанса, используя BIAcoreTM-2000 или BIAcoreTM-3000 (BIAcore, Inc., Piscataway, NJ) при 25°С с использованием чипов СМ5 с иммобилизованным антигеном при ~10 единиц ответа (RU). Вкратце, биосенсорные чипы из карбоксиметилированного декстрана (СМ5, BIAcore, Inc.) активируют с помощью N-этил-N'-(3-диметиламинопропил)карбодиимида гидрохлорида (EDC) и N-гидроксисукцинимида (NHS) в соответствии с инструкциями поставщика. Антиген разводят с использованием 10 мМ ацетата натрия, рН 4,8, до 5 мкг/мл (~0,2 мкМ) до инъекции со скоростью потока 5 мкл/минуту для получения приблизительно 10 единиц ответа (RU) связанного белка. После инъекции антигена инъецируют 1 М этаноламин для блокирования непрореагировавших групп. Для кинетических измерений инъецируют двукратные серийные разведения Fab (0,78 нМ-500 нМ) в PBS с 0,05% поверхностно-активного вещества полисорбата 20 (Tween-20ТМ) (PBST) при 25°С со скоростью потока, составляющей приблизительно 25 мкл/минуту. Скорости ассоциации (kon) и скорости диссоциации (koff) рассчитывают с использованием ленгмюровской модели простого связывания в соотношении 1:1 (версия 3,2 программного обеспечения для оценки BIAcore) путем одновременного вычерчивания сенсограмм ассоциации и диссоциации. Константу диссоциации при равновесии (Kd) рассчитывают как отношение koff/kon. См., например, Chen Y. et al., J. Mol. Biol. 293: 865-881 (1999). Если скорость ассоциации превышает 106 М-1 с-1 при вышеуказанном анализе с использованием поверхностного плазмонного резонанса, то скорость ассоциации можно определить с помощью метода гашения флуоресценции, с помощью которого определяется увеличение или уменьшение интенсивности флуоресцентного испускания (возбуждение = 295 нм; испускание = 340 нм; 16 нм полоса) при 25°С 20 нМ антитела против антигена (формы Fab) в PBS, pH 7,2, в присутствии увеличивающихся концентраций антигена, что измеряется в спектрометре, таком как спектрофотометр, оснащенный остановленным потоком (Avin Instruments), или спектрофотометр SLM-Aminco 8000-серии (ThermoSpectronic) с кюветой с мешалкой.

2. Фрагменты антител

В некоторых вариантах осуществления антитело по настоящему изобретению является фрагментом антитела. Фрагменты антител включают, но ими не ограничиваются, Fab-, Fab'-, Fab'-SH, F(ab')2-, Fv- и scFv-фрагменты, и другие фрагменты, описываемые ниже. Для обзора некоторых фрагментов антител см. Hudson et al. Nat. Med. 9: 129-134 (2003). Для обзора scFv-фрагментов см., например, Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); см. также WO 93/16185 и патенты США № 5571894 и 5587458. Ради осуждения Fab- и F(ab')2-фрагментов, содержаших остатки эпитопа, связывающегося с рецептором спасения, и характеризующихся увеличенным in vivo полупериодом жизни, см. патент США № 5869046.

Диатела представляют собой фрагменты антител с двумя антигенсвязывающими сайтами, которые могут быть двухвалентными или биспецифическими. См., например, EP 404097; WO 1993/01161; Hudson et al., Nat. Med. 9: 129-134 (2003); и Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Триатела и тетратела также описываются в Hudson et al., Nat. Med. 9: 129-134 (2003).

Однодоменные антитела представляют собой фрагменты антител, содержащие целый вариабельный домен тяжелой цепи антитела или его часть или целый вариабельный домен легкой цепи антитела или его часть. В некоторых вариантах осуществления однодоменным антителом является человеческое однодоменное антитело (Domantis, Inc., Waltham, MA; см., например, патент США № 6248516 B1).

Фрагменты антител можно создать с помощью различных методов, включающих, но ими не ограничиваются, протеолитическое расщепление интактного антитела, а также получение с помощью рекомбинантных клеток-хозяев (например, E. coli или фага), как описывается в настоящем описании.

3. Химерные и гуманизированные антитела

В некоторых вариантах осуществления антитело по настоящему изобретению является химерным антителом. Некоторые химерные антитела описаны, например, в патенте США № 4816567 и в Morrison et al., Proc. Natl. Acad. Sci. USA, 81: 6851-6855 (1984)). В одном из примеров химерное антитело содержит нечеловеческую вариабельную область (например, вариабельную область, полученную от мыши, крысы, хомяка, кролика или не являющегося человеком примата, такого как обезьяна) и человеческую константную область. В дальнейшем примере химерное антитело представляет собой антитело со «сменой класса», в случае которого класс или изотип был изменен по сравнению с таковым родительского антитела. Химерные антитела включают их антигенсвязывающие фрагменты.

В некоторых вариантах осуществления химерным антителом является гуманизированное антитело. Обычно нечеловеческое антитело подвергают гуманизации для уменьшения иммуногенности у людей, при сохранении специфичности и аффинности родительского нечеловеческого антитела. Как правило, гуманизированное антитело содержит один или более вариабельных доменов, в которых HVR, например, CDR, (или их части) происходят из нечеловеческого антитела, а FR (или их части) происходят из последовательностей антител человека. Необязательно, гуманизированное антитело будет также содержать по крайней мере часть константной области человека. В некоторых вариантах осуществления некоторые остатки FR в гуманизированном антителе заменены соответствующими остатками из нечеловеческого антитела (например, антитела, из которого происходят остатки HVR), например, для восстановления или увеличения специфичности или аффинности антитела.

Гуманизированные антитела и способы их получения рассматриваются, например, в Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008) и, кроме того, описываются, например, в Riechmann et al., Nature 332: 323-329 (1988); Queen et al., Proc. Nat'l Acad. Sci. USA 86: 10029-10033 (1989); патентах США № 5821337, 7527791, 6982321 и 7087409; Kashmiri et al., Methods 36: 25-34 (2005) (где описывается пересадка SDR (a-CDR)); Padlan, Mol. Immunol. 28: 489-498 (1991) (где описывается «изменение поверхности»); Dall'Acqua et al., Methods 36: 43-60 (2005) (где описывается «перетасовка FR»); и Osbourn et al., Methods 36: 61-68 (2005) и Klimka et al., Br. J. Cancer, 83: 252-260 (2000) (где описывается способ «направляемого отбора» для перетасовки FR).

Человеческие каркасные области, которые могут использоваться для гуманизации, включают, но ими не ограничиваются, каркасные области, отобранные с использованием метода «наилучшей подгонки» (см., например, Sims et al. J. Immunol. 151: 2296 (1993)); каркасные области, полученные на основе консенсусной последовательности для антител человека конкретной подгруппы вариабельных областей легкой или тяжелой цепи (см., например, Carter et al. Proc. Natl. Acad. Sci. USA, 89: 4285 (1992); и Presta et al. J. Immunol, 151: 2623 (1993)); каркасные области созревших (соматически мутированных) иммуноглобулинов человека или каркасные области иммуноглобулинов зародышей линии человека (см., например, Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008)); и каркасные области, полученные в результате скрининга библиотек FR (см., например, Baca et al., J. Biol. Chem. 272: 10678-10684 (1997) и Rosok et al., J. Biol. Chem. 271: 22611-22618 (1996)).

4. Антитела человека

В некоторых вариантах осуществления антитело по настоящему изобретению является антителом человека. Антитела человека можно продуцировать, используя различные методы, известные в данной области техники. Антитела человека описаны в общих чертах в van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) и Lonberg, Curr. Opin. Immunol. 20: 450-459 (2008).

Антитела человека можно получить введением иммуногена трансгенному животному, которое было изменено для получения интактных антител человека или интактных антител с вариабельными областями человека в ответ на антигенное воздействие. Такие животные типично содержат все локусы иммуноглобулинов человека или их часть, которые замещают эндогенные локусы иммуноглобулинов, или которые присутствуют экстрахромосомно или интегрированы по случайному закону в хромосомы животного. У таких трансгенных мышей эндогенные локусы иммуноглобулинов, как правило, инактивированы. Для обзора способов получения антител человека из трансгенных животных см. Lonberg, Nat. Biotech. 23: 1117-1125 (2005). См. также, например, патенты США № 6075181 и 6150584, в которых описывается технология XENOMOUSETM; патент США № 5770429, в котором описывается технология HUMAB®; патент США № 7041870, в котором описывается технология K-M MOUSE®, и публикацию заявки на патент США № US 2007/0061900, в которой описывается технология VELOCIMOUSE®. Вариабельные области человека из интактных антител, созданных с помощью таких животных, можно далее модифицировать, например, посредством объединения с отличной константной областью человека.

Антитела человека можно также получать методами на основе гибридомы. Были описаны линии клеток миеломы человека и гетеромиеломы мыши-человека для получения моноклональных антител человека. (См., например, Kozbor J. Immunol, 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); и Boerner et al., J. Immunol, 147: 86 (1991).) Антитела человека, созданные благодаря гибридомной технологии с использованием В-клеток человека, также описываются в Li et al., Proc. Natl. Acad. Sci. USA, 103: 3557-3562 (2006). Дополнительные способы включают те, которые описаны, например, в патенте США № 7189826 (где описывается получение моноклональных антител человека класса IgM за счет линий гибридомных клеток) и в Ni, Xiandai Mianyixue, 26(4): 265-268 (2006) (где описываются гибридомы человек-человек). Технология получения гибридом человека (технология Trioma) также описывается в Vollmers and Brandlein, Histology and Histopathology, 20(3): 927-937 (2005) и Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3): 185-91 (2005).

Антитела человека можно также создать с помощью выделения последовательностей вариабельных доменов Fv-клонов, отбираемых из библиотек фагового дисплея человеческого происхождения. Такие последовательности вариабельных доменов можно затем объединить с желаемым константным доменом человека. Методы отбора антител человека из библиотек антител описываются ниже.

5. Получаемые из библиотек антитела

Антитела по настоящему изобретению можно выделить посредством скрининга комбинаторных библиотек на предмет антител с желаемой активностью или активностями. Например, в данной области техники известен ряд способов создания библиотек фагового дисплея и скрининга таких библиотек на предмет антител, обладающих желаемыми характеристиками связывания. Такие способы рассматриваются, например, в Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001) и, кроме того, описываются, например, в McCafferty et al., Nature 348: 552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, in Methods in Molecular Biology 248: 161-175 (Lo, ed., Human Press, Totowa, NJ, 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); и Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004).

В некоторых методах фагового дисплея наборы генов VH и VL клонируют отдельно с помощью полимеразной цепной реакции (ПЦР) и рекомбинируют по случайному закону в библиотеки фагов, которые затем можно скринировать на предмет антигенсвязывающего фага, как описано в Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Фаги обычно представляют на своей поверхности фрагменты антител, в виде либо одноцепочечных Fv- (scFv) фрагментов, либо Fab-фрагментов. Библиотеки на основе иммунизированных источников обеспечивают антитела с высокой аффинностью к иммуногену без необходимого условия конструирования гибридом. Альтернативно, можно клонировать набор генов из не иммунизированного источника (например, человека) для обеспечения одного источника антител против широкого ряда антигенов, не являющихся аутоантигенами, а также аутоантигенов без какой-либо иммунизации, как описано в Griffiths et al., EMBO J, 12: 725-734 (1993). Наконец, библиотеки на основе не иммунизированных источников можно также получать синтетически посредством клонирования сегментов не подвергнутых реаранжировке V-генов из стволовых клеток и использования праймеров, имеющих случайную последовательность, для ПЦР, чтобы кодировать в высокой степени вариабельные CDR3-участки и завершить реаранжировку in vitro, как описано в Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992). Патенты и публикации заявок на патенты, в которых описываются библиотеки антител человека в фагах, включают, например, патент США № 5750373 и публикации заявок на патенты № 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936 и 2009/0002360.

Антитела или фрагменты антител, выделенные из библиотек антител человека, считаются в настоящем описании антителами человека или фрагментами антител человека.

6. Полиспецифические антитела

В некоторых вариантах осуществления антитело по настоящему изобретению является полиспецифическим антителом, например биспецифическим антителом. Полиспецифические антитела представляют собой моноклональные антитела, которые обладают специфичностями связывания с по крайней мере двумя различными сайтами. В некоторых вариантах осуществления одной из специфичностей связывания является таковая в отношении NRP1, а другая - в отношении любого другого антигена. В некоторых вариантах осуществления биспецифические антитела могут связываться с двумя различными эпитопами NRP1. Биспецифические антитела могут также использоваться для сосредоточения цитотоксических средств в клетках, которые экспрессируют NRP1. Биспецифические антитела можно получить в виде полноразмерных антител или фрагментов антител.

Способы получения полиспецифических антител включают, но ими не ограничиваются, рекомбинантную коэкспрессию пар тяжелая цепь-легкая цепь двух иммуноглобулинов, имеющих различные специфичности (см. Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829 и Traunecker et al., EMBO J. 10: 3655 (1991)) и инженерию «выступы-во-впадины» (см., например, патент США № 5731168). Полиспецифические антитела можно также получить посредством создания эффектов электростатического наведения для получения гетеродимерных молекул из Fc антител (WO 2009/089004 A1); сшивания двух или более антител или фрагментов (см., например, патент США № 4676980 и Brennan et al., Science, 229: 81 (1985)); использования лейциновых молний для получения биспецифических антител (см., например, Kostelny et al., J. Immunol., 148(5): 1547-1553 (1992)); использования технологии получения «диател» для создания фрагментов биспецифических антител (см., например, Hollinger et al., Proc. Natl. Acad. Sci. USA, 90: 6444-6448 (1993)), и использования димеров одноцепочечных Fv (sFv) (см., например, Gruber et al., J. Immunol, 152: 5368 (1994)); и приготовления триспецифических антител, как описано, например, в Tutt et al. J. Immunol. 147: 60 (1991).

В настоящее описание также включены сконструированные антитела с тремя или более функциональными антигенсвязывающими сайтами, включающие «антитела-осминоги» (см., например, US 2006/0025576 A1).

Антитело или фрагмент в настоящем описании также включает «Fab двойного действия» или «DAF», содержащий антигенсвязывающий сайт, который связывается с NRP1, а также с другим отличным антигеном (см. US 2008/0069820, например).

7. Варианты антител

В некоторых вариантах осуществления предусматриваются варианты по аминокислотным последовательностям обеспечиваемых в настоящем описании антител. Например, желательным может быть увеличение аффинности связывания и/или улучшение других биологических свойств антитела. Варианты по аминокислотной последовательности антитела можно получить посредством введения соответствующих модификаций в нуклеотидную последовательность, кодирующую антитело, или с помощью синтеза пептидов. Такие модификации включают, например, делеции остатков из аминокислотных последовательностей антитела и/или вставки и/или замены остатков в них. Любую комбинацию из делеции, вставки и замены можно создать для получения конечной конструкции при условии, что конечная конструкция обладает желаемыми характеристиками, например, связыванием с антигеном.

а) Варианты с заменой(ами), вставкой(ами) и делецией(ями)

В некоторых вариантах осуществления изобретение относится к вариантам антител, содержащим одну или более аминокислотных замен. Представляющие наибольший интерес сайты для мутагенеза с заменой включают HVR и FR. Консервативные замены представлены в таблице 1 под заголовком «предпочтительные замены». Более существенные изменения представлены в таблице 1 под заголовком «приводимым в качестве примера замены» и дополнительно описаны ниже со ссылкой на классы боковых цепей аминокислот. Аминокислотные замены можно ввести в представляющее интерес антитело, а продукты подвергнуть скринингу на предмет желаемой активности, например, сохранение/увеличение связывания с антигеном, уменьшение иммуногенности или увеличение ADCC или CDC.

Таблица 1
Первоначальный остаток Приводимые в качестве примера замены Предпочтительные замены
Ala (A) Val; Leu; Ile Val
Arg (R) Lys; Gln; Asn Lys
Asn (N) Gln; His; Asp, Lys; Arg Gln
Asp (D) Glu; Asn Glu
Cys (C) Ser; Ala Ser
Gln (Q) Asn; Glu Asn
Glu (E) Asp; Gln Asp
Gly (G) Ala Ala
His (H) Asn; Gln; Lys; Arg Arg
Ile (I) Leu; Val; Met; Ala; Phe; норлейцин Leu
Leu (L) норлейцин; Ile; Val; Met; Ala; Phe Ile
Lys (K) Arg; Gln; Asn Arg
Met (M) Leu; Phe; Ile Leu
Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr (Y) Trp; Phe; Thr; Ser Phe
Val (V) Ile; Leu; Met; Phe; Ala; норлейцин Leu

Аминокислоты можно разделить на группы в соответствии с общими свойствами их боковых цепей:

1) гидрофобные: норлейцин, Met, Ala, Val., Leu, Ile;

2) нейтральные гидрофильные: Cys, Ser, Thr, Asn, Gln;

3) кислые: Asp, Glu;

4) основные: His, Lys, Arg;

5) остатки, оказывающие влияние на ориентацию цепи: Gly, Pro;

6) ароматические: Trp, Tyr, Phe.

Неконсервативные замены повлекут за собой замену члена одного из этих классов на другой класс.

Один тип варианта с заменой(ами) включает замену одного или нескольких остатков гипервариабельных участков родительского антитела (например, гуманизированного антитела или антитела человека). Как правило, получаемый в результате вариант(ы), отбираемый для дальнейшего исследования, будет иметь изменения (например, улучшения) некоторых биологических свойств (например, увеличение аффинности, уменьшение иммуногенности) относительно родительского антитела, и/или у него будут сохранены в значительной степени определенные биологические свойства родительского антитела. Приводимым в качестве примера вариантом с заменой(ами) является антитело с созревшей аффинностью, которое можно беспрепятственно создать, например, используя методы созревания аффинности на основе фагового дисплея, такие как те, которые описаны в настоящем описании. Вкратце, один или более остатков HVR мутируют, и варианты антител представляют на поверхности фагов и скринируют на предмет конкретной биологической активности (например, аффинности связывания).

Изменения (например, замены) можно ввести в HVR, например, для увеличения аффинности антитела. Такие изменения можно ввести в «горячие точки» HVR, т.е. остатки, кодируемые кодонами, которые подвергаются мутации с высокой частотой во время процесса соматического процесса созревания (см., например, Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), и/или SDR (a-CDR), при этом результирующий вариант VH или VL проверяют на аффинность связывания. Созревание аффинности с помощью конструирования вторичных библиотек и выбора заново из них было описано, например, в Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, (2001).) В некоторых вариантах осуществления созревания аффинности в гены вариабельных областей, выбранные для созревания, вносят разнообразие с помощью любого из ряда способов (например, ПЦР с внесением ошибок, перетасовки цепей или мутагенеза с использованием олигонуклеотидов). Затем создают вторичную библиотеку. Затем библиотеку скринируют для идентификации любых вариантов антитела с желаемой аффинностью. Другой способ внесения разнообразия включает направленные на HVR подходы, в которых рандомизируют несколько остатков HVR (например, 4-6 остатков за один раз). Остатки HVR, вовлеченные в связывание антигена, можно, в частности, идентифицировать, например, используя сканирующий аланином мутагенез или моделирование. В особенности, CDR-H3 и CDR-L3 часто становятся мишенями.

В некоторых вариантах осуществления замены, вставки или делеции могут встречаться в одном или более HVR при условии, что такие изменения не уменьшают существенно способность антитела к связыванию антигена. Например, консервативные изменения (например, консервативные замены, представленные в настоящем описании), которые не уменьшают существенно аффинность связывания, могут быть внесены в HVR. Такие изменения могут находиться вне «горячих точек» HVR или SDR. В некоторых вариантах осуществления вариантов последовательностей VH и VL, представленных выше, каждый HVR либо является неизмененным, либо содержит не более одной, двух или трех аминокислотных замен.

Подходящий способ идентификации остатков или районов антитела, которые могут быть намечены для мутагенеза, называют «сканирующим аланином мутагенезом», как описано Cunningham и Wells (Science, 244: 1081-1085 (1989)). В этом способе остаток или группу целевых остатков (например, заряженные остатки, такие как arg, asp, his, lys и glu) идентифицируют и замещают нейтральной или отрицательно заряженной аминокислотой (например, аланином или полиаланином) для определения того, оказывается ли влияние на взаимодействие антитела с антигеном. Затем замены могут быть введены в положения аминокислот, демонстрирующие функциональную чувствительность к первоначальным заменам. Альтернативно или дополнительно, может использоваться кристаллическая структура комплекса антиген-антитело для идентификации точек контакта между антителом и антигеном. Такие точки контакта и соседние остатки могут быть намечены в качестве кандидатов на замену или устранены. Варианты можно подвергнуть скринингу для определения того, обладают ли они желаемыми свойствами.

Вставки в аминокислотную последовательность, длина которых находится в диапазоне от одного остатка до полипептидов, содержащих сотню или более остатков, включают слияния с амино-концом и/или карбоксильным концом, а также вставки внутрь последовательности одного или множества аминокислотных остатков. Примеры концевых вставок включают антитело с метионильным остатком на N-конце. Другие инсерционные варианты молекулы антитела включают слияние фермента (например, для ADEPT) или полипептида, который увеличивает полупериод жизни антитела в сыворотке, с N- или С-концом антитела.

b) Варианты гликозилирования

В некоторых вариантах осуществления антитело по настоящему изобретению изменяют для увеличения или уменьшения степени гликолизирования антитела. Добавление к антителу сайтов гликозилирования или их исключение легко осуществляют путем изменения аминокислотной последовательности, так что создается или исключается один или более сайтов гликозилирования.

Если антитело содержит Fc-область, углевод, присоединяемый к нему, может быть изменен. Природные антитела, продуцируемые клетками млекопитающих, обычно содержат разветвленный, биантеннальный олигосахарид, который, как привило, присоединен с помощью N-связи к Asn297 CH2-домена Fc-области. См., например, Wright et al. TIBTECH 15: 26-32 (1997). Олигосахарид может включать различные углеводы, например, маннозу, N-ацетилглюкозамин (GlcNAc), галактозу и сиаловую кислоту, а также фукозу, присоединенную к GlcNAc в «стволе» биантеннальной олигосахаридной структуры. В некоторых вариантах осуществления модификации олигосахарида в антителе по настоящему изобретению могут осуществляться с целью создания вариантов антитела с определенными улучшенными свойствами.

В одном из вариантов осуществления изобретение относится к вариантам антител с углеводной структурой, в которой недостает фукозы, присоединенной (непосредственно или опосредованно) к Fc-области. Например, количество фукозы в таком антителе может составлять 1-80%, 1-65%, 5-65%, 20-40%. Количество фукозы определяют путем расчета среднего количества фукозы в сахарной цепи, присоединенной к Asn297, относительно суммы всех гликоструктур, присоединенных к Asn 297 (например, сложных, гибридных структур и структур с высоким количеством маннозы), определяемых с помощью MALDI-TOF масс-спектрометрии, как описано в WO 2008/077546, например. Asn297 относится к остатку аспарагина, находящемуся приблизительно в положении 297 в Fc-области (EU-нумерация остатков Fc-области); однако Asn297 может также находится на приблизительно ±3 аминокислоты выше или ниже положения 297, т.е. между положениями 294 и 300, вследствие незначительных вариаций последовательностей антител. Такие варианты фукозилирования могут характеризоваться улучшенной функцией в виде ADCC. См., например, публикации заявок на патенты США № US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Примеры публикаций, относящихся к «дефукозированным» или вариантам антител «с недостатком фукозы», включают: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO 2005/053742; WO 2002/031140; Okazaki et al. J. Mol. Biol. 336: 1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Примеры линий клеток, способных к получению дефукозированных антител включают клетки Lec13 CHO с недостаточной способностью к фукозилированию белков (Ripka et al. Arch. Biochem. Biophys. 249: 533-545 (1986); заявка на патент США № US 2003/0157108 Al., Presta, L; и WO 2004/056312 Al., Adams et al., особенно в примере 11), и линии клеток с выключенным геном, такие как клетки СНО с выключенным геном альфа-1,6-фукозилтрансферазы, FUT8, (см., например, Yamane-Ohnuki et al., Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4): 680-688 (2006); и WO 2003/085107).

Кроме того, изобретение относится к вариантам антител с бисекторными олигосахаридами, например, в которых GlcNAc делит пополам биантеннальный олигосахарид, присоединенный к Fc-области антитела. Такие варианты антител могут иметь уменьшенное фукозилирование и/или улучшенную функцию в виде ADCC. Примеры таких вариантов антител описаны, например, в WO 2003/011878 (Jean-Mairet et al.); патенте США № 6602684 (Umana et al.) и US 2005/0123546 (Umana et al.). Также изобретение относится к вариантам антител с по крайней мере одним остатком галактозы в олигосахариде, присоединенном к Fc-области. Такие варианты антител могут иметь улучшенную функцию в виде CDC. Такие варианты антител описаны, например, в WO 1997/30087 (Patel et al); WO 1998/58964 (Raju, S.) и WO 1999/22764 (Raju, S.).

c) Варианты Fc-области

В некоторых вариантах осуществления одна или более модификаций аминокислот может быть введена в Fc-область антитела по настоящему изобретению, создавая тем самым вариант Fc-области. Вариант Fc-области может содержать последовательность Fc-области человека (например, Fc-области IgG1, IgG2, IgG3 или IgG4 человека), содержащую модификацию аминокислоты (например, замену) в одном или нескольких положениях аминокислот.

В некоторых вариантах осуществления настоящее изобретение предусматривается вариант антитела, который обладает некоторыми, но не всеми эффекторными функциями, что делает его желанным кандидатом на такие применения, когда важен полупериод жизни антитела in vivo, однако же некоторые эффекторные функции (такие как комплемент и ADCC) являются ненужными или вредными. In vitro и/или in vivo анализы цитотоксичности можно провести для подтверждения уменьшения/истощения активностей CDC и/или ADCC. Например, можно провести анализы связывания с рецептором Fc (FcR) для гарантии того, что антитело не связывает FcγR (следовательно, у него, вероятно, отсутствует активность ADCC), но у него сохраняется способность связывать FcRn. Основные клетки, опосредующие ADCC, NK-клетки, экспрессируют только FcγRIII, в то время как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. Экспрессия FcR в гематопоэтических клетках суммирована в таблице 3 на странице 464 Ravetch and Kinet, Annu. Rev. Immunol. 9: 477-492 (1991). Неограничивающие примеры in vitro анализов для оценки активности ADCC представляющей интерес молекулы описаны в патенте США № 5500362 (см., например, Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83: 7059-7063 (1986)) и Hellstrom, I et al., Proc. Nat'l Acad. Sci. USA 82: 1499-1502 (1985); патент США № 5821337 (см. Bruggemann, M. et al., J. Exp. Med. 166: 1351-1361 (1987)). Альтернативно могут использоваться нерадиоактивные анализы (см., например, нерадиоактивный анализ цитотоксичности ACTITM вместо проточной цитометрии (CellTechnology, Inc. Mountain View, CA; и нерадиоактивный анализ цитотоксичности CytoTox 96® (Promega, Madison, WI). Применимые для таких анализов клетки-эффекторы включают мононуклеарные клетки периферической крови (PBMC) и природные киллеры (NK). Альтернативно или дополнительно, активность ADCC представляющей интерес молекулы можно оценить in vivo, например, в модели на животном, такой как модель, описанная в Clynes et al., PNAS (USA) 95: 652-656 (1998)). Можно также провести анализы связывания C1q для подтверждения того, что антитело не способно связывать C1q и, следовательно, не обладает активностью CDC. См., например, ELISA для оценки связывания C1q и C3c в WO 2006/029879 и WO 2005/100402. Для оценки активации комплемента можно провести анализ CDC (см., например, Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg, M.S. et al., Blood 101: 1045-1052 (2003); и Cragg, M.S. and M.J. Glennie, Blood 103: 2738-2743 (2004)). Определения связывания с FcRn и in vivo клиренса/периода полувыведения можно также провести с использованием способов, известных в данной области (см., например, Petkova, S.B. et al., Int'l. Immunol. 18(12): 1759-1769 (2006)).

Антитела со сниженной эффекторной функцией включают антитела с заменой одного или более остатков в положениях 238, 265, 269, 270, 297, 327 и 329 Fc-области (патент США № 6737056). Такие Fc-мутанты включают Fc-мутанты с заменами в двух или более положениях аминокислот 265, 269, 270, 297 и 327, включающие так называемый Fc-мутант «DANA» с заменой остатка 265 и 297 на аланин (патент США № 7332581).

Описаны определенные варианты антител с увеличенным или уменьшенным связыванием с FcR (см., например, патент США № 6737056; WO 2004/056312 и Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001)).

В определенных вариантах осуществления вариант антитела содержит Fc-область с одной или несколькими аминокислотными заменами, которые увеличивают ADCC, например, заменами в положениях 298, 333 и/или 334 Fc-области (EU-нумерация остатков).

В некоторых вариантах осуществления осуществляют изменения в Fc-области, которые приводят к изменению (т.е. либо увеличению, либо уменьшению) связывания C1q и/или комплементзависимой цитотоксичности (CDC), например, как описано в патенте США № 6194551, WO 99/51642 и в Idusogie et al. J. Immunol. 164: 4178-4184 (2000).

Антитела с увеличенным полупериодом жизни и увеличенным связыванием с неонатальным Fc-рецептором (FcRn), который ответственен за перенос материнских IgG плоду (Guyer et al., J. Immunol. 117: 587 (1976) и Kim et al., J. Immunol. 24: 249 (1994)), описаны в US 2005/0014934 A1 (Hinton et al.). Эти антитела содержат Fc-область с одной или несколькими заменами в ней, которые увеличивают связывание Fc-области с FcRn. Такие варианты Fc-области включают Fc-области с заменами в одном или более остатков Fc-области, выбираемых из 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 и 434, например, заменой остатка 434 Fc-области (патент США № 7371826).

См. также Duncan & Winter, Nature 322: 738-740 (1988); патент США № 5648260; патент США № 5624821 и WO 94/29351, касающиеся других примеров вариантов Fc-области.

d) Варианты антител с генно-инженерным цистеином(ами)

В некоторых вариантах осуществления желательным может быть создание антител с генно-инженерным цистеином(ами), например, «thioMAb», в которых один или более остатков антитела заменены остатками цистеина. В конкретных вариантах осуществления замещенные остатки встречаются в открытых для доступа местах антитела. В результате замещения этих остатков цистеином реакционно-способные тиольные группы располагаются таким образом в доступных местах антитела и могут использоваться для конъюгации антитела с другими составляющими, такими как составляющие в виде лекарственных средств или составляющие линкер-лекарственных средств, для создания иммуноконъюгата, как описывается ниже в настоящем описании. В некоторых вариантах осуществления на цистеин может быть заменен любой один или более из следующих остатков: V205 (нумерация Kabat) легкой цепи; A118 (EU-нумерация) тяжелой цепи и S400 (EU-нумерация) Fc-области тяжелой цепи. Антитела с генно-инженерным цистеином(ами) можно создать, как описано, например, в патенте США № 7521541.

e) Производные антител

В некоторых вариантах осуществления антитело по настоящему изобретению можно, кроме того, модифицировать так, чтобы оно содержало дополнительные небелковоподобные составляющие, которые известны в данной области техники и легкодоступны. Составляющие, подходящие для дериватизации антитела, включают, но ими не ограничиваются, водорастворимые полимеры. Неограничивающие примеры водорастворимых полимеров включают, но ими не ограничиваются, полиэтиленгликоль (PEG), сополимеры этиленгликоля и пропиленгликоля, карбоксиметилцеллюлозу, декстран, поливиниловый спирт, поливинилпирролидон, поли-1,3-диоксолан, поли-1,3,6-триоксан, сополимер этилена и малеинового ангидрида, полиаминокислоты (или гомополимеры, или произвольные сополимеры) и декстран, или поли(н-винилпирролидон)полиэтиленгликоль, гомополимеры пропропиленгликоля, сополимеры пролипропиленоксида и этиленоксида, полиоксиэтилированные полиолы (например, глицерин), поливиниловый спирт и их смеси. Полиэтиленгликольпропиональдегид может иметь преимущества при производстве вследствие его стабильности в воде. Полимер может быть любой молекулярной массы и может быть разветвленным или неразветвленным. Число полимеров, присоединяемых к антителу, может варьировать, и если присоединяется больше одного полимера, они могут представлять собой одинаковые или различные молекулы. Как правило, число и/или тип используемых для дериватизации полимеров можно определить на основе принятия во внимание, например, но ими не ограничиваются, конкретных свойств или функций антитела, которые необходимо улучшить, того, будет ли производное антитела использоваться для лечения при определенных условиях и т.п.

В другом варианте осуществления изобретение относится к конъюгатам антитела и небелковоподобной составляющей, которые можно выборочно нагреть посредством подвергания воздействию излучения. В одном из вариантов осуществления небелковоподобной составляющей является углеродная нанотрубка (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). Излучение может быть любой длины волны и включает, но ими не ограничиваются, длины волн, которые не наносят вред обычным клеткам, но которые нагревают небелковоподобную составляющую до температуры, при которой уничтожаются клетки, находящиеся близко к антителу- небелковоподобной составляющей.

B. Способы создания рекомбинантных молекул и композиции

Антитела можно получать, используя способы создания рекомбинантных молекул и композиции, например, как описано в патенте США №4816567. В одном из вариантов осуществления изобретение относится к выделенной нуклеиновой кислоте, кодирующей антитело против NRP1, описываемое в настоящем описании. Такая нуклеиновая кислота может кодировать аминокислотную последовательность, содержащую VL, и/или аминокислотную последовательность, содержащую VH антитела (например, легкую и/или тяжелую цепи антитела). В дальнейшем варианте осуществления изобретение относится к одному или более векторам (например, векторам экспрессии), содержащим такую нуклеиновую кислоту. В дальнейшем варианте осуществления изобретение относится к клетке-хозяина, содержащей такую нуклеиновую кислоту. В одном из вариантов осуществления клетка-хозяин содержит (например, была трансформирована им(и)): (1) вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и аминокислотную последовательность, содержащую VH антитела, или (2) первый вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и второй вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, включающую VH антитела. В одном из вариантов осуществления клетка-хозяин является эукариотической, например, клеткой яичника китайского хомячка (CHO) или лимфоидной клеткой (например, клетка Y0, NS0, Sp20). В одном из вариантов осуществления изобретение относится к способу получения антитела против NRP1, который предусматривает культивирование клетки-хозяина, содержащей нуклеиновую кислоту, кодирующую антитело, обеспеченное выше, в условиях, подходящих для экспрессии антитела, и необязательно извлечение антитела из клетки-хозяина (или среды для культивирования клетки-хозяина).

Для рекомбинантного получения антитела против NRP1 нуклеиновую кислоту, кодирующую антитело, например, описанную выше, выделяют и встраивают в один или более векторов для дальнейшего клонирования и/или экспрессии в клетке-хозяине. Такую нуклеиновую кислоту можно без труда выделить и секвенировать, используя обычные процедуры (например, используя олигонуклеотидные зонды, которые способны к специфическому связыванию с генами, кодирующими тяжелую и легкую цепи антитела).

Клетки-хозяева, подходящие для клонирования или экспрессии кодирующих антитела векторов, включают прокариотические или эукариотические клетки, описываемые в настоящем описании. Например, антитела можно получать в бактериях, в частности, когда гликозилирование и эффекторная функция Fc не требуются. Для экспрессии фрагментов антител и полипептидов в бактериях см., например, патенты США № 5648237, 5789199 и 5840523. (См. также Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, где описывается экспрессия фрагментов антител в E. coli.) После экспрессии антитело можно выделить из массы бактериальных клеток в растворимой фракции и можно в дальнейшем очистить.

Хозяевами, подходящими для клонирования или экспрессии кодирующих антитела векторов, являются, помимо прокариот, эукариотические микробы, такие как нитчатые грибы или дрожжи, включающие штаммы грибов и дрожжей, пути гликозилирования которых были «гуманизированы», приводя к получению антитела с частично или полностью человеческим профилем гликозилирования. См. Gerngross, Nat. Biotech. 22: 1409-1414 (2004) и Li et al., Nat. Biotech. 24: 210-215 (2006).

Клетки-хозяева, подходящие для экспрессии гликозилированного антитела, также получены от многоклеточных организмов (беспозвоночных и позвоночных). Примеры клеток беспозвоночных включают клетки растений и насекомых. Были идентифицированы многочисленные штаммы бакуловирусов, которые могут использоваться совместно с клетками насекомых, в частности, для трансфекции клеток Spodoptera frugiperda.

Культуры клеток растений могут также использоваться в качестве хозяев. См., например, патенты США № 5959177, 6040498, 6420548, 7125978 и 6417429 (где описывается технология PLANTIBODIESTM для получения антител в трансгенных растениях).

Клетки позвоночных могут также использоваться в качестве хозяев. Например, могут использоваться линии клеток млекопитающих, которые адаптированы к росту в суспензии. Другими примерами используемых линий клеток-хозяев млекопитающих являются линия CV1 почки обезьяны, трансформированная SV40 (COS-7); линия клеток эмбриональной почки человека (293 или клетки 293, описанные в Graham et al., J. Gen Virol. 36: 59 (1977)); клетки почки детеныша хомячка (BHK); клетки опухоли Сертоли мыши (клетки TM4, описанные, например, в Mather, Biol. Reprod. 23: 243-251 (1980)); клетки почки обезьяны (CV1); клетки почки африканской зеленой мартышки (VERO-76); клетки карциномы шейки матки человека (HELA); клетки почки собаки (MDCK); клетки печени крысы Buffalo (BRL 3A); клетки легкого человека (W138); клетки печени человека (Hep G2); опухоль молочной железы мыши (ММТ 060562); клетки TRI, описанные, например, в Mather et al., Annals N.Y. Acad. Sci. 383: 44-68 (1982); клетки MRC 5 и клетки FS4. Другие применимые линии клеток-хозяев млекопитающих включают клетки яичника китайского хомячка (CHO), включающие клетки DHFR- CHO (Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980)); и линии клеток миеломы, такие как Y0, NS0 и Sp2/0. Для обзора некоторых линий клеток-хозяев млекопитающих, подходящих для получения антител, см., например, Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268 (2003).

C. Анализы

Антитела против NRP1 по настоящему изобретению можно идентифицировать, отобрать или охарактеризовать в отношении их физических/химических свойств и/или биологических активностей с помощью различных анализов, известных в данной области техники.

1. Анализы связывания и другие анализы

В одном из аспектов проверяют антигенсвязывающую активность антитела по настоящему изобретению, например, с помощью известных способов, таких как ELISA, Вестерн-блоттинг и т.д.

В другом аспекте анализы конкуренции могут использоваться для идентификации антитела, которое конкурирует за связывание с NRP1 с любым антителом по настоящему изобретению (например, антителом против NRP1-7130, описываемым ниже). В некоторых вариантах осуществления такое конкурирующее антитело связывается с тем же эпитопом (например, линейным или конформационным эпитопом), с которым связывается любое антитело по настоящему изобретению (например, антителом против NRP1-7130, описываемым ниже). Изложенные подробно, приводимые в качестве примера способы картирования эпитопа, с которым связывается антитело, представлены в Morris (1996) "Epitope Mapping Protocols," in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).

В приводимом в качестве примера анализе конкуренции иммобилизованный NRP1 инкубируют в растворе, содержащем первое меченое антитело, которое связывается с NRP1 (например, антитело против NRP1 - 7130, описываемое ниже) и второе немеченое антитело, способность которого к конкуренции с первым антителом за связывание с NRP1 проверяют. Второе антитело может присутствовать в супернатанте гибридомы. В качестве контроля, иммобилизованный NRP1 инкубируют в растворе, содержащем первое меченое антитело, но не второе немеченое антитело. После инкубации в условиях, допускающих связывание первого антитела с NRP1, избыточное количество не связавшегося антитела удаляют, и определяют количество метки, связавшейся с иммобилизованным NRP1. Если количество метки, связавшейся с иммобилизованным NRP1, является существенно уменьшенным в исследуемом образце относительно контрольного образца, то это означает, что второе антитело конкурирует с первым антителом за связывание с NRP1. См. Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).

2. Анализы на обнаружение

В одном из аспектов изобретение относится к анализам для идентификации антител против NRP1, применимых для обнаружения NRP1, например, в иммуногистохимических исследованиях. В некоторых вариантах осуществления антитело по настоящему изобретению проверяют в отношении такой активности.

D. Иммуноконъюгаты

Настоящее изобретение также относится к иммуноконъюгатам, содержащим антитело по настоящему изобретению против NRP1, конъюгированное с одним или более средств, таких как радиоактивные изотопы.

В одном из вариантов осуществления иммуноконъюгат содержит описываемое в настоящем описании антитело, конъюгированное с радиоактивным атомом для образования радиоконъюгата. Для получения радиоконъюгатов в наличии имеется множество радиоактивных изотопов. Примеры включают At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu. При использовании радиоконъюгата для обнаружения он может содержать радиоактивный атом в случае сцинтиграфических исследований, например tc99m или I123, или спин-метку в случае ядерного магнитного резонанса (ЯМР) (также известного как магнитный резонанс), такую как снова иод-123, иод-131, индий-111, фтор-19, углерод-13, азот-15, кислород-17, гадолиний, марганец или железо.

E. Способы и композиции для диагностирования и обнаружения

В некоторых вариантах осуществления любое антитело против NRP1 по настоящему изобретению применимо для обнаружения NRP1 в биологическом образце. Используемый в настоящем описании термин «обнаружение» охватывает количественное и качественное обнаружение. В некоторых вариантах осуществления биологический образец содержит клетку или ткань от нормальных пациентов или больных раком, такую как, например, нормальная и раковая ткань молочной железы, ободочной кишки, легкого, почки, кости, головного мозга, желудка, поджелудочной железы, мочевого пузыря, яичника, матки, а также сердца, эмбриональная и плацентарная ткань.

В одном из вариантов осуществления изобретение относится к антителу против NRP1 для применения в способе диагностирования или обнаружения. В другом аспекте изобретение относится к способу обнаружения NRP1 в биологическом образце. В некоторых вариантах осуществления способ предусматривает приведение биологического образца в контакт с антителом против NRP1, описываемым в настоящем описании, в условиях, допускающих связывание антитела против NRP1 с NRP1, и определение того, образуется ли комплекс между антителом против NRP1 и NRP1. Такой способ может быть in vitro или in vivo способом. В одном из вариантов осуществления антитело против NRP1 используется для отбора индивидов, приемлемых для терапии с использованием антитела против NRP1, например, если NRP1 является биомаркером для отбора пациентов.

В некоторых вариантах осуществления изобретение относится к меченым антителам против NRP1. Метки включают, но ими не ограничиваются, метки и составляющие, которые можно обнаружить непосредственно (такие как флуоресцентные, хромофорные, электронно-плотные, хемилюминесцентные и радиоактивные метки), а также такие составляющие, как ферменты или лиганды, которые выявляют опосредованно, например, через ферментативную реакцию или молекулярное взаимодействие. Приводимые в качестве примера метки включают, но без ограничения, радиоизотопы 32P, 14C, 125I, 3H и 131I, флуорофоры, такие как хелаты редкоземельных элементов или флуоресцеин и его производные, родамин и его производные, дансил, умбеллиферон, люциферазы, например, люциферазу светляков и бактериальную люциферазу (патент США № 4737456), люциферин, 2,3-дигидрофталазиндионы, пероксидазу хрена (HRP), щелочную фосфатазу, β-галактозидазу, глюкоамилазу, лизоцим, сахаридоксидазы, например, глюкозооксидазу, галактозооксидазу и глюкозо-6-фосфат-дегидрогеназу, гетероциклические оксидазы, такие как уриказа и ксантиноксидаза, связанные с ферментом, который использует перекись водорода для окисления предшественника красителя, таким как HRP, лактопероксидаза или микропероксидаза, биотин/авидин, спин-метки, бактериофаговые метки, стабильные свободные радикалы и т.п.

Понятно, что любой из вышеуказанных способов диагностирования и/или обнаружения можно выполнить, используя иммуноконъюгат по настоящему изобретению вместо антитела против NRP1 или помимо него.

III. ПРИМЕРЫ

Ниже приведены примеры способов и композиций по настоящему изобретению. Понятно, что различные другие варианты можно осуществить на практике, принимая во внимание общее описание, приведенное выше.

Пример 1. Создание моноклональных антител кролика против NRP1

200 мкг растворимого антигена NRP1 человека вводили белым новозеландским кроликам, используя соотношение 1:1 антигена к полному адъюванту Фрейнда, с последующей бустер-иммунизацией раз в две недели 100 мкг растворимого антигена NRP1 человека для каждого кролика. Селезенку одного из кроликов вырезали, и клетки селезенки сливали с клетками миеломы кролика, используя стандартные методы. Результирующие супернатанты гибридом скринировали с помощью ELISA, используя растворимый антиген NRP1, и положительные клоны в дальнейшем скринировали на предмет реактивности в отношении клеток эмбриональной почки человека HEK-293, трансфицированных NRP1 человека или пустым вектором (в качестве контроля). Клоны-кандидаты наращивали, субклонировали методом предельного разведения и вновь исследовали с помощью ELISA, как указано выше. Моноклональное антитело против NRP1 - 7130 было получено и секвенировано. Последовательности тяжелой и легкой цепей являются следующими:

Тяжелая цепь:

Легкая цепь:

Пример 2. Иммуногистохимическое исследование, используя моноклональное антитело против NRP1

Иммуногистохимическое исследование (IHC) было выполнено на свежесделанных срезах тканей, следуя стандартной процедуре. Срезы тканей инкубировали с первым антителом (моноклональным антителом против NRP1 - 7130) в концентрации 1 мкг/мл с последующими стандартными отмывками и дополнительным обнаружением с помощью антикроличьего биотинилированного антитела козы (Vector lab) и Vectastain® ABC-HRP Elite. Специфичность антитела против NRP1 оценивали, используя клетки HEK-293, трансфицированные NRP1 человека и пустым вектором в качестве контроля (см. фиг. 1A и 1B). Для оценки экспрессии целые срезы оценивали полуколичественно по шкале от нуля (нет экспрессии) до трех (очень сильный сигнал), в соответствии с интенсивностью отложения хромогена в ≥10% неопластических клеток или эндотелия. На фиг. 1C и 1D представлено IHC срезов тканей нормальной почки и нормальной плаценты, соответственно, окрашенных моноклональным антителом против NRP1 - 7130. На фиг. 2A-C представлено IHC срезов тканей, окрашенных моноклональным антителом против NRP1 - 7130, от пациентов с колоректальным раком, с раком молочной железы и немелкоклеточным раком легкого, соответственно.

Хотя вышеприведенное изобретение описано подробно для иллюстрации и для ясности понимания, описание и примеры не следует рассматривать как ограничение объема по настоящему изобретению. Описание всей патентной и научной литературы, на которую в настоящем описании ссылаются, включено в полном объеме в качестве ссылки.

1. Выделенное антитело или его фрагмент, которые связываются с нейропилином 1 (NRP1), содержащие:
(a) HVR-H1, содержащий аминокислотную последовательность SEQ ID NO: 3,
(b) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO: 4,
(c) HVR-H3, содержащий аминокислотную последовательность SEQ ID NO: 5,
(d) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO: 8,
(e) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO: 9, и
(f) HVR-L3, содержащий аминокислотную последовательность SEQ ID NO: 10.

2. Антитело или его фрагмент по п. 1, содержащие:
(a) последовательность VH, которая по крайней мере на 95% идентична аминокислотной последовательности SEQ ID NO: 2; и
(b) последовательность VL, которая по крайней мере на 95% идентична аминокислотной последовательности SEQ ID NO: 7.

3. Выделенное антитело или его фрагмент, которые связываются с нейропилином 1 (NRP1), содержащие
последовательность VH SEQ ID NO: 2 и
последовательность VL SEQ ID NO: 7.

4. Антитело или его фрагмент по любому из пп. 1-3, которые являются антителом изотипа IgG1 или его фрагментом.

5. Выделенная нуклеиновая кислота, кодирующая антитело или его фрагмент по любому из пп. 1-4.

6. Клетка-хозяин для экспрессии антитела или его фрагмента по любому из пп. 1-4, где клетка-хозяин содержит нуклеиновую кислоту по п. 5.

7. Способ получения антитела или его фрагмента по любому из пп. 1-4, где способ включает культивирование клетки-хозяина по п. 6, так что продуцируется антитело или его фрагмент.

8. Иммуноконъюгат, содержащий антитело или его фрагмент по любому из пп. 1-4 и группу лекарственного средства, группу линкер-лекарственное средство, цитотоксическое средство или радиоактивный атом.

9. Антитело или его фрагмент по любому из пп. 1-4 для применения для обнаружения NRP1 в биологическом образце.

10. Антитело или его фрагмент по п. 9, где обнаружение NRP1 проводят путем иммуногистохимического исследования.

11. Способ обнаружения NRP1 в биологическом образце, который предусматривает приведение биологического образца в контакт с антителом или его фрагментом по любому из пп. 1-4 и обнаружение присутствия связанного антитела или его фрагмента.

12. Способ по п. 11, где обнаружение NRP1 выявляют иммуногистохимическим исследованием.



 

Похожие патенты:

Настоящее изобретение относится к области биохимии. Предложены способы скрининга антитела IgG, обладающего повышенной способностью элиминировать антиген в плазме, основанные на отборе IgG, антигенсвязывающая активность которого при рН от 6,7 до 10,0 выше антигенсвязывающей активности при рН от 4,0 до 6,5.

Изобретение относится к биохимии. Описано моноклональное гуманизированное антитело, которое специфически связывается с внеклеточным доменом рецепторной тирозинкиназы AXL и которое, по меньшей мере, частично ингибирует активность AXL.

Настоящее изобретение относится к области биотехнологии и раскрывает группу гуманизированных рекомбинантных антител, специфически связывающихся с человеческим CDCP1.

Изобретение относится к области иммунологии. Представлены вариантные выделенные антитела 2.9D10, 2.7A4, 2.14H9 и 2.14H9-opti и их антигенсвязывающие фрагменты, которые специфически связывается с В7-Н1, где каждое антитело или его антигенсвязывающий фрагмент содержит набор из 6 CDR, последовательности которых представлены в описании.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антигенсвязывающий фрагмент, способные связываться с дельта-подобным лигандом 4 (DLL4) человека, в том числе в форме меченого антитела или его антигенсвязывающего фрагмента, конструкции с константным доменом иммуноглобулина, конъюгата с терапевтическим или цитотоксическим средством и в кристаллизованной форме.

Настоящее изобретение относится к области иммунологии. Предложено антитело против фракталкина (ФКН, CX3CL1) и его фракталкин-связывающий фрагмент, охарактеризованные последовательностями вариабельных доменов.

Изобретение относится к области иммунологии. Предложены выделенное антитело-антагонист против FGFR3 и его функциональный фрагмент, а также полинуклеотид, вектор экспрессии, клетка-хозяин и способ получения антитела против FGFR3 или его функционального фрагмента.

Изобретение относится к области биохимии, в частности к антителам к человеческому CSF-1R, способам их получения, фармацевтическим композициям, содержащим указанные антитела, и вариантам их применения.

Изобретение относится к области иммунологии. Представлено выделенное антитело или его антиген-связывающая часть, содержащие вариабельную область легкой цепи и вариабельную область тяжелой цепи с аминокислотными последовательностями, раскрытыми в описании, или с аминокислотными последовательностями вариабельных областей, по меньшей мере на 90% идентичными указанным последовательностям, где вариабельная область легкой цепи содержит CDR1: RASESVEYYGTSLMQ, CDR2: GASNVES и CDR3: QQSRKLPWT, и вариабельная область тяжелой цепи содержит CDR1: TYGIN, CDR2: WIYPRDGSTNFNENFKD и CDR3: LTGGTFLDY, где антитело или его антиген-связывающая часть специфически связывают внеклеточный домен Toll-подобного рецептора 2 и являются антагонистом функции Toll-подобного рецептора 2.

Изобретение относится к области биотехнологии и иммунологии. Описаны выделенное моноклональное антитело и его антиген-связывающий фрагмент, связывающие hNKG2D и поперечно сшивающие не более двух димеров hNKG2D при добавлении к NK или Т клеткам, экспрессирующим NKG2D, включающие: CDR1 тяжелой цепи, содержащий SYYWS; CDR2 тяжелой цепи, содержащий HISYSGSANYNPSLKS; и CDR3 тяжелой цепи, содержащий WDDAFNI; и CDR1 легкой цепи, содержащий RASQSVSSSYLA; CDR2 легкой цепи, содержащий GASSRAT; и CDR3 легкой цепи, содержащий QQYGSSPWT.

Изобретение относится к биотехнологии и иммунологии. Предложены варианты выделенного антитела или его фрагмента, которые специфично связываются с внеклеточным доменом CXCR5 человека. Описаны: фармацевтическая композиция, а также варианты способа лечения пациента, использующие указанные антитело или его фрагмент для лечения заболевания или состояния, вызванного или связанного с CXCR5 человека. Предложена выделенная кодирующая молекула нуклеиновой кислоты, экспрессионный вектор на ее основе и клетка-хозяин для экспрессии антитела или его фрагмента, содержащая указанный вектор. Использование изобретения обеспечивает новые антитела, которые специфично связываются с внеклеточным доменом CXCR5 и блокируют связывание лиганда CXCL13 c CXCR5 человека, что может найти применение в медицине для лечения болезней или нарушений, связанных или вызванных CXCR5. 7 н. и 14 з.п. ф-лы, 2 табл., 19 пр.

Изобретение относится к области биотехнологии и иммунологии и представляет собой способ изготовления биспецифического антитела, которое содержит: а) тяжелую цепь и легкую цепь первого антитела полной длины, которое специфически связывается с первым антигеном; и б) тяжелую цепь и легкую цепь второго антитела полной длины, которое специфически связывается со вторым антигеном, где N-конец тяжелой цепи связан с С-концом легкой цепи через пептидный линкер, причем каждый из СН3-домена тяжелой цепи антитела полной длины а) и СН3-домена тяжелой цепи антитела полной длины б) встречается на контактной поверхности, которая включает изменения в исходной контактной поверхности СН3-доменов антитела; где изменения в СН3-доменах тяжелых цепей представляют собой изменения типа «ключ-замок»; где указанный способ включает этапы: а) трансформации клетки-хозяина векторами, содержащими нуклеиновокислотные молекулы, кодирующие указанную молекулу биспецифического антитела, б) культивирования клетки-хозяина в условиях, обеспечивающих синтез указанной молекулы биспецифического антитела; и в) извлечения указанной молекулы биспецифического антитела из указанной культуры. Изобретение позволяет получать биспецифические антитела с указанной выше структурой с высоким выходом и чистотой. 16 з.п. ф-лы, 10 ил., 6 табл., 11 пр.

Изобретение относится к области иммунологии. Представлены вариантные выделенные анти-CXCR4-антитела 414H5, 515H7 и их антигенсвязывающие фрагменты, способные ингибировать активацию CXCR4, где каждое антитело или его антигенсвязывающий фрагмент содержит набор из 6 CDR, последовательности, которых представлены в описании. Описаны: нуклеиновая кислота, кодирующая указанное антитело, вектор для получения анти-CXCR4-антитела и клетка-хозяин, продуцирующая указанное антитело против CXCR4, трансфицированная указанным вектором. Предложен способ получения анти-CXCR4-антитела или его функционального фрагмента по настоящему изобретению, включающий: культивирование указанной клетки-хозяина в среде в соответствующих культуральных условиях; и выделение указанного антитела или одного из его функциональных фрагментов. Раскрыта фармацевтическая композиция, содержащая в качестве активного ингредиента указанное антитело или его функциональный фрагмент в эффективном количестве, а также эксципиент и/или фармацевтически приемлемый носитель. Изобретение позволяет получить антитела против CXCR4, модулирующие пространственную конформацию димеров CXCR4/CXCR4 и CXCR2/CXCR4 при раковых заболеваниях. 9 н. и 14 з.п. ф-лы, 23 ил., 5 табл., 24 пр.

Предложенное изобретение относится к области иммунологии. Предложено антитело против CXCR4 человека или его функциональный фрагмент, которые характенизуются тем, что содержат легкую и тяжелую цепи, содержащие по 3 соответствующих CDR. Описаны варианты нуклеиновых кислот для экспрессии антитела; вектор для экспрессии антитела на основе указанной НК, клетка-хозяин для получения антитела, содержащая указанный вектор, и способ получения антитела, использующий культивирование клетки. Раскрыта фармацевтическая композиция, способная связывать CXCR4 человека на основе антитела. Описан способ скрининга и/или идентификации молекул в качестве антивирусных средств-антагонистов CXCR4. Использование изобретения обеспечивает антитела, которые могут найти применение в терапии ВИЧ-инфекции. 7 н. и 6 з.п. ф-лы, 22 ил., 11 табл., 16 пр.

Группа изобретений относится к медицине, а именно к онкологии, и может быть использована для получения лекарственного средства для лечения рака. Для этого применяют нефукозилированное анти-CD20 антитело с количеством фукозы 60% или менее от общего количества олигосахаридов (сахаров) в положении Asn297 в комбинации с бендамустином. При этом раком является рак, экспрессирующий CD20, и указанное антитело включает аминокислотную последовательность вариабельной области тяжелой цепи (VH) SEQ ID NO: 7 и аминокислотную последовательность вариабельной области легкой цепи (VL) SEQ ID NO: 20, также предложен способ лечения рака, экспрессирующего CD20. Группа изобретений обеспечивает лечение рака у пациентов за счет синергетического действия комбинации нефукозилированного анти-CD20 антитела с бендамустином. 2 н. и 8 з.п. ф-лы, 3 табл., 1 ил.

Настоящее изобретение относится к области биотехнологии. Предложен способ идентификации антитела, которое специфически связывается с интересующим антигеном на клеточной поверхности, предусматривающий иммунизацию животного вектором экспрессии, кодирующим антиген клеточной поверхности; приведение в контакт клеток, содержащих на своей поверхности антитела и выделенных из животного, подвергнутого иммунизации, причем антитела связаны с первой сортируемой меткой, с клетками, экспрессирующими антиген, связанный со второй сортируемой меткой; определение специфического связывания с использованием клеточного сортера по наличию первой и второй сортируемой метки в клеточном комплексе; а также идентификацию участков, определяющих комплементарность с антигеном (CDR), у идентифицированного антитела и прививку CDR на каркасную область акцепторного антитела. Данное изобретение предполагает скрининг антител, специфичных в отношении мембраносвязанных антигенов, что может найти дальнейшее применение в разработке терапевтических и диагностических средств. 3 з.п. ф-лы, 8 ил., 5 табл., 5 пр.

Данное изобретение относится к области иммунологии. Предложено выделенное антитело или его фрагмент, которые связываются с Axl человека и охарактеризованные последовательностями гипервариабельных участков (CDR). Также рассмотрены: нуклеиновая кислота; клетка-хозяин и способ получения антитела или его фрагмента по изобретению. Кроме того, представлены: иммуноконъюгат, содержащий антитело или его фрагмент по изобретению и цитотоксическое средство; фармацевтический состав для нацеливания на патологические состояния, связанные с экспрессией и/или активностью каскадов передачи сигнала Axl; и применение антитела или его фрагмента по изобретению для получения лекарственных средств для лечения злокачественной опухоли и для ингибирования конститутивной активации Axl. Настоящее изобретение может найти дальнейшее применение в терапии заболеваний, связанных с Axl. 8 н. и 10 з.п. ф-лы, 12 ил., 1 табл.

Изобретение относится к области биотехнологии и иммунологии. Предложены новые противораковые антитела, которые связываются с рецептором “frizzled” человека. Также идентифицированы новые эпитопы в составе рецепторов “frizzled” человека, которые являются подходящими мишенями для противораковых агентов. Кроме того, предложены способы применения антител для ингибирования сигнального пути через Wnt и/или ингибирования роста опухоли. Предложенная группа изобретений может быть использована в медицине. 12 н. и 8 з.п.ф-лы, 46 ил., 15 табл., 25 пр.

Изобретение относится к области биохимии, в частности к антителам, которые связывают Notch2. Заявлены моноклональные антитела, которые специфически связываются с доменом Lin12/Notch Repeat (LNR)-А и доменом гетеродимеризации (HD)-С отрицательной регуляторной области (NRR) Notch2 и ингибируют передачу сигнала Notch2. Также изобретение относится к способам применения этих антител. Изобретение позволяет использовать антитела, связывающие Notch2, для лечения нарушения, ассоциированного с повышенной экспрессией или передачей сигнала Notch2, такого как злокачественная опухоль. 9 н. и 28 з.п. ф-лы, 47 ил., 1 табл.

Изобретение относится к биохимии. Представлено модифицированное антитело, используемое для конъюгации с лекарственными веществами, которое на С-конце молекулы содержит цистеин-содержащий мотив, имеющий структуру, представленную формулой 1, приведенную в материалах заявки. Также представлен конъюгат указанного антитела и лекарственного средства и способы его получения. Изобретение расширяет арсенал терапевтических средств. 5 н. и 14 з.п. ф-лы, 8 ил., 1 табл., 7 пр.
Наверх