Способ сбора функциональных клеток in vivo с высокой эффективностью



Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью
Способ сбора функциональных клеток in vivo с высокой эффективностью

 


Владельцы патента RU 2571230:

ДЖЕНОМИКС КО., ЛТД. (JP)
ОСАКА ЮНИВЕРСИТИ (JP)

Представленная группа изобретений относится к области биотехнологии и касается способов сбора функциональных клеток (варианты). Охарактеризованные решения заключаются в имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель, где популяция клеток мобилизована в емкость с помощью любого из белков HMGB1, HMGB2, HMGB3, S100A8, S100A9 или гиалуроновой кислоты или смеси любых двух или более из указанных. Указанные факторы обладают активностью привлечения конкретных функциональных клеток в организм. Представленные изобретения позволяют эффективно и безопасно собирать биологически функциональные клетки, в частности, такие как стволовые клетки. 6 н. и 1 з.п. ф-лы, 37 ил., 1 табл., 12 пр.

 

Техническая область

Настоящее изобретение относится к новым высокоэффективным и минимально инвазивным способам сбора функциональных клеток, таких как стволовые клетки, которые существуют in vivo в крайне малом количестве.

Уровень техники

Общепринятые способы сбора высокофункциональных клеток из живого организма включают, например, способы сбора гемопоэтических стволовых клеток костного мозга, в которых осуществляют взятие костномозговой жидкости из костного мозга трубчатой кости или кости таза путем прямого введения иглы в костный мозг, и для введения человеку популяцию стволовых клеток концентрируют центрифугированием, и с помощью клеточного сортера собирают и подтверждают флуоресцентно меченные клетки с использованием в качестве индикатора поверхностных маркеров стволовых клеток; способы сбора стволовых клеток периферической крови, в которых осуществляют вовлечение гемопоэтических стволовых клеток в периферическую кровь путем введения G-CSF, отбирают периферическую кровь и выделяют гемопоэтические стволовые клетки из крови; и способы сбора мезенхимальных стволовых клеток, в которых мезенхимальные стволовые клетки выделяют путем сбора прикрепленных пролиферирующих клеток из прямой культуры жидкости костного мозга, или мезенхимальные стволовые клетки выделяют и культивируют из взятых хирургическим путем периферических тканей, таких как жировые ткани. Однако взятие костномозговой жидкости из костного мозга является в высокой степени инвазивным и болезненным, и вовлекает риск миелита вследствие внутрикостномозговой инфекции. Таким образом, данная процедура требует строгого медицинского контроля экспертами, и ее нельзя проводить часто. Взятие хирургическими способами периферических тканей также имеет такой же риск. Мобилизация гемопоэтических стволовых клеток с использованием G-CSF налагает большое экономическое бремя, и ее также нельзя проводить часто.

Совершенно очевидно, что создание эффективных и безопасных способов сбора биологически функциональных клеток может стать обнадеживающей новостью для многих пациентов, которые страдают трудноизлечимыми заболеваниями и нуждаются в таких клетках.

Документы уровня техники

Непатентные документы

Непатентный документ 1: Transplantation of hematopoietic stem cells from the peripheral blood. J. Cell Mol. Med. 2005; 9: 37-50

Непатентный документ 2: Role of mesenchymal stem cells in regenerate medicine: application to bone and cartilage repair. Expert Opin. Biol. Ther. 2008; 8: 255-268

Описание изобретения

Задачи, решаемые изобретением

Задачей настоящего изобретения является предоставление новых высокоэффективных и минимально инвазивных способов сбора функциональных клеток, таких как стволовые клетки, которые существуют in vivo в крайне малом количестве.

Средства для решения задач

Настоящее изобретение относится к совершенно новым высокоэффективным способам взятия биологически функциональных клеток путем только имплантации трубки в живой организм минимально инвазивным способом.

Конкретно, цилиндрические трубки (которые имеют длину 10 мм и площадь поперечного сечения 2 мм2 и являются открытыми с одной стороны и закрытыми с другой стороны), изготовленные из биологически гипоаллергенного силикона, заполняли каждым из HMGB1, гиалуроновой кислоты, фосфатного буфера или сходными с ними, а затем имплантировали под кожу спины мышей с трансплантатом костного мозга с GFP. Трубки извлекали через две недели после имплантации, и клетки, иммобилизованные и скопившиеся в трубках, собирали. Некоторые из клеток культивировали, а другие анализировали в отношении маркеров клеточной поверхности посредством FACS. Результат показывает, что по сравнению с трубками, заполненными фосфатным буфером, значительно большее количество PDGFRα-положительных клеток собирали из пробирок, заполненных средством, отличным от фосфатного буфера, и эти популяции клеток содержали мезенхимальные стволовые клетки, способные дифференцироваться в кость и хрящ.

Исходя из описанных выше открытий, настоящее изобретение относится к следующему:

[1] способ сбора популяции клеток из емкости, удаленной из-под кожи организма;

[2] способ сбора популяции клеток из емкости, извлеченной из-под кожи организма, где клеточная популяция вовлечена в емкость одним из материалов (a)-(r), описанных ниже, или смесью любых двух или более из материалов согласно (a)-(r), описанным ниже:

(a) белок HMGB1;

(b) клетка, которая секретирует белок HMGB1;

(c) вектор, в который встроена ДНК, кодирующая белок HMGB1;

(d) белок HMGB2;

(e) клетка, которая секретирует белок HMGB2;

(f) вектор, в который встроена ДНК, кодирующая белок HMGB2;

(g) белок HMGB3;

(h) клетка, которая секретирует белок HMGB3; и

(i) вектор, в который встроена ДНК, кодирующая белок HMGB3;

(j) белок S100A8;

(k) клетка, которая секретирует белок S100A8;

(l) вектор, в который встроена ДНК, кодирующая белок S100A8;

(m) белок S100A9;

(n) клетка, которая секретирует белок S100A9;

(o) вектор, в который встроена ДНК, кодирующая белок S100A9;

(p) гиалуроновая кислота;

(q) экстракт клетки или ткани; и

(r) гепарин-связывающая фракция экстракта клеток или тканей;

[3] способ сбора клетки костного мозга, который включает стадию выделения клетки костного мозга из популяции клеток, собранной из емкости, имплантированной под кожу;

[4] способ сбора клетки костного мозга, который включает стадию выделения клетки костного мозга из популяции клеток, собранной из емкости, имплантированной под кожу, где популяция клеток вовлечена в емкость с помощью любого из материалов (a)-(r), описанных ниже, или смеси любых двух или более из материалов (a)-(r), описанных ниже:

(a) белок HMGB1;

(b) клетка, которая секретирует белок HMGB1;

(c) вектор, в который встроена ДНК, кодирующая белок HMGB1;

(d) белок HMGB2;

(e) клетка, которая секретирует белок HMGB2;

(f) вектор, в который встроена ДНК, кодирующая белок HMGB2;

(g) белок HMGB3;

(h) клетка, которая секретирует белок HMGB3; и

(i) вектор, в который встроена ДНК, кодирующая белок HMGB3;

(j) белок S100A8;

(k) клетка, которая секретирует белок S100A8;

(l) вектор, в который встроена ДНК, кодирующая белок S100A8;

(m) белок S100A9;

(n) клетка, которая секретирует белок S100A9;

(o) вектор, в который встроена ДНК, кодирующая белок S100A9;

(p) гиалуроновая кислота;

(q) экстракт клетки или ткани; и

(r) гепарин-связывающая фракция экстракта клеток или тканей;

[5] способ согласно [3] или [4], который включает стадию сбора популяции клеток из емкости, извлеченной из организма, перед стадией выделения клетки костного мозга из популяции клеток;

[6] способ согласно [2] или [4], где экстракт клетки или ткани получают способом, включающим стадию погружения клетки или ткани в растворитель;

[7] способ согласно [2] или [4], где гепарин-связывающую фракцию экстракта клетки или ткани получают способом, включающим стадии

(a) погружения клетки или ткани в растворитель;

(b) контактирования иммобилизованного гепарина с экстрактом, полученным на стадии (a); и

(c) элюирования гепарин-связывающей фракции с иммобилизованного гепарина;

[8] популяция клеток, собранная способом согласно любому из [1], [2], [6] и [7];

[9] клетка костного мозга, выделенная способом по любому из [3]-[7];

[10] средство для регенерации тканей, содержащее популяцию клеток согласно [8];

[11] средство для регенерации тканей, содержащее клетку костного мозга согласно [9];

[12] способ сбора популяции клеток, который включает стадии

(I) имплантации емкости под кожу; и

(II) сбора популяции клеток из емкости;

[13] способ согласно [12], который включает стадию введения любого из (a)-(r) или смеси любых двух или более из (a)-(r) в кровеносный сосуд или мышцу после стадии (I):

(a) белок HMGB1;

(b) клетка, которая секретирует белок HMGB1;

(c) вектор, в который встроена ДНК, кодирующая белок HMGB1;

(d) белок HMGB2;

(e) клетка, которая секретирует белок HMGB2;

(f) вектор, в который встроена ДНК, кодирующая белок HMGB2;

(g) белок HMGB3;

(h) клетка, которая секретирует белок HMGB3;

(i) вектор, в который встроена ДНК, кодирующая белок HMGB3;

(j) белок S100A8;

(k) клетка, которая секретирует белок S100A8;

(l) вектор, в который встроена ДНК, кодирующая белок S100A8;

(m) белок S100A9;

(n) клетка, которая секретирует белок S100A9;

(o) вектор, в который встроена ДНК, кодирующая белок S100A9;

(p) гиалуроновая кислота;

(q) экстракт клетки или ткани; и

(r) гепарин-связывающая фракция экстракта клетки или ткани;

[14] способ согласно [12], в котором емкость содержит любой один или смесь любых двух или более из следующего:

(a) белок HMGB1;

(b) клетка, которая секретирует белок HMGB1;

(c) вектор, в который встроена ДНК, кодирующая белок HMGB1;

(d) белок HMGB2;

(e) клетка, которая секретирует белок HMGB2;

(f) вектор, в который встроена ДНК, кодирующая белок HMGB2;

(g) белок HMGB3;

(h) клетка, которая секретирует белок HMGB3;

(i) вектор, в который встроена ДНК, кодирующая белок HMGB3;

(j) белок S100A8;

(k) клетка, которая секретирует белок S100A8;

(l) вектор, в который встроена ДНК, кодирующая белок S100A8;

(m) белок S100A9;

(n) клетка, которая секретирует белок S100A9;

(o) вектор, в который встроена ДНК, кодирующая белок S100A9;

(p) гиалуроновая кислота;

(q) экстракт клетки или ткани; и

(r) гепарин-связывающая фракция экстракта клетки или ткани;

[15] способ сбора клетки костного мозга, который включает стадии

(I) имплантации емкости под кожу;

(II) сбора популяции клеток из емкости; и

(III) выделения клетки костного мозга из собранной популяции клеток;

[16] способ согласно [15], который включает стадию введения любого одного из (a)-(r) или смеси любых двух или более из (a)-(r) в кровеносный сосуд или мышцу после стадии (I):

(a) белок HMGB1;

(b) клетка, которая секретирует белок HMGB1;

(c) вектор, в который встроена ДНК, кодирующая белок HMGB1;

(d) белок HMGB2;

(e) клетка, которая секретирует белок HMGB2;

(f) вектор, в который встроена ДНК, кодирующая белок HMGB2;

(g) белок HMGB3;

(h) клетка, которая секретирует белок HMGB3;

(i) вектор, в который встроена ДНК, кодирующая белок HMGB3;

(j) белок S100A8;

(k) клетка, которая секретирует белок S100A8;

(l) вектор, в который встроена ДНК, кодирующая белок S100A8;

(m) белок S100A9;

(n) клетка, которая секретирует белок S100A9;

(o) вектор, в который встроена ДНК, кодирующая белок S100A9;

(p) гиалуроновая кислота;

(q) экстракт клетки или ткани; и

(r) гепарин-связывающая фракция экстракта клеток или тканей;

[17] способ согласно [15], в котором емкость содержит любой один, или смесь любых двух или более из следующего:

(a) белок HMGB1;

(b) клетка, которая секретирует белок HMGB1;

(c) вектор, в который встроена ДНК, кодирующая белок HMGB1;

(d) белок HMGB2;

(e) клетка, которая секретирует белок HMGB2;

(f) вектор, в который встроена ДНК, кодирующая белок HMGB2;

(g) белок HMGB3;

(h) клетка, которая секретирует белок HMGB3;

(i) вектор, в который встроена ДНК, кодирующая белок HMGB3;

(j) белок S100A8;

(k) клетка, которая секретирует белок S100A8;

(l) вектор, в который встроена ДНК, кодирующая белок S100A8;

(m) белок S100A9;

(n) клетка, которая секретирует белок S100A9;

(o) вектор, в который встроена ДНК, кодирующая белок S100A9;

(p) гиалуроновая кислота;

(q) экстракт клетки или ткани; и

(r) гепарин-связывающая фракция экстракта клеток или тканей;

[18] способ согласно любому из [13], [14], [16] и [17], в котором экстракт клетки или ткани получают способом, включающим стадию погружения клетки или ткани в растворитель;

[19] способ согласно любому из [13], [14], [16] и [17], в котором гепарин-связывающую фракцию экстракта клетки или ткани получают способом, включающим стадии

(a) погружения клетки или ткани в растворитель;

(b) контактирования иммобилизованного гепарина с экстрактом, полученным на стадии (a); и

(c) элюирования гепарин-связывающей фракции с иммобилизованного гепарина;

[20] популяция клеток, собранная способом согласно любому из [12]-[14];

[21] клетка костного мозга, выделенная способом согласно любому из [15]-[17];

[22] средство для регенерации тканей, содержащее популяцию клеток согласно [20]; и

[23] средство для регенерации тканей, содержащее клетку костного мозга согласно [21].

Краткое описание фигур

На фиг.1 представлена схема высокоэффективного способа сбора биологически функциональных клеток. Гипоаллергенную трубку (силиконовую трубку или сходную с ней), заполненную фактором, который специфично привлекает биологически функциональные клетки, помещают в организм. В результате функциональные клетки селективно вовлекаются в трубку из периферического кровотока или ткани.

На фиг.2 представлена фотография, на которой показано, что клетки, скопившиеся в трубке (улавливающиеся в трубку клетки; TEC), являются GFP-положительными.

На фиг.3 представлен набор фотографий TEC через 24 часа после начала культивирования. На левой фотографии показано изображение светового поля с пролиферирующими фибробластоподобными клетками и клетками, подобными эпителиальными клеткам, прикрепившимися к пластмассовой культуральной чашке. На правой фотографии представлено изображение флуоресценции GFP в темном поле.

На фиг.4 представлен набор фотографий для оценки TEC, собранных из трубки, в отношении их способности дифференцироваться в остеобласты. Клетки, собранные из трубки, культивировали в индуцирующей дифференцировку остеобластов культуральной среде, и было подтверждено, что они дифференцируются в остеобласты, положительные по красителю ализарину красному, приблизительно за две недели.

На фиг.5 представлен набор фотографий для оценки TEC, собранных из трубки, в отношении их способности дифференцироваться в адипоциты. Клетки, собранные с трубки, культивировали в индуцирующей дифференцировку адипоцитов культуральной среде, и было подтверждено, что они дифференцируются в адипоциты, положительные по красителю масляному красному, приблизительно за две недели.

На фиг.6 представлен набор фотографий для оценки TEC, собранных с трубки, в отношении их способности дифференцироваться в эпидермальные клетки. Клетки, собранные с трубки, культивировали в индуцирующей рост эпидермальных клеток культуральной среде, и было подтверждено, что они дифференцируются в эпидермальные клетки, экспрессирующие кератиноцит-специфический кератин 5, приблизительно за две недели.

На фиг.7 представлен набор диаграмм для оценки экспрессии PDGFRα и CD44 на TEC. Подтверждено получение из трубки двойных положительных по PDGFRα и CD44 клеток.

На фиг.8 представлен набор фотографий, на которых показана детекция вестерн-блоттингом семейства HMGB в экстракте кожи новорожденной мыши.

На фиг.9 представлена схема экспрессирующего вектора HMGB1.

На фиг.10 представлен набор фотографий результатов вестерн-блоттинга для семейства очищенных рекомбинантных слитых белков метка Flag-HMGB, экспрессированных в клетках HEK293.

На фиг.11 представлен набор графиков, на которых показана хемотаксическая активность рекомбинантного HMGB1/HMGB2/HMGB3 в отношении костномозговых мезенхимальных стволовых клеток с использованием камеры Бойдена. Все рекомбинантные белки показали более высокую хемотаксическую активность по сравнению с контрольными группами.

На фиг.12 представлен набор графиков, на которых показан результат лечения в модели лечения кожных язв у мышей с использованием белков семейства HMGB. Все из HMGB1, HMGB2 и HMGB3 показали значимые эффекты в отношении снижения площади язвы по сравнению с контрольными группами.

На фиг.13 представлена фотография, на которой показана активность HMGB1 человека и экстракта кожи человека в отношении индукции миграции происходящих из костного мозга человека мезенхимальных стволовых клеток, подтвержденная с использованием камеры Бойдена.

На фиг.14 представлен набор фотографий, на которых показана активность активаторов, очищенных на колонке с гепарином, из экстрактов сердца, головного мозга и кожи мыши в отношении индукции мезенхимальных стволовых клеток костного мозга, подтвержденная с использованием камеры Бойдена.

На фиг.15 представлен набор фотографий, на которых показана активность экстракта культивированной клеточной линии HEK293 или HeLa в отношении индукции миграции мезенхимальных стволовых клеток костного мозга человека, подтвержденная с использованием камеры Бойдена. Обе культивированные клеточные линии показали хемотаксическую активность в отношении мезенхимальных стволовых клеток костного мозга человека.

На фиг.16A представлена фотография, на которой показана мышь, фиксированная к стереотаксическому устройству для головного мозга с разрезом головы по средней линии скальпелем, с последующей трепанацией с использованием бура. На фиг.16B представлена фотография, на которой показан головной мозг, к которому применяют отрицательное давление с использованием шприца для отсасывания части ткани головного мозга. На фиг.16C представлена фотография мыши после инъекции 5 мкл очищенной на колонке с гепарином фракции экстракта кожи, растворенного в фибриновом адгезивном составе (фибриноген), и последующей инъекции 5 мкл состава фибринового клея (тромбин). На фиг.16D и 16E представлены фотографии модели повреждения головного мозга, полученные через 2 недели после лечения. Более высокое накопление положительных по GFP клеток наблюдали в группе лечения с использованием очищенной на колонке с гепарином фракции экстракта кожи, на E, по сравнению с контролем, на D. На фиг.16F и 16G представлены фотографии модели повреждения головного мозга, полученные через 6 недель после лечения. Более высокое накопление GFP-положительных клеток наблюдали в группе лечения с использованием очищенной на колонке с гепарином фракции экстракта кожи, на G, по сравнению с контролем, на F.

На фиг.17 представлена фотография, на которой показаны результаты анализа измерения активности в отношении миграции происходящих из костного мозга мезенхимальных стволовых клеток в экстрактах кожи с использованием камеры Бойдена. На этих изображениях показаны окрашенные синим цветом мезенхимальные стволовые клетки костного мозга, мигрировавшие из верхнего отделения камеры Бойдена через микропоры размером 8 мкм мембранного фильтра из поликарбоната в нижнее отделение, содержащее экстракты кожи, и прикрепившиеся к мембране со стороны нижнего отделения. В нижние отделения были помещены экстракты кожи, взятой от мышей в возрасте двух дней или шести недель.

На фиг.18 представлен набор фотографий детекции посредством вестерн-блоттинга белков S100A8 и S100A9 в экстрактах кожи.

На фиг.19 представлена фотография, на которой показано элюирование гепарин-связывающего белка кожных экстрактов, элюированного с аффинной колонки с гепарином посредством градиента концентрации NaCl. Белки в каждой фракции разделяли посредством SDS-PAGE и подвергали детекции окрашиванием серебром.

На фиг.20 представлена фотография, на которой показаны результаты анализа по измерению активности в отношении миграции происходящих из костного мозга мезенхимальных стволовых клеток в экстракты кожи с использованием камеры Бойдена. На изображении показаны окрашенные синим цветом мезенхимальные стволовые клетки костного мозга, которые мигрировали из верхнего отделения камеры Бойдена через микропоры фильтра к каждой гепарин-связывающей фракции в экстрактах (в нижнее отделение) и прикреплялись к мембране со стороны нижнего отделения.

На фиг.21 представлен набор фотографий, на которых показана детекция вестерн-блоттингом белков S100A8 и S100A9 в каждой гепарин-связывающей фракции экстрактов кожи.

На фиг.22 представлена схема экспрессирующего вектора для S100A8 или S100A9.

На фиг.23 представлена фотография, на которой показаны результаты измерения активности в отношении миграции происходящих из костного мозга мезенхимальных стволовых клеток в экстракты кожи с использованием камеры Бойдена. На этих изображениях показаны окрашенные синим цветом мезенхимальные стволовые клетки костного мозга, которые мигрировали из верхнего отделения камеры Бойдена через микропоры фильтра в нижнее отделение, содержащее рекомбинантный GST-S100A8, GST-S100A9 или экстракты кожи, и прикреплялись к мембране со стороны нижнего отделения.

На фиг.24A представлен набор диаграмм с результатами FACS для CD44, PDGFRα и PDGFRβ в отрицательной по CD45 фракции клеток в периферической крови через 12 часов после введения GST-S100A8 или GST-S100A через хвостовую вену мыши. На фиг.24B представлены графики, на которых показан количественный анализ популяций CD45-отрицательных, CD44-положительных, PDGFRα-положительных клеток или CD45-отрицательных, CD44-положительных, PDGFRβ-положительных клеток в периферической крови через 12 часов после введения GST-S100A8 или GST-S100A, исходя из результатов FACS.

На фиг.25 представлен график, на котором показан терапевтический эффект S100A8 на кожную язву у нормальных мышей.

На фиг.26 представлен график, на котором показан терапевтический эффект S100A8 на кожную язву у диабетических мышей.

На фиг.27 представлен график, на котором показан терапевтический эффект клеток, которые привлечены в устройство с использованием экстрактов кожи или экстрактов периферической крови, на кожную язву.

На фиг.28 представлен набор фотографий, на которых показана детекция на флуоресцентном микроскопе клеток костного мозга, привлеченных в устройство с использованием связывающихся с аффинной колонкой с гепарином компонентов экстрактов периферической крови.

На фиг.29 представлен график, на котором показана детекция клеток костного мозга, привлеченных в устройство с использованием связывающихся с аффинной колонкой с гепарином компонентов экстрактов периферической крови, с помощью флуоресцентной микроскопии, и определение количества клеток костного мозга с использованием программного обеспечения для анализа изображений.

На фиг.30 представлен график, на котором показана детекция происходящих из костного мозга клеток (GFP-положительных клеток), привлеченных в устройство с использованием S100A8, HMGB1, HMGB2 или HMGB3 (A, S100A8; B, HMGB1; C, HMGB2; D, HMGB3; E, отрицательный контроль) посредством флуоресцентной микроскопии.

На фиг.31 представлен набор фотографий, на которых показан терапевтический эффект на кожную язву, развившуюся у мышей BALB/cAJcl-nu/nu, происходящих из костного мозга клеток, привлеченных в устройство с использованием S100A8, HMGB1 или HMGB2.

На фиг.32 представлена схема экспрессирующего вектора для HMGB1.

На фиг.33 представлена схема введения экстракта кожи (SE) мыши через хвостовую вену с последующим взятием периферической крови.

На фиг.34 показана диаграмма, на которой показано фракционирование посредством проточной цитометрии фракции мононуклеарных клеток периферической крови, флуоресцентно меченных антителом против PDGFRα мыши и антителом против CD44 мыши через 12 часов после введения экстракта кожи (SE). Верхние три диаграммы соответствуют группе введения PBS (n=3) в качестве отрицательного контроля, а нижние три диаграммы соответствуют группе введения экстракта кожи (SE) (n=3). Вертикальная ось указывает на уровень экспрессии CD44, а горизонтальная ось указывает на уровень экспрессии PDGFRα. Область, заключенная в рамку, соответствует популяции двойных положительных по CD44 и PDGFRα клеток. Популяция была увеличена в группе введения экстракта кожи (SE) по сравнению с группой введения PBS.

На фиг.35 представлена схема введения HMGB1 мыши через хвостовую вену с последующим взятием периферической крови.

На фиг.36 представлена схема, на которой показано фракционирование проточной цитометрией фракции мононуклеарных клеток периферической крови, флуоресцентно меченных антителом против PDGFRα мыши и антителом против CD44 мыши через 12 часов после введения HMGB1. Левая диаграмма соответствует мышам, которым вводили PBS в качестве отрицательного контроля, а правая диаграмма соответствует мышам, которым вводили HMGB1. Вертикальная ось указывает на уровень экспрессии CD44, а горизонтальная ось указывает на уровень экспрессии PDGFRα. Область, заключенная в рамку, соответствует популяции двойных положительных по CD44 и PDGFRα клеток. У мышей, которым вводили HMGB1, популяция была увеличена по сравнению с мышами, которым вводили PBS.

На фиг.37A представлена диаграмма результата проточной цитометрии, на которой показано присутствие клеток, имеющих CD44 и PDGFRα. Введение HMGB1 приводило к увеличению популяций как двойных положительных по PDGFRα и CD44 клеток, так и положительных PDGFRα, отрицательных по CD44 клеток, в периферической крови. На фиг.37B и 37C представлены результаты сравнения между группами введения PBS и HMGB1 в отношении присутствия двойных положительных по PDGFRα и CD44 клеток и положительных по PDGFRα, отрицательных по CD44 клеток в периферической крови, соответственно. Обе популяции клеток были на статистически значимом уровне увеличены в группе введения HMGB1.

Способы осуществления изобретения

Настоящее изобретение относится к способу сбора популяции клеток из емкости, извлеченной из-под кожи организма.

Также настоящее изобретение относится к способу сбора клеток костного мозга, который включает стадию выделения клетки костного мозга из популяции клеток, собранной из емкости, имплантированной под кожу. Указанный выше способ может включать стадию сбора популяции клеток из емкости, извлеченной из организма, до стадии выделения клеток костного мозга из популяции клеток.

Настоящее изобретение относится к способу сбора популяции клеток, который включает стадии

(I) имплантации емкости под кожу; и

(II) сбора популяции клеток из емкости.

Более того, настоящее изобретение относится к способу сбора клеток костного мозга, который включает стадии

(I) имплантации емкости под кожу;

(II) сбора популяции клеток из емкости; и

(III) выделения клеток костного мозга из собранной популяции клеток.

Альтернативно способы, описанные выше, могут включать после стадии (I) стадию извлечения емкости из-под кожи.

Предпочтительные материалы для описанной выше емкости включают, но не ограничиваются ими, силикон, винил, пластмассу и другие биологически гипоаллергенные материалы. При этом размер емкости, использованной в примерах, составлял 10 мм в длину × площадь поперечного сечения 2 мм (с объемом 20 мл; для мышей); однако размер не ограничен указанным выше примером при условии, что емкость можно имплантировать под кожу. Толщина стенки емкости, использованной в примерах, составляла приблизительно 0,5 мм; однако толщина не ограничена указанными выше примерами при условии, что она является достаточной для поддержания надлежащей прочности. Форма емкости, использованной в примерах, представляла собой цилиндрическую форму, открытую только с одной стороны; однако форма конкретно не ограничена при условии, что она не повреждает биологические ткани; и форма включает цилиндрическую, веретенообразную, сферическую и яйцевидную формы. Емкости, использованные по настоящему изобретению, включают силиконовые трубки, виниловые мешки и постоянные инъекционные иглы. Емкости конкретно не ограничены при условии, что они представляют собой имплантируемые медицинские материалы или устройства in vivo.

В настоящем изобретении популяции клеток, собранные из емкости, включают происходящие из костного мозга клетки.

Клетки костного мозга по настоящему изобретению представляют собой клетки, отличные от гемопоэтических стволовых клеток, или клеток, происходящих из них, таких как лейкоциты, эритроциты и тромбоциты, и они включают стволовые клетки, которым соответствуют клетки, до настоящего времени называемые мезенхимальными стволовыми клетками костного мозга, стромальными плюрипотентными стволовыми клетками костного мозга или плюрипотентными стволовыми клетками костного мозга и ткани, и популяции клеток-предшественников, существующие в костном мозге. Клетки костного мозга по настоящему изобретению можно выделять из коллекции костного мозга (коллекции клеток костного мозга) или коллекции периферической крови. Гемопоэтические стволовые клетки являются неприкрепяющимися, в то время как клетки костного мозга по настоящему изобретению получают в качестве прикрепляющихся клеток посредством клеточной культуры фракции мононуклеарных клеток крови, полученных из коллекции костного мозга (коллекции клеток костного мозга) или коллекции периферической крови. Более того, клетки костного мозга по настоящему изобретению включают мезенхимальные стволовые клетки, и они обладают потенциалом к дифференцировке, предпочтительно, в остеобласты (эту индукцию дифференцировки можно идентифицировать путем выявления кальцификации), хондроциты (которые можно идентифицировать по положительному окрашиванию альциановым синим, по положительному окрашиванию сафранином O, или сходными с ними), адипоциты (которые можно идентифицировать по положительному окрашиванию суданом III), и другие мезенхимальные клетки, такие как фибробласты, гладкомышечные клетки, стромальные клетки и клетки сухожилий; и, кроме того, нервные клетки, эпителиальные клетки (например, эпидермальные кератиноциты и эпителиальные клетки кишечника экспрессируют семейство цитокератинов), и сосудисто-эндотелиальные клетки. Однако, клетки, в которые может происходить дифференцировка, не ограничиваются указанными выше клетками, и также они включают клетки, имеющие потенциал к дифференцировке в клетки паренхиматозных органов, таких как печень, почка и поджелудочная железа.

В настоящем изобретении происходящие из костного мозга мезенхимальные стволовые клетки, плюрипотентные стромальные стволовые клетки костного мозга или плюрипотентные стволовые клетки костного мозга относятся к клеткам, существующим в костном мозге, которые непосредственно получают из костного мозга или опосредованно получают из других тканей (крови, кожи, жировой ткани и других тканей), и их можно культивировать/они могут пролиферировать в качестве прикрепляющихся клеток на культуральной чашке (изготовленной из пластмассы или стекла). Эти клетки характеризуются наличием потенциала к дифференцировке в мезенхимальные ткани (мезенхимальные стволовые клетки), такие как кость, хрящ и жировая ткань, или скелетные мышцы, сердечная мышца, кроме того, нервные ткани, эпителиальные ткани (плюрипотентные стволовые клетки) и их можно получать из коллекции крови костного мозга, периферической крови или мезенхимальных тканей, таких как жировая ткань, эпителиальные ткани, такие как кожа, нервные ткани, такие как головной мозг. Происходящие из костного мозга мезенхимальные стволовые клетки, происходящие из костного мозга плюрипотентные стволовые клетки или плюрипотентные стволовые клетки костного мозга также характеризуются наличием потенциала к дифференцировке в эпителиальные ткани, такие как кератиноциты, которые образуют кожу, или в нервные ткани, которые образуют головной мозг, путем введения клеток, которые прикрепились к культуральной чашке, в область повреждения живого организма.

Мезенхимальные стволовые клетки костного мозга, стромальные плюрипотентные стволовые клетки костного мозга или плюрипотентные стволовые клетки костного мозга по настоящему изобретению представляют собой мультипотентные стволовые клетки, и они способны дифференцироваться предпочтительно в остеобласты (индукцию дифференцировки можно идентифицировать путем выявления кальцификации), хондроциты (которые можно идентифицировать по положительному окрашиванию альциановым синим, по положительному окрашиванию сафранином O, или сходными с ними), адипоциты (которые можно идентифицировать по положительному окрашиванию суданом III или т.п.), и другие мезенхимальные клетки, такие как фибробласты, гладкомышечные клетки, клетки скелетных мышц, стромальные клетки и клетки сухожилий; нервные клетки, пигментные клетки, эпидермальные клетки, клетки волосяного фолликула (которые экспрессируют семейство цитокератинов, семейство кератина волос или сходные с ними), эпителиальные клетки (например, эпидермальные кератиноциты и эпителиальные клетки кишечника экспрессируют семейство цитокератинов или сходные с ним), и эндотелиальные клетки; и, кроме того, предпочтительно в клетки паренхиматозных органов, таких как печень, почка и поджелудочная железа. Однако дифференцированные клетки не ограничены указанными выше клетками.

Клетки-предшественники тканей определяют как недифференцированные клетки, имеющие однонаправленную способность к дифференцировке в клетки конкретных тканей, отличных от кроветворной системы, и они включают недифференцированные клетки, способные дифференцироваться в мезенхимальную ткань, эпителиальную ткань, нервную ткань, паренхиматозные органы и сосудистый эндотелий, как упоминалось выше.

Между тем, клетки костного мозга по настоящему изобретению включают, но не ограничиваются ими, например, клетки костного мозга, положительные по меньшей мере по одному из маркеров клеточной поверхности: CD44, PDGFRα и PDGFRβ.

В настоящем изобретении стадию имплантации емкости под кожу проводят путем проведения надреза на коже размером несколько миллиметров скальпелем после общей (или местной) анестезии; создания необходимого пространства в подкожной жировой ткани путем тупого отделения с использованием металлического стержня с округлым концом (кровоостанавливающий зажим "Москит" или сходные с ним); имплантации емкости для сбора клеток, такой как силиконовая трубка, в пространство; и, наконец, закрытия надреза швом или скобками.

Возможные альтернативные способы помещения емкостей под кожей включают способы, в которых под кожу помещают внутреннюю часть и наружную оболочку инъекционной иглы, а затем удаляют внутреннюю часть (инъекционную иглу), оставляя наружную оболочку внутри; и способы, в которых помещают баллонный катетер поверх направляющей проволоки под кожей, и оставляют катетер после удаления направляющей проволоки путем расширения баллона фармацевтической жидкостью.

Индивиды, которым имплантируют емкость, включают людей и не являющихся человеком животных, включая, например, людей, мышей, крыс, обезьян, свиней, собак, кроликов, хомяков и морских свинок. Предпочтительным индивидом является человек.

В настоящем изобретении стадия сбора популяций клеток из емкостей может представлять собой либо стадию сбора популяций клеток из емкостей, имплантированных под кожу, либо стадию удаления емкостей из-под кожи с последующим сбором популяций клеток из удаленных емкостей. Например, в примерах настоящего документа описано, что силиконовые трубки, имплантированные под кожу, извлекали через надрез в коже и клетки собирали из трубок аспирированием с использованием пипеток. Однако также доступны другие способы.

Способы сбора популяций клеток из емкостей, имплантированных под кожу, проводят следующим образом: емкость, подлежащую имплантации под кожу, модифицируют так, чтобы она была удлиненной, образуя конец в форме трубки; подобную трубке часть фиксируют снаружи организма; к трубке во время сбора клеток присоединяют шприц; и клетки собирают вакуумным аспирированием. Затем в трубку, имплантированную в организм, повторно инъецируют индуцирующий клетки раствор, такой как раствор HMGB1. Это обеспечивает многократный сбор клеток из емкости, имплантированной под кожу. В организм имплантируют емкости, форма которых пригодны для этих способов.

В настоящем изобретении стадию выделения клеток костного мозга из собранных популяций клеток проводят, например, путем выделения клеток, прикрепленных к культуральным чашкам, из популяций собранных клеток.

В другом способе, например, клетки собирают пипетированием из трубок, извлеченных из организма; проведением реакции по меньшей мере одного из маркеров клеточной поверхности, CD44, PDGFRα и PDGFRβ, с антителами, меченными различными типами флуоресцентных меток; а затем использованием клеточного сортера для выделения популяций клеток, имеющих конкретные маркеры клеточной поверхности, в присутствии каждого типа флуоресценции в качестве индикатора.

Существует альтернативный способ (MACS), который проводят, например, следующим образом: маркеры клеточной поверхности подвергают реакции аналогичным образом с антителами, меченными металлическими частицами вместо флуоресцентных меток; клетки, связавшиеся со связанными с металлом антителами, привлекают и иммобилизуют на внутренней стенке одной стороны трубки с использованием силы магнитного поля; после тщательного элюирования клеток, не реагирующих с антителами, клетки-мишени, иммобилизованные на трубке, собирают, устраняя силу магнитного поля.

Настоящее изобретение относится к способам сбора популяций клеток из емкостей, извлеченных из-под кожи организма, в которых за привлечение популяций клеток из костного мозга в емкости отвечает любой из материалов (a)-(r), или смесь любых двух или более из материалов (a)-(r), описанных ниже.

Настоящее изобретение также относится к способам сбора клеток костного мозга, которые включают стадию выделения клеток костного мозга из популяций клеток, собранных из емкостей, имплантированных под кожу, и в которых за привлечение популяций клеток из костного мозга в емкости отвечает любой из материалов (a)-(r), описанных ниже, или смесь любых двух или более из материалов (a)-(r), описанных ниже. Указанные выше способы могут включать стадию сбора популяций клеток из емкостей, извлеченных из организма, перед стадией выделения клеток костного мозга из популяций клеток.

(a) белок HMGB1;

(b) клетка, которая секретирует белок HMGB1;

(c) вектор, в который встроена ДНК, кодирующая белок HMGB1;

(d) белок HMGB2;

(e) клетка, которая секретирует белок HMGB2;

(f) вектор, в который встроена ДНК, кодирующая белок HMGB2;

(g) белок HMGB3;

(h) клетка, которая секретирует белок HMGB3; и

(i) вектор, в который встроена ДНК, кодирующая белок HMGB3;

(j) белок S100A8;

(k) клетка, которая секретирует белок S100A8;

(l) вектор, в который встроена ДНК, кодирующая белок S100A8;

(m) белок S100A9;

(n) клетка, которая секретирует белок S100A9;

(o) вектор, в который встроена ДНК, кодирующая белок S100A9;

(p) гиалуроновая кислота;

(q) экстракт клеток или тканей; и

(r) гепарин-связывающая фракция экстракта клеток или тканей.

Настоящее изобретение относится к способам, включающим стадии

(I) имплантации емкости под кожу; и

(II) сбора популяции клеток из емкости;

и, кроме того, включающим после стадии (I) стадию введения в кровеносный сосуд или мышцу любого одного, или смеси любых двух или более из материалов (a)-(r), описанных выше.

Для проведения стадии (II) популяцию клеток можно собирать из емкости в организме или из емкости, извлеченной из организма.

Настоящее изобретение также относится к способам сбора клеток костного мозга, которые включают стадии

(I) имплантации емкости под кожу;

(II) сбора популяции клеток из емкости; и

(III) выделения клеток костного мозга из собранной популяции клеток;

и, кроме того, включающим после стадии (I) стадию введения в кровеносный сосуд или мышцу любого из материалов (a)-(r), описанных выше, или смеси любых двух или более из материалов (a)-(r), описанных выше.

Для проведения стадии (II) популяцию клеток можно собирать из емкости в организме или емкости, извлеченной из организма.

Настоящее изобретение относится к способам сбора популяций клеток, которые включают стадии

(I) имплантации емкости под кожу; и

(II) сбора популяции клеток из емкости;

где емкость содержит любой из материалов (a)-(r), описанных выше, или смесь любых двух или более из материалов (a)-(r), описанных выше.

Для проведения стадии (II) клеточные популяции можно собирать из емкости, имплантированной в организм, или из емкости, извлеченной из организма.

Настоящее изобретение также относится к способам сбора клеток костного мозга, которые включают стадии

(I) имплантации емкости под кожу;

(II) сбора популяции клеток из емкости; и

(III) выделения клеток костного мозга из собранной популяции клеток;

где емкость содержит любой из материалов (a)-(r), описанных выше, или смесь любых двух или более из материалов (a)-(r), описанных выше.

Для проведения стадии (II) популяцию клеток можно собирать из емкости, имплантированной в организм, или из емкости, извлеченной из организма.

Настоящее изобретение также относится к способам сбора популяций клеток, которые включают стадии

(I) имплантации емкости под кожу; и

(II) сбора популяции клеток из емкости;

где емкость содержит любой из материалов (a)-(r), описанных выше, или смесь любых двух или более из материалов (a)-(r), описанных выше;

и которые также включают после стадии (I) стадию введения в кровеносный сосуд или мышцу, любого из материалов (a)-(r), описанных выше, или смесь любых двух или более из материалов (a)-(r), описанных выше.

Для проведения стадии (II) популяцию клеток можно собирать из емкости, имплантированной в организм, или из емкости, извлеченной из организма.

Настоящее изобретение также относится к способам сбора клеток костного мозга, которые включают стадии

(I) имплантации емкости под кожу;

(II) сбора популяции клеток из емкости; и

(III) выделения клеток костного мозга из собранной популяции клеток;

где емкость содержит любой из материалов (a)-(r), описанных выше, или смесь любых двух или более из материалов (a)-(r), описанных выше;

и которые также включают после стадии (I) стадию введения в кровеносный сосуд или мышцу любого из материалов (a)-(r), описанных выше, или смесь любых двух или более из материалов (a)-(r), описанных выше.

Для проведения стадии (II) популяцию клеток можно собирать из емкости, имплантированной в организм, или из емкости, извлеченной из организма.

Белок HMGB1 по настоящему изобретению может быть проиллюстрирован, но не ограничиваясь этим, белками, содержащими аминокислотную последовательность SEQ ID NO: 1, 3 или 5. Белки HMGB1 по настоящему изобретению также могут включать белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3 или 5. Примеры таких белков включают 1) выделенные белки, которые содержат аминокислотную последовательность с одной или несколькими аминокислотными заменами, делециями, инсерциями и/или вставками в аминокислотной последовательности SEQ ID NO: 1, 3 или 5, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3 или 5; и 2) выделенные белки, которые кодируются ДНК, которые гибридизуются в строгих условиях с ДНК, содержащими нуклеотидную последовательность SEQ ID NO: 2, 4 или 6, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3 или 5.

Белок HMGB2 по настоящему изобретению может быть проиллюстрирован, но не ограничиваясь этим, белками, содержащими аминокислотную последовательность SEQ ID NO: 7, 9 или 11. Белки HMGB2 по настоящему изобретению также могут включать белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 7, 9 или 11. Примеры таких белков включают 1) выделенные белки, которые содержат аминокислотную последовательность с одной или несколькими аминокислотными заменами, делециями, инсерциями и/или вставками в аминокислотной последовательности SEQ ID NO: 7, 9 или 11 и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 7, 9 или 11; и 2) выделенные белки, которые кодируются ДНК, которые гибридизуются в строгих условиях с ДНК, содержащими нуклеотидную последовательность SEQ ID NO: 8, 10 или 12, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 7, 9 или 11.

Белок HMGB3 по настоящему изобретению может быть проиллюстрирован, но не ограничиваясь этим, белками, содержащими аминокислотную последовательность SEQ ID NO: 13 или 15. Белки HMGB3 по настоящему изобретению также могут включать белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 13 или 15. Примеры таких белков включают 1) выделенные белки, которые содержат аминокислотную последовательность с одной или несколькими аминокислотными заменами, делециями, инсерциями и/или вставками в аминокислотной последовательности SEQ ID NO: 13 или 15, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 13 или 15; и 2) выделенные белки, которые кодируются ДНК, которые гибридизуются в строгих условиях с ДНК, содержащими нуклеотидную последовательность SEQ ID NO: 14 или 16, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 13 или 15.

Белок S100A8 по настоящему изобретению может быть проиллюстрирован, но не ограничиваясь этим, белками, содержащими аминокислотную последовательность SEQ ID NO: 17, 19 или 21. Белки S100A8 по настоящему изобретению также могут включать белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 17, 19 или 21. Примеры таких белков включают 1) выделенные белки, которые содержат аминокислотную последовательность с одной или несколькими аминокислотными заменами, делециями, инсерциями и/или вставками в аминокислотной последовательности SEQ ID NO: 17, 19 или 21, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 17, 19 или 21; и 2) выделенные белки, которые кодируются ДНК, которые гибридизуются в строгих условиях с ДНК, содержащими нуклеотидную последовательность SEQ ID NO: 18, 20 или 22, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 17, 19 или 21.

Белок S100A9 по настоящему изобретению может быть проиллюстрирован, но не ограничиваясь этим, белками, содержащими аминокислотную последовательность SEQ ID NO: 23, 25 или 27. Белки S100A9 по настоящему изобретению также могут включать белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 23, 25 или 27. Примеры таких белков включают 1) выделенные белки, которые содержат аминокислотную последовательность с одной или несколькими аминокислотными заменами, делециями, инсерциями и/или вставками в аминокислотной последовательности SEQ ID NO: 23, 25 или 27, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 23, 25 или 27; и 2) выделенные белки, которые кодируются ДНК, которые гибридизуются в строгих условиях с ДНК, содержащими нуклеотидную последовательность SEQ ID NO: 24, 26 или 28, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 23, 25 или 27.

Выделенные белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, могут быть гомологами или паралогами белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27. Специалисты в данной области могут выделять белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, известными способами (дополнительный том "Jikken Igaku (Experimental Medicine), Idenshi Kougaku Handbook (Genetic Engineering Handbook)", pp. 246-251, опубликованный Yodosha Co., Ltd., 1991).

Примеры белков, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, включают белки, обладающие активностью индукции происходящих из костного мозга клеток.

Белки, которые содержат аминокислотную последовательность с одной или несколькими аминокислотными заменами, делециями, инсерциями и/или вставками в аминокислотной последовательности SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, включают встречающиеся в природе белки. Как правило, эукариотические гены имеют полиморфизм, как известно для генов интерферонов и сходных с ними. Изменения нуклеотидной последовательности, вызванные полиморфизмом, могут привести к одной или нескольким аминокислотным заменам, делециям, инсерциям и/или вставкам. Встречающиеся в природе белки, такие как белки, содержащие аминокислотную последовательность с одной или несколькими аминокислотными заменами, делециями, инсерциями и/или вставками в аминокислотной последовательности SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, включены в белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению.

Настоящее изобретение также включает искусственно продуцированные мутантные белки при условии, что они функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27. Известные способы, которые приводят к случайной мутации данной нуклеотидной последовательности, включают замену(ы) пары(пар) оснований посредством обработки ДНК азотистой кислотой (Hirose, S. et al., Proc. Natl. Acad. Sci. USA, 79: 7258-7260, 1982). Этот способ обеспечивает случайное внесение замены(замен) пары(пар) оснований в конкретный сегмент посредством обработки азотистой кислотой желательного для мутации сегмента. Альтернативно, технологии для сайт-направленной мутации мишени включают способ дуплекса с брешью (Kramer W. and Fritz H.J., Methods in Enzymol., 154: 350-367, 1987) и т.п. Замкнутый двухцепочечный вектор, в который клонируют ген, подлежащий встраиванию мутации, разделяют на отдельные цепи. Эти отдельные цепи гибридизуют с синтетическим олигонуклеотидом с мутацией в участке-мишени. Происходящую из вектора комплементарную отдельную цепь ДНК, линеаризованную ферментом рестрикции, подвергают отжигу с циклическим одноцепочечным вектором, и разрыв между олигонуклеотидом и вектором достраивают с использованием ДНК-полимеразы, которую затем преобразовывают в полный двухцепочечный вектор лигированием.

Количество аминокислот, подлежащих модификации, как правило, находится в пределах 50, предпочтительно в пределах 30, и более предпочтительно в пределах 5 аминокислот (например, одна аминокислота).

Когда аминокислоту заменяют искусственно, замена аминокислотой, имеющей сходные свойства, приводит к сохранению активности исходного белка. Белки по настоящему изобретению включают белки, полученные в результате консервативной замены при указанной выше замене аминокислоты(аминокислот), и которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27. Консервативную замену считают важной в случае замены аминокислоты(аминокислот) доменов, важных для активности белка. Такая консервативная замена аминокислоты(аминокислот) хорошо известна специалистам в данной области.

Примеры групп аминокислот, пригодных для консервативной замены, включают основные аминокислоты (такие как лизин, аргинин и гистидин), кислотные аминокислоты (такие как аспарагиновая кислота и глутаминовая кислота), незаряженные полярные аминокислоты (такие как глицин, аспарагин, глутамин, серин, треонин, тирозин и цистеин), неполярные аминокислоты (такие как аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин и триптофан), β-разветвленные аминокислоты (такие как треонин, валин и изолейцин) и ароматические аминокислоты (такие как тирозин, фенилаланин, триптофан и гистидин).

Более того, неконсервативная замена может повышать активность белка (например, конститутивно активированные белки).

Кроме того, белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, можно получать способами, в которых используется гибридизация. Иными словами, ДНК, кодирующую белок HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению, как показано в SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26 или 28, или ее фрагмент используют в качестве зонда, и затем выделяют ДНК, которые могут гибридизоваться с ними. Реакция гибридизации, проведенная в строгих условиях, приводит к выбору высоко гомологичной ДНК в качестве нуклеотидной последовательности. Это повышает вероятность того, что выделенные белки содержат белки, которые функционально эквивалентны белку HMGB1, HMGB2, HMGB3, S100A8 или S100A9. Примеры высоко гомологичной нуклеотидной последовательности включают последовательности, обладающие 70% или более, и желательно 90% или более идентичностью.

В конкретном примере термин "строгие условия" относится к условиям гибридизации с 6×SSC, 40% формамидом при 25°C и последующему промыванию 1×SSC при 55°C. Строгость зависит от таких условий, как концентрация соли, концентрация формамида или температура; однако специалистам в данной области понятно, как устанавливать условия, чтобы получить необходимую строгость.

С использованием гибридизации, например, можно выделять ДНК, кодирующие гомологи белков HMGB1, HMGB2, HMGB3, S100A8 или S100A9, отличные от белков, содержащих аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27.

Белки, которые функционально эквивалентны белку, содержащему аминокислотную последовательность SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27, обычно имеют высокую гомологию с аминокислотной последовательностью SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 или 27. Термин "высокая гомология" относится к идентичности последовательностей, составляющей по меньшей мере 30% или более, предпочтительно 50% или более, более предпочтительно 80% или более (например, 95% или более). Идентичность нуклеотидных последовательностей и аминокислотных последовательностей можно определять с использованием сайта поиска гомологии через интернет (например, программы поиска гомологии, такие как FASTA, BLAST, PSI-BLAST и SSEARCH, можно использовать в DNA Data Bank of Japan (DDBJ) [примеры которого включают страницу поиска гомологии (Search and Analysis) на web-сайте DNA Data Bank of Japan (DDBJ); http://www.ddbj.nig.ac.jp/E-mail/homology-j.html]). Более того, поиск с использованием BLAST можно проводить через web-сайт National Center for Biotechnology Information (NCBI) (примеры которого включают страницу BLAST на домашней странице web-сайта NCBI; http://www.ncbi.nlm.nih.gov/BLAST/; Altschul, S.F. et al., J. Mol. Biol., 1990, 215(3): 403-10; Altschul, S.F. & Gish, W., Meth. Enzymol., 1996, 266: 460-480; Altschul, S.F. et al., Nucleic Acids Res., 1997, 25: 3389-3402)).

Например, при вычислении идентичности аминокислотных последовательностей с использованием Advanced BLAST 2.1, величину идентичности (%) можно получить следующим образом: в качестве программы используют blastp, ожидаемое значение устанавливают на 10, все фильтры устанавливают на OFF, в качестве матрицы используют BLOSUM62, и штраф за наличие пропуска, штраф пропуска остатка, и отношение лямбда устанавливают на 11, 1 и 0,85, соответственно (параметры по умолчанию) (Karlin, S. and S.F. Altschul (1990) Proc. Natl. Acad. Sci. USA 87: 2264-68; Karlin, S. и S.F. Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-7).

Белки по настоящему изобретению или белки, функционально эквивалентные им, могут представлять собой белки, подвергнутые различным модификациям, таким как физиологическая модификация сахарными цепями и т.п., мечение флуоресцентными или радиоактивными веществами, или слияние с другими белками. В частности, в рекомбинантных молекулах, описанных ниже, модификация сахарной цепи может варьировать в зависимости от хозяев, используемых для экспрессии. Однако даже если существуют отличия в модификации сахарных цепей, все белки, имеющие свойства, сходные со свойствами белков HMGB1, HMGB2, HMGB3, S100A8 или S100A9, описанных в настоящем документе, представляют собой белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению или белки, функционально эквивалентные им.

Белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9 можно получать не только из материалов живых организмов, но также в форме рекомбинантных белков, путем встраивания генов, которые кодируют эти белки, в соответствующую экспрессирующую систему. Для получения белков HMGB1, HMGB2, HMGB3, S100A8 или S100A9 способами генной инженерии указанные выше ДНК, которые кодируют белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9, можно встраивать в соответствующую экспрессирующую систему, а затем они могут экспрессироваться. Примеры систем хозяин/вектор, применимых для настоящего изобретения, включают экспрессирующий вектор pGEX и E. coli. В случае pGEX, чужеродные гены могут быть экспрессированы в качестве слитого с глутатион-S-трансферазой белка (GST) (Gene, 67: 31-40, 1988). pGEX, в который встроен ген, кодирующий белок HMGB1, HMGB2, HMGB3, S100A8 или S100A9, вводят в штамм E. coli, такой как BL21, посредством теплового шока, инкубируют в течение подходящего периода времени, а затем добавляют изопропилтио-β-D-галактозид (IPTG) для индукции слитого с GST белка HMGB1, слитого с GST белка HMGB2, слитого с GST белка HMGB3, слитого с GST белка S100A8 или слитого с GST белка S100A9. Поскольку GST по настоящему изобретению адсорбируется на глутатион-сефарозу 4B, продукт экспрессии легко выделять и очищать аффинной колоночной хроматографией.

Кроме того, в качестве систем хозяин/вектор для получения рекомбинантных белков HMGB1, HMGB2, HMGB3, S100A8 или S100A9 можно использовать следующее. Прежде всего, когда в качестве хозяев используют бактерии, экспрессирующие векторы для слитых белков, в которых используется гистидиновая метка, HA-метка, FLAG-метка и сходные с ними, являются коммерчески доступными. Что касается дрожжей, известно, что дрожжи, относящиеся к роду Pichia, являются эффективными для экспрессии содержащих сахарную цепь белков. С точки зрения добавления сахарных цепей, также являются пригодными экспрессирующие системы, в которых используется бакуловирусный вектор с клетками насекомых в качестве клеток-хозяев (Bio/Technology, 6: 47-55, 1988). Кроме того, при использовании клеток млекопитающих, трансфекцию вектора проводят с использованием промоторов, таких как CMV, RSV и SV40. Любые из этих систем хозяин/вектор можно использовать в качестве экспрессирующей системы для белков HMGB1, HMGB2, HMGB3, S100A8 или S100A9. Более того, гены также можно вводить с использованием вирусных векторов, таких как ретровирусные векторы, аденовирусные векторы и векторы на основе аденоассоциированных вирусов.

Полученные таким образом белки по настоящему изобретению можно выделять из внутреннего содержимого клетки или извне клеток (среда и т.п.), и их можно очищать в качестве белков, которые являются по существу чистыми и гомогенными. Белки можно разделять и очищать с использованием способов разделения и очитки, которые обычно используют при очистке белков, и они конкретно не ограничены. Например, белки можно разделять и очищать путем надлежащего выбора и комбинирования хроматографических колонок, фильтров, ультрафильтрации, высаливания, осаждения растворителем, экстракции растворителем, дистилляции, иммунопреципитации, SDS-полиакриламидного гель-электрофореза, электрофореза с изоэлектрическим фокусированием, диализа, перекристаллизации и т.п.

Примеры хроматографии включают аффинную хроматографию, ионообменную хроматографию, гидрофобную хроматографию, гель-фильтрацию, обращенно-фазовую хроматографию и адсорбционную хроматографию (Marshak et al., Strategies for Protein Purification and Characterization: A Laboratory Course Manual. Ed Daniel R. Cold Spring Harbor Laboratory Press, 1996). Эти типы хроматографии можно проводить с использованием жидкофазной хроматографии, такой как ВЭЖХ и FPLC.

Более того, белки по настоящему изобретению предпочтительно представляют собой по существу очищенные белки. В настоящем документе, термин "по существу очищенный" означает, что чистота белка по настоящему изобретению (доля белка по настоящему изобретению в общих белковых компонентах) составляет 50% или более, 60% или более, 70% или более, 80% или более, 90% или более, 95% или более, 100% или близко к 100%. Верхний предел для выражения "близко к 100%" зависит от способов очистки и аналитических способов специалистов в данной области, и его примерами являются 99,999%, 99,99%, 99,9%, 99% и т.п.

Более того, по существу очищенный белок включает любой белок, очищенный любым способом очистки при условии, что чистота белка является такой, как указано выше. Примеры включают, но не ограничиваются ими, белки, по существу очищенные посредством надлежащего выбора и комбинирования указанных выше хроматографических колонок, фильтров, ультрафильтрации, высаливания, осаждения растворителем, экстракции растворителем, дистилляции, иммунопреципитации, SDS-полиакриламидного гель-электрофореза, электрофореза с изоэлектрическим фокусированием, диализа, перекристаллизации и т.п.

Клетки, где высвобождаются или секретируются белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению, в основном включают все типы происходящих из тканей клеток in vivo. Примерами клеток, которые можно легко собирать и культивировать, являются, но они не ограничиваются ими, фибробласты (такие как нормальные фибробласты кожи и клеточные линии, происходящие из них). Более того, клетки, секретирующие белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9 также можно получать следующим образом. Получают вектор встраиванием ДНК, кодирующей белок HMGB1, HMGB2, HMGB3, S100A8 или S100A9, или ДНК, кодирующей HMGB1, HMGB2, HMGB3, S100A8 или S100A9, связанной с ДНК, кодирующей сигнальную последовательность для секреции (ATG CAG ACA GAC ACA CTC CTG CTA TGG GTA CTG CTG CTG TGG GTT CCA GGT TCC ACT GGT GAC; SEQ ID NO: 29), в известный экспрессирующий вектор или вектор генной терапии. Полученный вектор вводят в клетки млекопитающих, такие как фибробласты (такие как нормальные фибробласты кожи и клеточные линии, происходящие из них), клетки насекомых и другие клетки. Примеры ДНК, кодирующих сигнальные последовательности для секреции, включают, но не ограничиваются ими, ДНК с описанными выше последовательностями. Более того, не существует конкретных ограничений типа животных, из которых эти клетки происходят, хотя предпочтительно используют клетки из типа животных, к которому относится животное-мишень, которому вводят вектор, клетки из самого животного-мишени или клетки, происходящие из близкого родственника животного-мишени, которому вводят вектор.

ДНК, которые кодируют белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9 индукторов или стимуляторов регенерации тканей по настоящему изобретению, могут представлять собой кДНК, геномные ДНК, природные ДНК или искусственно синтезированные ДНК, при условии, что они кодируют белок HMGB1, HMGB2, HMGB3, S100A8 или S100A9. ДНК, которые кодируют белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9, обычно вводят в форме, встроенной в векторы.

Примеры векторов по настоящему изобретению включают, но не ограничиваются ими, плазмидные векторы, ретровирусные векторы, лентивирусные векторы, аденовирусные векторы, векторы на основе аденоассоциированного вируса, векторы на основе вируса Сендай, векторы на основе оболочки вируса Сендай и векторы на основе вируса папилломы. Векторы могут содержать промоторные последовательности ДНК, которые эффективно индуцируют экспрессию генов, факторы, которые регулируют экспрессию генов, и молекулы, которые необходимы для поддержания стабильности ДНК.

В настоящем изобретении также можно использовать следующие векторы: неполные пептиды белка HMGB1, HMGB2, HMGB3, S100A8 или S100A9, которые обладают активностью индукции происходящих из костного мозга клеток; клетки, секретирующие эти неполные пептиды; или векторы, в которые встроена ДНК, кодирующая эти неполные пептиды.

Гиалуроновая кислота (также называемая гиалуронаном) представляет собой гликозаминогликан (мукополисахарид), в котором два сахара, N-ацетилглюкозамин и глюкуроновая кислота, соединены и связаны. Химическое название является следующим: [->3)-2-ацетамидо-2-дезокси-β-D-глюкопиранозил-(1->4)-β-D-глюкопиранозилуроновая кислота-(1->]n. Большинство природных гиалуроновых кислот представляют собой высокомолекулярные гиалуроновые кислоты с молекулярной массой несколько сотен тысяч. При этом можно искусственно продуцировать низкомолекулярные гиалуроновые кислоты с от двух до 14 остатками сахаров. В медицинской области, например, гиалуронат натрия используют для инъекции в полость сустава. Способы получения гиалуроновых кислот включают способы, в которых гиалуроновые кислоты экстрагируют и очищают из продуктов, продуцированных с использованием Streptococcus zooepidemicus, молочнокислой бактерии, и способы, в которых гиалуроновые кислоты экстрагируют и очищают из гребешка курицы или сходных с ним. Гиалуроновые кислоты могут быть различным образом модифицированными путем этерификации, окисления перйодатом, присоединения изомочевины, сульфатации и т.п. Гиалуроновые кислоты также могут быть поперечно-сшитыми через простые эфирные или сложные эфирные мостики. Такие модификации стабилизируют гиалуроновые кислоты от деградации, делают их нерастворимыми, придают им губчатую форму или придают им свойство высвобождения веществ замедленным образом. При этом CD44 представляет собой рецептор гиалуроновой кислоты, и гиалуроновые кислоты обладают хемотаксической активностью в отношении мезенхимальных стволовых клеток, которые имеют CD44 на их клеточной поверхности.

Экстракты клеток или тканей, используемые в способах по настоящему изобретению, можно получать способами, включающими стадию погружения клеток или тканей в растворитель.

Клетки и ткани, подлежащие погружению в растворитель, конкретно не ограничены, но включают, например, происходящие из ткани клетки, клетки клеточных линий, полученных из происходящих из ткани клеток (включая, но не ограничиваясь ими, например, HeLa и HEK293), выделенные клетки, не выделенные клетки (например, клетки в выделенных тканях), и клетки, трансфицированные ДНК, кодирующей белок HMGB1, HMGB2, HMGB3, S100A8 или S100A9. Указанные выше ткани могут представлять собой ткани любого типа, и они включают, но не ограничиваются ими, например, живые ткани кожи и ткани, полученные биопсией (хирургической операцией) из организма (головного мозга, легкого, сердца, печени, желудка, тонкого и толстого кишечника, поджелудочной железы, почки, мочевого пузыря, селезенки, матки, семенников, крови, и т.д.).

Примеры указанного выше растворителя включают, но не ограничиваются ими, физиологический раствор, фосфатно-солевой буфер (PBS) и забуференный Tris солевой раствор (TBS). Более того, время погружения клеток или ткани в растворитель должно иметь продолжительность, необходимую и достаточную для индукции некроза клеток, т.е. от 1 часа до 48 часов (например, от 6 до 48 часов), и предпочтительно от 12 до 24 часов, но оно не ограничивается этим. Таким образом, "стадию погружения клеток в растворитель" можно перефразировать как "стадию погружения клеток в растворитель на период времени, необходимый и достаточный для индукции некроза" или "стадию обеспечения некроза клеток". Более того, примеры температуры для погружения клеток или ткани в растворитель включают, но не ограничиваются этим, от 4°C до 25°C (например, от 4°C до 8°C), и предпочтительно 4°C. Кроме того, примеры pH для погружения клеток или ткани в растворитель включают, но не ограничиваются этим, pH от 7 до 8, и предпочтительно pH 7,5. Примеры буфера включают, но не ограничиваются этим, фосфатно-солевой буфер в концентрации от 10 мМ до 50 мМ, предпочтительно от 10 до 20 мМ.

Более того, в настоящем изобретении после погружения клеток или тканей в растворитель их можно извлекать из растворителя. Способы извлечения клеток или тканей из растворителя конкретно не ограничены, при условии, что способ известен специалистам в данной области. Например, клетки или ткани можно удалять из растворителя центрифугированием при гравитационном ускорении от 10 G до 100000 G (например, 440 G) при от 4°C до 25°C (например, 4°C), с последующим отделением супернатанта, однако способ удаления не ограничивается этим способом. Супернатант можно использовать в качестве экстракта клеток или тканей.

Экстракты клеток или тканей по настоящему изобретению, полученные способами, включающими стадию погружения клеток или тканей в растворитель, включают, например, но не ограничиваются ими, экстракт кожи и экстракт мононуклеарных клеток периферической крови (экстракт периферической крови).

Экстракт периферической крови получают следующим способом: после сбора крови шприцом или сходными с ним клетки замораживают в морозильной камере или в жидком азоте, на сухом льду, или сходными способами, а затем размораживают при температуре 0°C или более. Затем для удаления нерастворимых клеточных компонентов образец центрифугируют, например, при силе тяжести от 10 до 100000 G (например, при 440 G) и при от 4°C до 25°C (например, при 4°C), и полученный супернатант собирают. Нерастворимые клеточные компоненты можно удалять из растворителя способом, описанным выше. Однако способы удаления нерастворимых клеточных компонентов не ограничены указанным выше примером. Полученный супернатант можно использовать в качестве экстракта клеток или тканей. Альтернативно, вместо центрифугирования нерастворимые клеточные компоненты можно удалять фильтрацией через фильтр из нитроцеллюлозы с микропорами 0,45 мкм, или сходные с ним. Альтернативно, собранной периферической крови можно позволять стоять в течение от трех до 48 часов при 4°C для индукции некроза клеток. При такой обработке из клеток периферической крови могут высвобождаться внутриклеточные компоненты. Затем для удаления из растворителя нерастворимых клеточных компонентов, образец центрифугируют при силе тяжести от 10 до 100000 G (например, при 440 G), и полученный супернатант собирают. Нерастворимые клеточные компоненты можно удалять из растворителя способом, описанным выше, но не ограничиваясь им. Полученный супернатант можно использовать в качестве экстракта клеток или тканей. Альтернативно, вместо центрифугирования нерастворимые клеточные компоненты можно удалять фильтрацией через фильтр из нитроцеллюлозы с микропорами 0,45 мкм или т.п.

Гепарин-связывающие фракции из экстрактов клеток или тканей, подлежащие применению в настоящем изобретении, можно продуцировать способом, включающим следующие стадии:

(a) погружение клетки или ткани в растворитель;

(b) контактирование экстракта, полученного на стадии (a), с иммобилизованным гепарином; и

(c) элюирование гепарин-связывающей фракции (также она может называться очищенной гепарином фракцией или очищенной на колонке с гепарином фракцией) с иммобилизованного гепарина.

"Иммобилизованный гепарин" относится к гепарину, ковалентно связанному с нерастворимым носителем. Примеры нерастворимого носителя включают, но не ограничиваются ими, гранулы сефарозы (такие как сефароза 4B, сефароза 6B и т.п.: GE Healthcare). В настоящем изобретении также можно использовать коммерчески доступный иммобилизованный гепарин (колонка Hitrap Heparin HP: GE Healthcare).

Примеры условий для контактирования экстракта клеток или тканей с иммобилизованным гепарином включают, но не ограничиваются ими, pH приблизительно от 7 до 8 (предпочтительно pH 7,5), и концентрацию соли от 0 до 200 мМ, и предпочтительно приблизительно от 100 до 200 мМ. Время, в течение которого экстракт контактируют с иммобилизованным гепарином, конкретно не ограничено, однако контакт предпочтительно продолжается в течение 5 минут или более для достаточной адсорбции гепарин-связывающей фракции на иммобилизованный гепарин. Примеры температуры включают, но не ограничиваются ими, от 4 до 8°C, и предпочтительно 4°C. Кроме того, примеры условий элюирования гепарин-связывающей фракции, адсорбированной на иммобилизованный гепарин, включают, но не ограничиваются ими, pH приблизительно от 7 до 8 и концентрацию соли от 200 до 1000 мМ (предпочтительно приблизительно 1000 мМ).

При этом любые из материалов (a)-(r), описанные выше, или смеси любых двух или более из материалов, которые используют в способах по настоящему изобретению, включают, но не ограничиваются ими, например, следующие комбинации:

гиалуроновая кислота и белок HMGB1; гиалуроновая кислота и белок HMGB2; гиалуроновая кислота и белок HMGB3; гиалуроновая кислота и белок S100A8; гиалуроновая кислота и белок S100A9; гиалуроновая кислота и белки HMGB1 и HMGB2; гиалуроновая кислота, и белки HMGB2 и HMGB3; гиалуроновая кислота, и белки HMGB1 и HMGB3; гиалуроновая кислота и белки HMGB1, HMGB2 и HMGB3; гиалуроновая кислота и белки S100A8 и S100A9; гиалуроновая кислота и белки HMGB1 и S100A8; гиалуроновая кислота и белки HMGB2 и S100A8; гиалуроновая кислота и белки HMGB3 и S100A8; гиалуроновая кислота и белки HMGB1 и S100A9; гиалуроновая кислота и белки HMGB2 и S100A9; гиалуроновая кислота и белки HMGB3 и S100A9; гиалуроновая кислота и экстракты клеток или тканей; и гиалуроновая кислота и гепарин-связывающие фракции экстрактов клеток или тканей; и предпочтительно смеси гиалуроновой кислоты и экстрактов клеток или тканей. Соотношение для смешивания основано на объеме наименьшего количества ингредиента, растворенного в растворителе, который принимают за 1, где другие ингредиенты можно добавлять в объеме, вплоть до 10000 раз превышающем этот объем, и предпочтительно, другие ингредиенты можно добавлять в объеме, равном или вплоть до 10 раз превышающем наименьшее количество ингредиента, взятое в качестве 1.

Типы животных, которые служат в качестве источника экстракта, гепарин-связывающей фракции, белка HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению, включают человека и не являющихся человеком животных, примерами которых могут быть люди, мыши, крысы, обезьяны, свиньи, собаки, кролики, хомяки и морские свинки, однако предпочтительно тип животного является таким же, как и животное, которому намереваются вводить указанный выше экстракт или сходные с ним.

Экстракты, гепарин-связывающие фракции, белки HMGB1, HMGB2, HMGB3, S100A8 и S100A9 по настоящему изобретению вводят в кровеносные сосуды или мышцы парентеральными способами введения. Конкретно, такие способы введения включают инъекцию. Например, фармацевтические средства по настоящему изобретению можно вводить в кровеносные сосуды, мышцы или под кожу (например, в емкость, имплантированную под кожу, или вблизи нее) посредством внутрисосудистой инъекции (внутриартериальная инъекция, внутривенная инъекция, и т.д.), внутримышечной инъекции, подкожной инъекции и т.п. Альтернативно можно обеспечивать всасывание средств по настоящему изобретению способом замедленного высвобождения с использованием трансдермальных пластырей с всасывающимся компонентом или наружных препаратов.

Способ введения можно пригодным образом выбирать согласно возрасту и симптомам индивида. Когда вводят белок HMGB1, HMGB2, HMGB3, S100A8 или S100A9, однократную дозу белка можно выбирать из диапазона от 0,0000001 мг до 1000 мг на кг массы тела индивида. Альтернативно дозу можно выбирать, например, из диапазона от 0,00001 мг до 100000 мг массу тела индивида. При введении клеток, секретирующих белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9, или векторов для генной терапии, в которые встроена ДНК, кодирующая белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9, их можно вводить так, чтобы количества белка HMGB1, HMGB2, HMGB3, S100A8 или S100A9 в поврежденных тканях находились в пределах указанного выше диапазона. Однако дозировка экстрактов, гепарин-связывающих фракций или белков HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению не ограничивается этим.

При введении экстракты, гепарин-связывающие фракции или белки HMGB1, HMGB2, HMGB3, S100A8 или S100A9 можно изготавливать согласно обычным способам (например, Remington's Pharmaceutical Science, последнее издание, Mark Publishing Company, Easton, U.S.A), и они могут содержать фармацевтически приемлемые носители и добавки. Их примеры включают поверхностно-активные вещества, эксципиенты, красители, отдушки, консерванты, стабилизаторы, буферы, суспендирующие вещества, обеспечивающие изотоничность средства, связующие вещества, дезинтегрирующие вещества, смазывающие вещества, средства, обеспечивающие текучесть, и вкусовые добавки, хотя они не ограничены ими, и можно надлежащим образом использовать другие распространенные носители. Конкретные примеры включают легкую безводную кремниевую кислоту, лактозу, кристаллическую целлюлозу, маннит, крахмал, кармеллозу кальция, кармеллозу натрия, гидроксипропилцеллюлозу, гидроксипропилметилцеллюлозу, поливинилацетальдиэтиламиноацетат, поливинилпирролидон, желатин, триглицерид жирной кислоты средней длины цепи, полиоксиэтилен-гидрогенизированное касторовое масло 60, белый сахар, карбоксиметилцеллюлозу, кукурузный крахмал и неорганические соли.

Экстракты, гепарин-связывающие фракции, белок HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению можно помещать в емкость путем инъекции с использованием следующего способа. Конкретно, каждый раствор или растворенное вещество растворяют в физиологическом растворе, и полученный раствор вручную инъецируют с использованием устройства для инъекций или пипетки. Альтернативно раствор механически инъецируют в трубку во время изготовления трубки.

Между тем, количество экстрактов, гепарин-связывающих фракций, белка HMGB1, HMGB2, HMGB3, S100A8 или S100A9 по настоящему изобретению, подлежащих инъекции в емкость, определяют соответствующим образом в соответствии с объемом емкости, используемой для сбора клеток. Например, когда емкость имплантируют в подкожную жировую ткань живота, можно инъецировать приблизительно 10 мл средства по настоящему изобретению. Альтернативно, когда емкость имплантируют под кожу не в области живота, предполагаемое инъецируемое количество составляет приблизительно несколько миллилитров.

Настоящее изобретение относится к популяции клеток, собранных указанными выше способами сбора популяции клеток.

Также настоящее изобретение относится к клеткам костного мозга, собранным описанными выше способами сбора клеток костного мозга.

Популяции клеток и клетки костного мозга по настоящему изобретению можно вводить для лечения заболеваний с повреждением тканей, таких как наследственные заболевания, заболевания кожи (термическое повреждение, кожная язва или сходные с ними), заболевания головного мозга и нервов (инфаркт головного мозга, болезнь Альцгеймера, повреждение спинного мозга, повреждение головного мозга или сходные с ними), сердечно-сосудистые заболевания (инфаркт миокарда, миопатия сердца, артериальная эмболия или сходные с ними), и костно-хрящевые заболевания (перелом костей, ревматизм или сходные с ними). Регенерацию тканей можно осуществлять прямым введением клеток в кровоток через вену или артерию, или прямым введением клеток в ткани в поврежденной области сразу после сбора клеток. Альтернативно регенерацию тканей можно осуществлять введением клеток в диспергированном или агрегированном состоянии, или когда они имеют форму слоя после культивирования клеток с использованием культуральных чашек и флаконов. Что касается вводимого количества, можно вводить от 1 до 1014 клеток, и предпочтительно от 102 до 1010 клеток. Таким образом, настоящее изобретение также относится к средствам для регенерации тканей, содержащим популяцию клеток, собранную описанными выше способами сбора популяции клеток, или клетки костного мозга, собранные описанными выше способами сбора клеток костного мозга.

Тип тканей, подлежащих регенерации, конкретно не ограничен. Ткань-мишень может представлять собой любую ткань при условии, что она является поврежденной тканью. Такие ткани включают, например, живые ткани кожи и ткани, полученные биопсией (хирургической операцией) из организма (головной мозг, легкое, сердце, печень, желудок, тонкий и толстый кишечник, поджелудочная железа, почка, мочевой пузырь, селезенка, матка, семенники, кровь и т.п.). В частности, средства по настоящему изобретению эффективно используют для регенерации тканей, которые являются труднодоступными для прямого введения снаружи организма (головной мозг, сердце или сходные с ними). В настоящем изобретении поврежденные ткани включают ткани, поврежденные вследствие различных патологических состояний, таких как состояния, которые приводят к ишемии, гемостазу или гипоксии, травме, ожогу, воспалению, аутоиммунитету, генетическим нарушениям и т.п., но они не ограничиваются этими примерами. Более того, поврежденные ткани включают некротические ткани.

Ткани по настоящему изобретению конкретно не ограничены, при условии, что в них могут дифференцироваться клетки костного мозга. Такие ткани включают, например, все биологические ткани, такие как ткани кожи, костные ткани, хрящевые ткани, мышечные ткани, жировые ткани, ткани миокарда, нервные ткани, легочные ткани, ткани желудочно-кишечного тракта, ткани печени, ткани желчного пузыря, ткани поджелудочной железы и мочеполовой системы. Более того, описанные выше средства для регенерации тканей можно использовать для лечения не только кожных заболеваний, таких как трудноизлечимая кожная язва, кожные раны, буллез и алопеция, но также повреждений тканей, таких как повреждения вследствие инфаркта головного мозга, инфаркта миокарда, перелома кости, инфаркта легких, язвы желудка и энтерита. Виды животных, подлежащих введению описанных выше средств для регенерации тканей, включают, но не ограничиваются ими, человека и не являющихся человеком животных, например, человека, мышей, крыс, обезьян, свиней, собак, кроликов, хомяков и морских свинок. Более того, средства по настоящему изобретению можно вводить пациентам с диабетом. Известно, что трудноизлечимую кожную язву, которая является осложнением диабета, трудно лечить по сравнению с кожной язвой у здоровых людей. Средства по настоящему изобретению также можно эффективно использовать у таких пациентов с диабетом.

После сбора клеток клетки диффундируют в физиологический раствор, и полученную суспензию клеток можно вводить в качестве средства для регенерации ткани по настоящему изобретению в кровоток, например, в вену или артерию, для обеспечения регенерации ткани. Альтернативно средство для регенерации ткани по настоящему изобретению можно наносить или прикладывать на поверхность области повреждения тканей для достижения регенерации тканей. Альтернативно средство можно инъецировать в поврежденную область с использованием шприца или сходных с ним для обеспечения регенерации тканей. Альтернативно клетки можно культивировать с использованием культуральных чашек или флаконов, а затем вводить в поврежденную область в диффундированном или агрегированном состоянии, или в форме слоя, для достижения регенерации тканей. Что касается вводимого количества, можно вводить от 1 до 1014 клеток, и предпочтительно от 102 до 1010 клеток.

Все документы уровня техники, цитированные в настоящем документе, включены в настоящий документ в качестве ссылок.

Примеры

Ниже в настоящем документе настоящее изобретение конкретно описано с помощью примеров, но его не следует истолковывать как ограниченное ими.

Пример 1

Задача: разработать новые высокоэффективные и минимально инвазивные способы сбора функциональных клеток, таких как стволовые клетки, которые существуют in vivo в крайне низком количестве.

Способы: исследования проводили для достижения описанной выше задачи.

(1) После облучения дозой 10 Гр мышам (самцы) в возрасте восьми недель трансплантировали через хвостовую вену клетки костного мозга (5×106 клеток/0,1 мл фосфатно-солевого буфера, pH 7,4), происходящие из трансгенных мышей с зеленым флуоресцентным белком (GFP) для получения мышей с трансплантированным костным мозгом с GFP.

(2) Трубки, изготовленные из биологически гипоаллергенного материала (силикон), заполняли HMGB1, гиалуроновой кислотой, кожным экстрактом или фосфатно-солевым буфером (pH 7,4), а затем имплантировали под кожу спины мышей с трансплантированным костным мозгом с GFP (фиг.1).

(3) Имплантированные трубки удаляли через две недели после имплантации (фиг.2). Клетки, скопившиеся в трубках (улавливающиеся в трубку клетки (TEC)) собирали, а затем культивировали в среде Дульбекко (D-MEM), дополненной 10% эмбриональной телячьей сывороткой при 37°C в 5% газообразном диоксиде углерода.

(4) Когда плотность культуры TEC достигала приблизительно 80% смыкания монослоя на поверхности дна чашки, культуральную среду заменяли индуцирующей дифференцировку кости средой, индуцирующей дифференцировку жировой ткани средой или индуцирующей дифференцировку эпидермиса средой. Затем клетки далее культивировали. Через две недели после начала культивирования в каждой индуцирующей дифференцировку среде оценивали дифференцировку в кость, жировую ткань и эпидермис окрашиванием ализарином красным, окрашиванием масляным красным и иммунным окрашиванием на кератин 5, соответственно.

(5) Соотношение двойных положительных по рецептору тромбоцитарного фактора роста α (PDGFRα) и CD44 клеток и TEC анализировали проточной цитометрией.

Результаты: силиконовые трубки, заполненные HMGB1, гиалуроновой кислотой или экстрактом кожи, имплантировали под кожу мышей с трансплантированным костным мозгом с GFP. В результате, когда трубки заполняли любым из этих растворов, за одну неделю в трубках скапливалось большое количество GFP-положительных происходящих из костного мозга клеток (TEC). Изображение положительных по GFP клеток, скопившихся в силиконовой трубке, заполненной HMGB1, представлено на фиг.2. Тем временем, количество прикрепленных TEC в силиконовых трубках, заполненных фосфатным буфером, было значимо меньшим. Когда клетки, собранные из силиконовых трубок, заполненных HMGB1, культивировали, наблюдали, что пролиферирующие прикрепляющиеся TEC прикреплялись к культуральной чашке через 24 часа после начала культивирования (фиг.3). Прикрепляющиеся TEC, которые мигрировали в силиконовые трубки, заполненные HMGB1, культивировали в индуцирующей дифференцировку кости среде, индуцирующей дифференцировку жировой ткани среде или индуцирующей дифференцировку эпидермиса среде. Результат показал, что клетки обладали способностью дифференцироваться в положительные по ализарину красному остеобласты, положительнее по масляному красному адипоциты и положительные по кератину 5 эпидермальные клетки, и, таким образом, что среди прикрепляющихся TEC существуют популяции клеток, способные к дифференцировке в мезенхимальные и эпителиальные клетки (фиг.4-6). Более того, оценивали экспрессию PDGFRα и CD44 на TEC проточной цитометрией. Известно, что PDGFRα и CD44 экспрессируется на поверхности мезенхимальных стволовых клеток. Результат показал, что приблизительно 60% TEC были положительными как по PDGFRα, так и по CD44 (фиг.7).

Кроме того, трубки, заполненные гиалуроновой кислотой в концентрации 100 нг/мл (в PBS) имплантировали под кожу спины мышей с трансплантированным костным мозгом с GFP. Через две недели трубки удаляли и клетки, привлеченные в трубки, анализировали в отношении их поверхностных маркеров посредством FACS. Результаты были сходными с результатами, полученными с TEC, выделенными из трубок с HMGB1, и они продемонстрировали, что приблизительно 60% клеток представляли собой клетки P44, положительные как по CD44, так и по PDGFRα, и обладали способностью дифференцироваться в мезенхимальные клетки и эпителиальные клетки, такие как остеобласты и адипоциты.

Обсуждение: в настоящем изобретении авторы настоящего изобретения выявили, что происходящие из костного мозга TEC, способные дифференцироваться в кость, жировую ткань и эпидермис, можно очень эффективно собирать путем имплантации под кожу силиконовых трубок, заполненных HMGB1, гиалуроновой кислотой или экстрактом кожи. Следующие данные указывают на то, что мезенхимальные стволовые клетки селективно привлекаются в TEC: большинство из происходящих из костного мозга TEC экспрессируют PDGFRα и CD44, которые, как известно, экспрессируются на поверхности мезенхимальных стволовых клеток; и все из HMGB1, гиалуроновой кислоты и экстракта кожи обладают активностью привлечения мезенхимальных стволовых клеток. Путем выбора раствора для заполнения силиконовой трубки конкретные биологически функциональные клетки можно селективно собирать с высокой эффективностью в соответствии с веществом, содержащимся в растворе, которое отвечает за привлечение конкретных биологически функциональных клеток. Этот новый способ по настоящему изобретению позволяет собирать желаемые биологически функциональные клетки без использования высоко инвазивных способов, таких как введение иглы в костный мозг. Таким образом, ожидается, что этот способ обеспечит планирование регенеративных медицинских способов на заказ в соответствии с задачей. Более того, собранные клетки можно предоставлять в качестве материалов для различных типов фундаментальных исследований, включающих исследования стволовых клеток. Таким образом, авторы настоящего изобретения полагают, что настоящее изобретение вносит большой вклад в развитие фундаментальных и клинических исследований, а также в разработку лекарственных средств и прогресс медицинских технологий.

Пример 2

Задача: оценить терапевтический эффект происходящих из костного мозга клеток, привлеченных в подкожное устройство, на кожную язву.

Способы:

(1) Изготавливали устройства, подлежащие имплантации в организм.

(2) Для получения экстракта ткани кожи, содержащего факторы, которые привлекают плюрипотентные стволовые клетки костного мозга, от двух новорожденных мышей C57/BL6 (в возрасте двух суток) получали свободные фрагменты кожи и погружали их в 2 мл фосфатно-солевого буфера (PBS), pH 7,4. После инкубации в течение 24 часов при 4°C образец центрифугировали при 440 G и 4°C в течение десяти минут для удаления тканей. Полученный супернатант собирали в качестве экстракта кожи. Более того, для получения экстракта мононуклеарных клеток периферической крови периферическую цельную кровь собирали от двух мышей C57/BL6 в возрасте 4 недель, а затем разбавляли посредством PBS до общего объема 4 мл. После помещения 3 мл Ficoll-Paque Plus (GE) в центрифужную пробирку разбавленную кровь наслаивали на слой Ficoll. Трубку центрифугировали при 100 G при 18°C в течение десяти минут. Полученный средний слой, содержащий мононуклеарные клетки, переносили в свежую центрифужную пробирку. Для удаления Ficoll-Paque Plus из собранного среднего слоя добавляли 45 мл PBS и полученную смесь центрифугировали при 440 G при 18°C в течение пяти минут. Супернатант удаляли, и снова добавляли 45 мл PBS, и суспензию центрифугировали при 440 G при 18°C в течение пяти минут. Супернатант удаляли, и осажденные клетки суспендировали в 200 мл PBS. Суспензию клеток замораживали в морозильной камере при -80°C в течение 30 минут, а затем переносили на лед для размораживания. Эту обработку замораживанием-размораживанием повторяли три раза. Образец центрифугировали при 440 G при 4°C в течение 15 минут. Полученный супернатант собирали (экстракт периферической крови).

(3) Самцов мышей C57/BL6 (в возрасте от шести до восьми недель) облучали летальной дозой (10 Гр). Сразу после облучения мышам трансплантировали происходящие из трансгенной мыши с зеленым флуоресцентным белком (GFP) клетки костного мозга (5×106 клеток/0,1 мл фосфатно-солевого буфера, pH 7,4). В последующих экспериментах использовали только мышей, которые выжили в течение восьми недель после трансплантации.

(4) 40 мкл экстракта кожи и экстракта периферической крови, полученного, как описано в (2), или PBS в качестве отрицательного контроля помещали в устройства. Пару устройств имплантировали мышам, подготовленным согласно (3) (всего два устройства на мышь). Устройства помещали под кожу спины: одно справа, а другое слева, таким образом, чтобы их отверстия контактировали с фасцией. Через две недели после имплантации устройства извлекали из мышей.

(5) После удаления шерсти со спины у мышей C.B-17/lcr-scid/scidJcl (Charles River Japan, Inc.) в возрасте восьми недель, на каждой стороне спины формировали круглые кожные язвы диаметром 6 мм. Для предотвращения сморщивания кожи мыши, к области язвы прикрепляли силиконовый диск с внешним диаметром 10 мм, внутренним диаметром 6 мм и толщиной 1 мм с использованием двухсторонней липкой ленты и медицинского клея, Aron alpha A (Sankyo). Клетки собирали из одного из правого и левого извлеченных устройств, как описано в (3) и вводили в кожную язву. Силиконовый диск диаметром 10 мм и толщиной 1 мм помещали над язвой для предотвращения обезвоживания и бактериальной инфекции. Затем язву покрывали Tegaderm (3M) для защиты. Площадь язвы измеряли через семь суток (фиг.27).

В результате, язва отрицательного контроля не закрывалась на поверхности даже через семь суток. Тем временем, в язве, в которую вводили клетки, собранные из экстракта крови, снижение площади поверхности язвы наблюдали на 5 сутки. С другой стороны, при введении клеток, собранных с использованием экстракта кожи, было выявлено, что язва была закрыта на поверхности на 7 сутки (фиг.27).

Этот пример продемонстрировал, что при введении в очаги кожных язв, происходящие из костного мозга клетки, привлеченные в имплантированное in vivo устройство, которое содержит экстракт ткани, оказывали терапевтический эффект на язву. Терапевтический способ по настоящему изобретению, в котором используются клетки костного мозга, привлеченные в имплантированные устройства, но не осуществляется взятие клеток костного мозга из костного мозга, является совершенно новым терапевтическим способом.

Пример 3

(1) Экстракт кожи и экстракт периферической крови получали способом, описанным выше в примере 2.

Колонки HiTrap Heparin HP (GE) объемом 1 мл уравновешивали 10 мл 10 мМ фосфатного буфера (pH 7,5). Каждый экстракт кожи и экстракт периферической крови разбавляли десятью объемами 10 мМ фосфатного буфера (pH 7,5) и наносили на уравновешенные колонки. Для смывания неспецифично адсорбированных материалов, колонки промывали 10 мл 10 мМ фосфатного буфера (pH 7,5). Адсорбированные компоненты элюировали 10 мМ фосфатным буфером (pH 7,5), содержащим 1000 мМ NaCl, и разделяли на аликвоты (120 мкл) в пластмассовые пробирки. Содержание белка определяли с использованием набора для анализа белка (Bio-Rad), и выделяли три фракции с наиболее высокой концентрацией белка (адсорбированный на гепарин экстракт ткани).

(2) 10 мкл PBS, содержащего 0,1% гиалуроновую кислоту, комбинировали с 40 мкл экстракта ткани. Полученную смесь добавляли в устройства, описанные в примере 2. Смесь гиалуроновой кислоты и 10 мМ фосфатного буфера (pH 7,5), содержащего 1000 мМ NaCl, использовали в качестве отрицательного контроля.

(3) Мышей с трансплантированным костным мозгом с GFP получали тем же способом, который описан в примере 2. Устройства, полученные, как описано в (2), имплантировали под кожу спины мышей. Через десять суток после имплантации устройства удаляли из-под кожи и из устройств собирали клетки. Собранные клетки культивировали в культуральрных чашках, содержащих IMDM (Invitrogen), дополненную 10% эмбриональной телячьей сывороткой, при 37°C в атмосфере 5% CO2. Для удаления неприкрепившихся клеток среду заменяли через одни сутки после начала культивирования. Затем среду заменяли каждые трое суток. Через одну неделю после сбора клеток клетки наблюдали под флуоресцентным микроскопом для выявления происходящих из костного мозга клеток (положительных по GFP клеток) (фиг.28). Более того, количество положительных по GFP клеток определяли с использованием программного обеспечения для анализа изображений (Image J) (фиг.29).

Было продемонстрировано, что смесь гиалуроновой кислоты и гепарин-связывающей фракции экстракта ткани (экстракт крови (фиг.28C), и экстракта кожи (фиг.28D)) имеет выраженную активность привлечения происходящих из костного мозга прикрепляющихся клеток и вовлечение их в устройство (фиг.28 и 29), по сравнению с PBS (фиг.28A) или гиалуроновой кислотой отдельно (фиг.28B).

Этот пример демонстрирует, что факторы, привлекающие клетки костного мозга, можно очищать из экстрактов тканей с использованием гепариновых колонок. Экстракт кожи содержит HMGB1, HMGB2, HMGB3, S100A8 и S100A9. Эти компоненты связываются с гепариновыми колонками, указывая на вероятность того, что эти клетки вовлечены в привлечение клеток костного мозга. Альтернативно, поскольку различные цитокины, такие как факторы роста, также связываются с гепариновыми колонками, полагают, что за привлечение клеток костного мозга отвечает суммарный эффект различных факторов.

Пример 4

(1) РНК экстрагировали из кожи новорожденной мыши с использованием Trizol (Invitrogen), а затем с РНК синтезировали кДНК с использованием набора SuperScript III cDNA Synthesis Kit (Invitrogen). кДНК S100A8 амплифицировали способом полимеразной цепной реакции (ПЦР) с использованием синтезированной кДНК в качестве матрицы. Для очистки кДНК S100A8 встраивали в плазмидный вектор pCAGGS для экспрессии белков клеток млекопитающих, чтобы она экспрессировалась в качестве белка, имеющего последовательности Flag-метки и 6× His-метки на N-конце аминокислотной последовательности. pCAGGS-Flag-His-S100A8 трансфицировали в происходящую из клеток почки эмбриона человека культивированную клеточную линию HEK293 с использованием полиэтиленимина (PEI). Через 48 часов клетки и культуральный супернатант по отдельности собирали центрифугированием при 4400 G и 4°C в течение пять минут. Затем собранный супернатант фильтровали через фильтр из ацетата целлюлозы, имеющий поры диаметром 0,8 мкм (Nalgene), а затем через фильтр из нитроцеллюлозы, имеющий поры диаметром 0,45 мкм (Corning) с получением образца, из которого удалены нерастворимые фракции. Образец наносили на 5-мл HisTrap FF (GE), уравновешенную 50 мл 50 мМ Tris HCl (pH 8,0), содержащего 50 мМ NaCl, и затем адсорбированные компоненты промывали 50 мМ Tris HCl (pH 8,0), содержащим 50 мМ NaCl и 10 мМ имидазол, для удаления неспецифично адсорбированных компонентов. Адсорбированные специфические компоненты элюировали с колонки с использованием 50 мМ Tris HCl (pH 8,0), содержащего 50 мМ NaCl и 100 мМ имидазол. Адсорбированные фракции фракционировали в покрытые силиконом пластмассовые пробирки (500 мкл/пробирка). Белоксодержащие фракции объединяли и смешивали с гранулами M2 с антителом против Flag (Sigma). Смеси инкубировали при 4°C в течение 12 часов при осторожном перемешивании. После инкубации гранулы центрифугировали при 440 G в течение пяти минут. После удаления супернатанта гранулы ресуспендировали в PBS и центрифугировали таким же образом. Супернатант удаляли. Гранулы наносили в 3-мл колонку с внутренним диаметром 1 см, и адсорбированный белок элюировали с колонки с использованием 100 мМ глицина (pH 3,5). Элюат нейтрализовывали 1/10 объема 500 мМ Tris HCl (pH 7,5). Очищенный белок количественно определяли с использованием набора для анализа белка (Bio-Rad).

(2) РНК экстрагировали из кожи новорожденной мыши с использованием Trizol (Invitrogen), а затем с РНК синтезировали кДНК с использованием набора SuperScript III cDNA Synthesis Kit (Invitrogen). кДНК HMGB1 амплифицировали способом полимеразной цепной реакции (ПЦР) с использованием синтезированной кДНК в качестве матрицы. Для очистки кДНК HMGB1 встраивали в плазмидный вектор pCAGGS для экспрессии белков клеток млекопитающих, чтобы она экспрессировалась в качестве белка, имеющего последовательности Flag-метки и 6x His-метки на N-конце аминокислотной последовательности. pCAGGS-Flag-His-S100A8 трансфицировали в происходящую из клеток почки эмбриона человека культивированную клеточную линию HEK293 с использованием полиэтиленимина (PEI). Через 48 часов клетки и культуральный супернатант по отдельности собирали центрифугированием при 4400 G и 4°C в течение пяти минут. Затем собранный супернатант фильтровали через фильтр из ацетата целлюлозы, имеющий поры диаметром 0,8 мкм (Nalgene), а затем через фильтр из нитроцеллюлозы, имеющий поры диаметром 0,45 мкм (Corning) с получением образца, из которого удалены нерастворимые фракции. Образец наносили на 5-мл HisTrap FF (GE), уравновешенную 50 мл 50 мМ Tris HCl (pH 8,0), содержащего 50 мМ NaCl, и затем адсорбированные компоненты промывали 50 мМ Tris HCl (pH 8,0), содержащим 50 мМ NaCl и 10 мМ имидазол, для удаления неспецифично адсорбированных компонентов. Адсорбированные специфические компоненты элюировали с колонки с использованием 50 мМ Tris HCl (pH 8,0), содержащего 50 мМ NaCl и 100 мМ имидазол. Адсорбированные фракции фракционировали в покрытые силиконом пластмассовые пробирки (500 мкл/пробирка). Белоксодержащие фракции объединяли, а затем имидазол удаляли с использованием колонки для обессоливания PD10 (GE). Фракции элюировали с использованием 50 мМ Tris HCl (pH 7,5), содержащего 150 мМ NaCl. К элюированным образцам добавляли HRV3C (Novagen), и смесь инкубировали при 4°C в течение трех часов. После расщепления образец наносили на 1-мл колонку HiTrap Heparin (GE), уравновешенную 50 мМ Tris HCl (pH 7,5), содержащим 150 мМ NaCl. Внутреннюю часть колонки промывали 50 мМ Tris HCl (pH 7,5), содержащим 150 мМ NaCl. Белок, связанный с колонкой, элюировали 50 мМ Tris HCl (pH 7,5), содержащим 1000 мМ NaCl. Элюированный образец разделяли на аликвоты в покрытые силиконом пластмассовые пробирки (500 мкл/пробирка).

(3) 40 мкг каждого из S100A8, HMGB1, HMGB2 и HMGB3 добавляли в силиконовые устройства. Устройства имплантировали под кожу спины справа и слева, так чтобы отверстия устройств контактировали с фасцией. Через десять суток после имплантации, устройства удаляли из-под кожи, и из устройств собирали клетки, скопившиеся в устройствах. Клетки культивировали в культуральных чашках, содержащих IMDM (Invitrogen), дополненную 10% эмбриональной телячьей сывороткой при 37°C в атмосфере 5% CO2. Для удаления неприкрепившихся клеток среду заменяли через одни сутки после начала культивирования. Затем среду заменяли каждые трое суток. Через одну неделю после сбора клетки наблюдали под флуоресцентным микроскопом для детекции происходящих из костного мозга клеток (GFP-положительных клеток) (фиг.30).

(4) Округлые кожные язвы диаметром 6 мм формировали на спине (с левой и с правой стороны) мыши BALB/cAJcl-nu/nu (Charles River Japan, Inc.) в возрасте восьми недель. Для предотвращения сужения кожи мыши, к области язвы прикрепляли силиконовый диск с внешним диаметром 10 мм, внутренним диаметром 6 мм и толщиной 1 мм с использованием двухсторонней клейкой ленты и медицинского адгезива, Aron alpha A (Sankyo).

(5) Клетки, описанные в (3), открепляли от культуральных чашек обработкой раствором, содержащим 0,5 г/л трипсина и 0,53 ммоль/л ЭДТА (Nacalai Tesque). После инактивации трипсина IMDM, содержащим 10% FBS, клетки центрифугировали при 440 G при 4°C в течение пяти минут. После удаления супернатанта клетки вводили в язву, сформированную, как описано в (4). Силиконовый диск диаметром 10 мм и толщиной 1 мм помещали на язву для предотвращения обезвоживания и бактериальной инфекции в этой области. Затем язву покрывали Tegaderm (3M) для защиты. Площадь язвы измеряли через семь суток после введения (фиг.31).

Все из S100A8, HMGB1, HMGB2 и HMGB3 проявляли активность привлечения клеток костного мозга (фиг.30; A, S100A8; B, HMGB1; C, HMGB2; D, HMGB3) по сравнению с отрицательным контролем (E). В частности, HMGB1 и HMGB2 показали более сильную активность привлечения.

Более того, кожную язву обрабатывали путем введения происходящих из костного мозга клеток, привлеченных HMGB1, HMGB2 или S100A8. Наблюдали эффект уменьшения язвы (фиг.31) по сравнению с отрицательным контролем (введение PBS).

Этот пример продемонстрировал, что все из S100A8, HMGB1, HMGB2 и HMGB3 проявляли активность привлечения происходящих из костного мозга прикрепляющихся клеток и вовлечения их в устройство. Большинство клеток в костном мозге представляют собой кроветворные клетки, такие как эритроциты и гемоциты, и большинство из клеток представляют собой не прикрепляющиеся клетки. Тем временем, мезенхимальные клетки, такие как мезенхимальные стволовые клетки, известны в качестве прикрепляющихся клеток. Полагают, что такие клетки включают плюрипотентные клетки, способные дифференцироваться в эпителиальные и нервные клетки. Поскольку в этом примере показано, что клетки, привлеченные в устройство с использованием S100A8, HMGB1 или HMGB2, оказывали терапевтическое действие на кожную язву, клетки, привлеченные в устройства, представляют собой происходящие из костного мозга клетки, способные индуцировать заживление повреждений тканей. Было описано, что мезенхимальные стволовые клетки костного мозга оказывали терапевтическое действие при введении в очаги кожной язвы (мезенхимальные стволовые клетки усиливают заживление ран посредством дифференцировки и ангиогенеза. Wu Y, Chen L, Scott PG, Tredget EE. Stem Cells 2007 Oct; 25(10): 2648-59; Epub 2007 Jul 5). Таким образом, полагают, что мезенхимальные стволовые клетки костного мозга вовлечены в терапевтический эффект, описанный в этом примере. Более того, известно, что происходящие из костного мозга клетки, такие как мезенхимальные стволовые клетки костного мозга, дифференцируются в нервные клетки, адипоциты, остеоциты, хондроциты и эпителиальные клетки. Клетки, собранные с использованием устройств по настоящему изобретению, применимы для нового индуцирующего регенерацию лекарственного средства, где поврежденные ткани обрабатывают путем предоставления тканям клеток.

Справочный пример 1

Задача: идентификация семейства HMGB1 в экстракте кожи и исследование активности индукции мезенхимальных стволовых клеток.

Способы: наличие или отсутствие в неонатальном экстракте кожи мыши семейства белков HMGB подтверждали с использованием способа вестерн-блоттинга. Свободные фрагменты кожи от 400 новорожденных мышей погружали в 400 мл физиологического фосфатно-солевого буфера (PBS; pH 7,4) и раствор инкубировали при 4°C в течение 24 часов. Для удаления тканей образцы центрифугировали при 440 G при 4°C в течение 10 минут и супернатант собирали в качестве экстракта кожи. Десять мкл полученного экстракта кожи использовали в качестве образца и подвергали SDS-PAGE электрофорезу. Белки, разделенные в геле, переносили на PVDF-мембрану с использованием устройства для блоттинга (ATTO). Мембрану инкубировали с PBS, содержащим 3% обезжиренное молоко и 0,1% Tween20 (S-T-PBS) при комнатной температуре в течение одного часа, и затем ей позволяли реагировать с каждым из антитела кролика против HMGB1 мыши, антитела кролика против HMGB2 мыши, или антитела кролика против HMGB3 мыши, которые разбавляли в 1000 раз посредством S-T-PBS, при 4°C в течение 16 часов. После реакции мембрану PVDF промывали посредством S-T-PBS пять раз в течение 5 минут. Затем мембрану PVDF инкубировали с разбавленным в 2000 раз (разбавленным посредством S-T-PBS) меченным пероксидазой антителом козы против IgG кролика (GE Healthcare) при 25°C в течение 1 часа. Кроме того, после промывания посредством S-T-PBS пять раз в течение 5 минут мембране PVDF позволяли реагировать с системой для детекции вестерн-блоттингом ECL (GE Healthcare). Пленку ECL экспонировали и проявляли для детекции присутствия белков HMGB1, HMGB2 и HMGB3.

РНК экстрагировали из кожи новорожденной мыши с использованием Trizol (Invitrogen), и далее синтезировали кДНК с использованием набора SuperScript III cDNA Synthesis Kit (Invitrogen). С использованием этой кДНК в качестве матрицы амплифицировали кДНК HMGB1, HMGB2 и HMGB3 способом полимеразной цепной реакции (ПЦР). кДНК встраивали в плазмидный вектор pCAGGS для экспрессии белков в клетках млекопитающих, так чтобы могли экспрессироваться белки с дополнительной последовательностью Flag-метки (Asp-Tyr-Lys-Asp-Asp-Asp-Lys; SEQ ID: 30) на N-конце аминокислотной последовательности. Эти плазмидные векторы трансфицировали в HEK293 (культуру клеточной линии, происходящую из почки эмбриона человека) и культивировали в течение 48 часов для экспрессии белков. Клетки, экспрессирующие каждый из белков HMGB1, HMGB2 и HMGB3 и культуральный супернатант, инкубировали при 4°C в течение 16 часов, а затем их центрифугировали при 4400 g в течение 5 минут для сбора супернатанта. 100 мкл геля антитела против Flag (Sigma) смешивали с 50 мл этого супернатанта, а затем инкубировали при 4°C в течение 16 часов. Затем проводили центрифугирование для сбора геля и промывание посредством PBS пять раз. Кроме того, белок элюировали с использованием пептида 3x Flag (конечная концентрация 100 мкг/мл). Экспрессию рекомбинантных белков исследовали способом вестерн-блоттинга с использованием разбавленного в 1000 раз (разбавленного S-T-PBS) антитела мыши против Flag и разбавленного в 2000 раз (разбавленного S-T-PBS) меченного пероксидазой антитела против IgG мыши (GE Healthcare). Активность миграции мезенхимальных стволовых клеток костного мозга мыши в этих очищенных рекомбинантных белках оценивали с использованием камеры Бойдена. Более того, для исследования лекарственной эффективности средства на основе семейства HMGB in vivo, из кожи спины мышей C57BL/6 в возрасте 8 недель вырезали круг, имеющий диаметр 8 мкм, для осуществления моделей кожных язв. Каждый из очищенных HMGB1, HMGB2 и HMGB3 (100 нг/мкл) смешивали с тем же количеством раствора гиалуроновой кислоты в концентрации 1 г/100 мл PBS, и 100 мкл его вводили на поверхность язвы. Поверхность язвы покрывали прозрачной клейкой повязкой на рану/защитным материалом Tegaderm (3M Healthcare), чтобы избежать высыхания, и площадь раны измеряли с течением времени для определения терапевтического эффекта.

Кроме того, для исследования того, обладает ли экстракт кожи человека и очищенный HMGB1 человека активностью обеспечения миграции мезенхимальных стволовых клеток костного мозга человека, использовали камеру Бойдена. Кожу человека, имеющую площадь 1 см2, погружали в 1 мл PBS, а затем инкубировали при 4°C в течение 16 часов, а затем центрифугировали при 440 G при 4°C в течение 10 минут. Супернатант отдельно собирали для применения в качестве экстракта кожи человека. Более того, мезенхимальные стволовые клетки костного мозга человека (Cambrex) использовали в качестве клеток, помещаемых в верхнее отделение камеры Бойдена (в результате анализа поверхностных антигенов проточной цитометрией было подтверждено, что эти клетки являются CD105-положительными, CD166-положительными, CD29-положительными, CD44-положительными, CD34-отрицательными и CD45-отрицательными. Также с помощью тестов индукции дифференцировки было выявлено, что они дифференцируются в адипоциты, хондроциты и остеоциты). Более того, в нижнее отделение помещали 100 нг/лунка HMGB1 человека (R&D) и экстракта кожи человека, разбавленного в 10 раз PBS. В качестве контроля использовали PBS.

Результаты: в результате вестерн-блоттинга, были выявлены полосы HMGB2 и HMGB3, а также полоса HMGB1. Таким образом, было подтверждено, что экстракт кожи новорожденной мыши содержит, помимо HMGB1, белки семейства HMGB2 и HMGB3 (фиг.8). Получали экспрессирующие векторы HMGB1/HMGB2/HMGB3, имеющих Flag-метку, добавленную на N-конец каждого белка (фиг.9). Эти экспрессирующие векторы трансфицировали в клетки HEK293, и экспрессированные белки очищали с использованием Flag-метки, и для выявления этих белков проводили вестерн-блоттинг (фиг.10). Активность миграции мезенхимальных стволовых клеток костного мозга мыши определяли с использованием этих очищенных белков, и активность была подтверждена для всех из этих белков (фиг.11). Площадь язвы, сформированной на спине мыши, измеряли каждые 7 суток, и в группах введения HMGB1, 2 и 3, был подтвержден значительный эффект в отношении снижения площади язвы по сравнению с группой без введения (фиг.12). Аналогично случаю с мышью, было выявлено, что HMGB1 человека и экстракт кожи человека обладает активностью индукции миграции мезенхимальных стволовых клеток костного мозга (фиг.13).

Обсуждение: HMGB2 и HMGB3 известны в качестве белков, обладающих высокой гомологией с HMGB1. Также предполагается, что эти белки имеют свойства, сходные с HMGB1. Было подтверждено, что HMGB2 и HMGB3 семейства HMGB1 также выделяются из экстракта свободного среза кожи. Кроме того, продуцировали рекомбинантные белки HMGB1/HMGB2/HMGB3, и также были подтверждены их активность в отношении миграции мезенхимальных стволовых клеток костного мозга in vitro и терапевтический эффект на кожную язву in vivo. Было выявлено, что семейство HMGB (HMGB1/HMGB2/HMGB3) и рекомбинантное семейство HMGB в свободном срезе кожи новорожденной мыши обладают активностью индукции мезенхимальных стволовых клеток костного мозга и активностью локальной индукции происходящих из костного мозга стволовых клеток, которые могут дифференцироваться в эпителий и таким образом индуцированная группа происходящих из костного мозга клеток дифференцируется в различные клетки, такие как эпидермальные кератиноциты, волосяные фолликулы и фибробласты в поврежденной ткани, обеспечивая восстановление поврежденной ткани. Более того, поскольку мезенхимальные стволовые клетки костного мозга представляют собой мультипотентные стволовые клетки, авторы настоящего изобретения полагают, что также аналогично можно ожидать терапевтических эффектов путем систематического введения или местного введения семейства HMGB для лечения повреждений в других тканях, например, повреждений тканей, таких как повреждение головного мозга, инфаркт миокарда и перелом кости.

Более того, известно, что между человеком и мышью гомология аминокислотных последовательностей для HMGB1 составляет 98% (213/215), 96% (202/210) для HMGB2, и 97% (195/200) для HMGB3. Таким образом, считается, что HMGB человека и HMGB мыши имеют сходную активность, и результаты показали, что экстракт кожи человека и HMGB1 человека обладают такой же активностью индукции мезенхимальных стволовых клеток костного мозга, как и экстракт кожи мыши и HMGB1 мыши.

Справочный пример 2

Задача: установление способа продукции экстракта тканей, содержащего факторы, индуцирующие мезенхимальные стволовые клетки костного мозга.

Способы: головной мозг, сердце, кишечник, почку и печень мыши C57BL6 в возрасте 6 недель и кожу новорожденной мыши погружали в 1 мл физиологического фосфатно-солевого буфера (PBS) при pH 7,4. Растворы инкубировали при 4°C в течение 24 часов, а затем центрифугировали при 440 G при 4°C в течение 10 минут для удаления тканей. Супернатанты собирали с получением экстрактов тканей. Для подтверждения того, обладает ли полученный таким образом экстракт активностью индукции происходящих из костного мозга мезенхимальных стволовых клеток, исследовали активность миграции происходящих из костного мозга мезенхимальных стволовых клеток с использованием камеры Бойдена. Более того, измеряли концентрацию HMGB1, содержащегося в этих образцах, с использованием набора HMGB1 ELISA Kit (Shino-Test). Кроме того, экстрактам тканей головного мозга, сердца и кожи позволяли связываться с аффинной колонкой с гепарином, и активность индукции происходящих из костного мозга мезенхимальных стволовых клеток в связанной с белком фракции подтверждали с использованием камеры Бойдена.

Результаты: экстракт головного мыши содержал количество HMGB1, эквивалентное экстракту кожи новорожденной мыши. Кроме того, активность индукции мезенхимальных стволовых клеток костного мозга также наблюдали в головном мозге мыши, как и в коже. Хотя экстракт кишечника мыши и экстракт сердца мыши содержали мало HMGB1, также наблюдали активность индукции мезенхимальных стволовых клеток костного мозга. Более того, связанные с колонкой с гепарином фракции головного мозга мыши и сердца мыши, а также связанная с колонкой с гепарином фракция кожи мыши, показали активность индукции мезенхимальных стволовых клеток костного мозга (фиг.14). В таблице 1 представлены результаты измерения концентрации HMGB1 и активности индукции мезенхимальных стволовых клеток костного мозга в каждом из экстрактов тканей мыши.

Таблица 1
Концентрация HMGB1 (нг/мл) Костный мозг
- мезенхимальная стволовая клетка
- активность индукции
Кожа 110 Присутствует
Головной мозг 140 Присутствует
Сердце 4 Присутствует
Кишечник 0 Присутствует
Почка 115 ND
Печень 61 ND
ND: не определялось

Обсуждение: разработан способ, которым HMGB1 можно удобным образом экстрагировать не только из кожи, но также из головного мозга посредством прямого погружения этих органов в физиологический буфер. Этот способ также применим к другим органам, таким как печень и почка. Более того, хотя экстракты из кишечника и сердца содержат мало HMGB1, наблюдали активность индукции мезенхимальных стволовых клеток костного мозга. Это указывает на то, что эти экстракты содержат другое вещество(а), индуцирующее мезенхимальные стволовые клетки костного мозга, помимо HMGB1. Такие вещества, содержавшиеся в этих экстрактах, исходно присутствуют в каждой ткани, и полагают, что они в физиологических условиях привлекают мезенхимальные стволовые клетки костного мозга в поврежденную ткань, когда ткань повреждена. С помощью настоящего изобретения разработан новый способ удобной и функциональной экстракции из различных органов множества веществ, индуцирующих мезенхимальные стволовые клетки костного мозга, включая HMGB1. Кроме того, также разработан способ очистки веществ, индуцирующих мезенхимальные стволовые клетки костного мозга, из экстракта ткани с использованием связывания с колонкой с гепарином. Эти вещества, обладающие активностью индукции мезенхимальных стволовых клеток костного мозга, можно очищать из головного мозга и сердца, также как и из кожи, с использованием колонки с гепарином.

Справочный пример 3

Задача: установление способа экстракции активаторов миграции мезенхимальных стволовых клеток из культивированных клеток.

Способы: происходящую из почки эмбриона человека клеточную линию HEK293 и клеточную линию карциномы шейки матки человека HeLa культивировали в D-MEM (Nacalai), содержащей 10% эмбриональную телячью сыворотку. Эти клетки промывали посредством PBS, а затем 107 клеток погружали в 5 мл PBS (Nacalai) при 4°C в течение 16 часов. Раствор центрифугировали при 440 G (гравитационное ускорение) при 4°C в течение 5 минут, а затем супернатант собирали. Мезенхимальные стволовые клетки костного мозга человека помещали в верхнее отделение камеры Бойдена, и разбавленный в 5 раз (посредством DMEM) экстракт клеток помещали в нижнее отделение, для подтверждения миграционной активности мезенхимальных стволовых клеток костного мозга человека.

Результаты: как экстракт HEK293, так и экстракт HeLa, показали сходную активность в отношении миграции мезенхимальных стволовых клеток костного мозга (фиг.15).

Обсуждение: активаторы миграции мезенхимальных стволовых клеток костного мозга успешно экстрагированы удобным способом погружения культивируемых клеток в PBS.

Справочный пример 4

Задача: исследование того, можно ли индуцировать регенерацию нервных клеток, путем создания моделей дефекта головного мозга мышей, которым вводят очищенную на колонке с гепарином фракцию экстракта кожи способом замедленного высвобождения локально в область повреждения, обеспечивая миграцию стволовых клеток, содержащихся в миелоидной системе, локально в область повреждения.

Способы:

(1) Получение очищенной на колонке с гепарином фракции экстракта кожи

Вырезанный срез кожи новорожденной мыши инкубировали в PBS (мышь/мл) при 4°C в течение 16 часов, и получали экстракт кожи. Экстракт кожи разбавляли в 10 раз 9 объемами 20 мМ фосфатного буфера при pH 7,5 при 4°C. Предварительно для уравновешивания колонки в колонку HiTrap Hepalin HP (объем колонки: 5 мл, GE Healthcare) выливали 20 мМ фосфатный буфер, pH 7,5 (30 мл). Затем разбавленному раствору позволяли связаться с колонкой. Затем колонку промывали 20 мМ фосфатным буфером при pH 7,5 и 100 мМ NaCl (30 мл). Для элюирования адсорбированных белков, в колонку выливали 20 мМ фосфатный буфер с pH 7,5 и 1000 мМ NaCl, и фракции элюировали в пробирки. Каждую из адсорбированных фракций оценивали путем определения активности миграции происходящих из костного мозга клеток мыши с использованием способа с камерой Бойдена, и собирали фракцию(и), имеющую активность в отношении миграции. Раствор(ы), обладающий активностью, использовали в качестве очищенной на гепарине фракции(ий) экстракта кожи в следующем справочном примере.

(2) Получение мышей с подавлением костного мозга

Мышей облучали однократной дозой рентгеновского излучения, составляющей 10 Гр, для получения мышей с подавлением костного мозга.

(3) Трансплантация костного мозга мыши с GFP мышам с подавлением костного мозга

Клетки костного мозга собирали из обеих бедренных костей и костей голени мышей GFP. Эти клетки вводили мышам с подавлением костного мозга через хвостовую вену через 24 часа после облучения. Введение проводили под ингаляционной анестезией с использованием изофлурана.

(4) Получение модели дефекта головного мозга (дефекта тканей головного мозга) на мышах

Мышей с подавлением костного мозга, которым трансплантировали клетки костного мозга мыши с GFP, подвергали ингаляционной анестезии с использованием изофлурана и пентобарбитала (45 мг/кг), которые мышам инъецировали внутрибрюшинно. Мышей фиксировали к стереотактическому устройству для головного мозга и проводили срединный разрез головы скальпелем. Трепанацию проводили на 2,5 мм латерально справа и 12,5 мм спереди брегмы с использованием бура (фиг.16A). На глубине 3 мм от этого участка помещали и фиксировали иглу 20 G Surflow. Затем применяли отрицательное давление с использованием шприца для отсасывания части ткани головного мозга (фиг.16B).

(5) Введение очищенной на колонке с гепарином фракции экстракта кожи в область дефекта ткани головного мозга

Пять микролитров очищенной на колонке с гепарином фракции экстракта кожи, растворенной в адгезивном составе для тканей на основе фибрина (фибриноген) (Bolheal (Kaketsuken)) инъецировали в указанную выше область, а затем инъецировали 5 мкл адгезивного состава для тканей на основе фибрина (тромбин) (Bolheal (Kaketsuken)) с использованием шприца Hamilton и шприца 26 G (фиг.16C). Задачей этого действия было обеспечение эффекта замедленного высвобождения для очищенной на колонке с гепарином фракции экстракта кожи.

(6) Оценка эффекта регенерации нервных клеток в областях дефекта тканей головного мозга

Для оценки использовали мышей контрольной группы и группы введения. Определяли параметры в соответствующие периоды времени (с течением времени), мышам проводили перфузию 4% параформальдегидом, а затем их фиксировали и вырезали головной мозг. Кроме того, проводили наружную фиксацию 4% параформальдегидом. Затем его дегидратировали в 15% и 30% градиенте сахарозы с получением замороженных срезов.

Ядра окрашивали раствором DAPI (4',6-диамидино-2-фенилиндол, дигидрохлорид) и срез закрывали с использованием ингибитора фотообесцвечивания. Накопление GFP-положительных клеток в области повреждения (области дефекта ткани головного мозга) оценивали с использованием конфокального лазерного микроскопа.

Результаты: качественно показано накопление GFP-положительных клеток в течение 2 недель и в течение 6 недель после введения. Накопление GFP-положительных клеток имеет тенденцию к тому, чтобы быть более высоким в областях повреждения группы введения, а не в контрольной группе, как через 2 недели (контроль; фиг.16D, фракция очищенного на колонке с гепарином экстракта кожи; фиг.16E), так и через 6 недель (контроль; фиг.16F, фракция очищенного на колонке с гепарином экстракта кожи; фиг.16G) после введения.

Обсуждение: введение очищенной на колонке с гепарином фракции экстракта кожи приводило к накоплению происходящих из костного мозга клеток в области дефекта ткани головного мозга, которые имели форму нервных клеток. Известно, что происходящие из костного мозга мезенхимальные стволовые клетки также дифференцируются в нервные клетки и результат показал, что очищенная на колонке с гепарином фракция экстракта кожи способна индуцировать регенерацию нервных клеток поврежденной области головного мозга. Более того, это также применимо к регенерации нейронов поврежденных областей в тканях головного мозга при ишемических заболеваниях головного мозга и контузиях головного мозга.

Справочный пример 5

Задача: идентифицировать факторы индукции происходящих из ткани костного мозга стволовых клеток в экстрактах тканей кожи.

Способы: способом, описанным ниже, проводили исследование для идентификации факторов, ответственных за привлечение мезенхимальных стволовых клеток костного мозга, которые предположительно высвобождаются из вырезанной кожи в условиях гемостаза.

(1) Клетки костного мозга собирали из бедренных костей или костей голени мышей C57BL/6 для получения происходящих из костного мозга мезенхимальных стволовых клеток мыши. Клетки высевали в чашку для культивирования клеток с D-MEM (Nacalai), дополненной 10% эмбриональной телячьей сывороткой в качестве культуральной среды, и культивировали при 37°C под 5% газообразным диоксидом углерода. Когда клетки вырастали, чтобы занимать площадь от 70 до 100% относительно дна культуральной чашки, клетки отделяли от культуральной чашки с использованием 0,25% трипсина/1 мМ ЭДТА (Nacalai). Затем клетки пассировали в тех же условиях культивирования. После по меньшей мере пяти пассажей прикрепляющиеся клетки выделяли и далее культивировали и анализировали в отношении антигенов клеточной поверхности проточной цитометрией. Результат показал, что клетки были положительными по CD44 и Sca-1, и отрицательными по Lin, CD45 и c-kit. Было подтверждено, что клетки могут дифференцироваться в остеоциты и адипоциты и, таким образом, они имеют характеристики мезенхимальных стволовых клеток костного мозга.

(2) Свободные фрагменты кожи, полученные от пяти новорожденных мышей (в возрасте двух суток), погружали в 5 мл физиологического фосфатно-солевого буфера (PBS, pH 7,4). После инкубации в течение 24 часов при 4°C образец центрифугировали при 440 G при 4°C в течение десяти минут для удаления тканей. Супернатант собирали в качестве экстракта кожи. Кроме того, аналогично, свободные фрагменты кожи от мыши в возрасте шести недель погружали в 5 мл физиологического фосфатно-солевого буфера (PBS, pH 7,4). После инкубации при 4°C в течение 24 часов образцы центрифугировали при 440 G при 4°C в течение десяти минут для удаления тканей. Супернатанты собирали в качестве экстракта кожи.

(3) Для подтверждения того, обладает ли полученный экстракт кожи активностью индукции мезенхимальных стволовых клеток костного мозга, авторы настоящего изобретения использовали камеру Бойдена для исследования хемотаксической активности ранее клонированных происходящих из костного мозга мезенхимальных клеток, полученных от мышей C57BL6. Конкретно, смесь DMEM (20 мкл) и экстракта кожи (5 мкл) от мышей в возрасте двух суток или шести недель добавляли в нижнее отделение (объем 25 мкл) камеры Бойдена, и сверху помещали поликарбонатную мембрану с микропорами 8 мкм. Затем верхнее отделение (объем 50 мкл) камеры Бойдена контактировали с мембраной, а в верхнее отделение помещали суспензию происходящих из костного мозга мезенхимальных стволовых клеток (5×104 клеток/50 мл культуральной среды (DMEM, дополненная 10% эмбриональной телячьей сывороткой)). Камеру инкубировали в инкубаторе с CO2 при 37°C в течение от четырех до 24 часов. После инкубации верхнее отделение камеры удаляли. Тонкую силиконовую пленку открепляли, и посредством окрашивания клеток определяли количество происходящих из костного мозга мезенхимальных стволовых клеток, мигрировавших в нижнее отделение через микропоры (фиг.17).

(4) Образцы кожи размером примерно 2 см2 вырезали от мышей в возрасте двух суток и в возрасте шести недель и сразу замораживали в жидком азоте. Образцы кожи растирали в ступке. Из образцов вырезали и очищали РНК с использованием RNeasy (Qiagen). С использованием очищенных РНК проводили анализ на микрочипах для скрининга мРНК, экспрессирующейся на более высоких уровнях у мышей в возрасте двух суток. 767 генов показали в два или более раз более высокие показатели у мышей в возрасте двух суток. Среди этих генов исследовали белки с высокой аффинностью к гепарину, потенциальные секреторные белки, и гены, показатели для которых в шесть или более раз были более высокими у мышей в возрасте двух суток, и S100A9 был выявлен в качестве 57 гена по счету сверху. Таким образом, вестерн-блоттингом был выявлен S100A8, который, как известно, формирует гетеродимер с S100A9 в экстракте кожи от мышей в возрасте двух суток. Конкретно, 5 мкл экстракта кожи от мышей в возрасте двух суток смешивали с 5 мкл буфера для образца SDS-PAGE (Bio-Rad). Смесь нагревали в термоблоке при 98°C в течение пяти минут, а затем охлаждали до 25°C. Полученный образец наносили на 12,5% акриламидный гель e-PAGEL (ATTO) и подвергали электрофорезу при 40 мА в течение 75 минут с использованием устройства для электрофореза (ATTO). Гель собирали после электрофореза. С использованием устройства для блоттинга (ATTO) белки в геле переносили в мембрану PVDF (7 см на 9 см, Millipore), предварительно обработанную 100% метанолом. После переноса белка в течение 75 минут при 120 мА мембрану PVDF удаляли и встряхивали при комнатной температуре в течение 30 минут в PBS (Nacalai), содержащем 4% обезжиренное молоко. Затем удаленную мембрану PVDF погружали в 5 мкл антитела против S100A8 (R&D) или антитела против S100A9 (R&D), каждое из которых было разбавлено 10 мл PBS, содержащего 4% обезжиренного молока, и встряхивали при комнатной температуре в течение 60 минут. После удаления раствора антитела мембрану встряхивали в 30 мл PBS, содержащего 0,1% Tween20 при комнатной температуре в течение пяти минут. Это промывание повторяли пять раз. Затем мембрану пропитывали 5 мкл меченного HRP антитела против IgG козы (GE healthcare), разбавленного 10 мл PBS, содержащего 4% обезжиренное молоко, и встряхивали при комнатной температуре в течение 45 минут. После удаления раствора антитела, мембрану промывали 30 мл PBS, содержащего 0,1% Tween20 при комнатной температуре в течение пяти минут при встряхивании. Это промывание повторяли пять раз. Мембрану обрабатывали для люминесценции с использованием набора ECL Detection Kit (GE healthcare), а затем экспонировали на пленку. Сигналы для белков S100A8 и S100A9 получали путем проявки пленки в проявочном устройстве (фиг.18).

(5) Факторы, обладающие активностью привлечения происходящих из костного мозга мезенхимальных стволовых клеток в экстрактах кожи очищали аффинной колоночной хроматографией с гепарином. Эксперимент, описанный ниже, проводили с использованием устройства FPLC (GE healthcare). Прежде всего, экстракт кожи мышей в возрасте двух суток разбавляли в 10 раз девятью объемами 20 мМ фосфатного буфера (pH 7,5) при 4°C (раствор для разбавления A). Предварительно через колонку HiPrep 16/10 Heparin FF (GE Healthcare) пропускали 300 мл 20 мМ фосфатного буфера (pH 7,5) для уравновешивания колонки, и в колонку помещали раствор для разбавления A. Затем колонку промывали 300 мл 20 мМ фосфатного буфера (pH 7,5). Для элюирования адсорбированного белка получали 20 мМ фосфатный буфер (pH 7,5), содержащий 10 мМ NaCl (раствор A) и 20 мМ фосфатный буфер (pH 7,5), содержащий 500 мМ NaCl (раствор B). Элюирование начинали с [100% раствор A + 0% раствор B], а затем долю раствора B постепенно увеличивали. Наконец, колонку элюировали посредством [0% раствор A + 100% раствор B]. Общий элюированный объем составил 150 мл. Элюат фракционировали в покрытые силиконом пробирки (3 мл/пробирка). 5 мкл каждого из фракционированных образцов смешивали с 5 мкл буфера для образца SDS-PAGE (Bio-Rad). Смеси нагревали в термоблоке при 98°C в течение пяти минут, а затем охлаждали до 25°C. Образцы наносили на акриламидный гель e-PAGEL (5-20% градиент, ATTO), и подвергали электрофорезу при 40 мА в течение 75 минут с использованием устройства для электрофореза. После электрофореза проводили детекцию подвергнутого электрофорезу белка с использованием набора Dodeca Silver Stain Kit (Bio-Rad) (фиг.19).

Хемотаксическую активность фракционированных образцов оценивали аналогично тому, как описано выше, с использованием камеры Бойдена (фиг.20).

Присутствие белков S100A8 и S100A9 во фракционированных образцах выявляли аналогично тому, как описано выше, вестерн-блоттингом (фиг.21).

(6) РНК экстрагировали из кожи новорожденной мыши с использованием Trizol (Invitrogen), а затем с РНК синтезировали кДНК с использованием набора SuperScript III cDNA Synthesis Kit (Invitrogen). кДНК S100A8 и S100A9 амплифицировали способом полимеразной цепной реакции (ПЦР) с использованием кДНК в качестве матрицы. Каждую из этих кДНК встраивали в плазмидный вектор для экспрессии белка в клетках млекопитающих pCAGGS, для экспрессии белков, в которых с N-концом их аминокислотных последовательностей связана последовательность GST-метки (аминокислотная последовательность/SEQ ID NO: 31; последовательность ДНК/SEQ ID NO: 32) (фиг.22). Каждый из pCAGGS-GST-S100A8 или pCAGGS-GST-S100A9 трансфицировали в культивированную клеточную линию, происходящую из почки эмбриона человека, HEK293 с использованием реагента для липофекции (Invitrogen). Через 48 часов после трансфекции, клетки и культуральный супернатант собирали и центрифугировали при 4400 G при 4°C в течение пяти минут. Супернатант (супернатант A) и клетки собирали по отдельности. К клеткам добавляли PBS, содержащий 0,1% Tween20, и суспензию обрабатывали ультразвуком на льду в течение 30 секунд для разрушения клеточной мембраны. После центрифугирования при 4400×g при 4°C в течение пяти минут полученный супернатант собирали (супернатант B). Супернатанты A и B объединяли и помещали в колонку HiTrap GST FF (5 мл; GE Healthcare), буфер которой предварительно заменяли 30 мл PBS. После загрузки колонку промывали 100 мл PBS и адсорбированный белок элюировали 20 мМ фосфатным буфером (pH 8), содержащим восстановленный глутатион. Хемотаксическую активность рекомбинантных S100A8 и S100A9 в отношении мезенхимальных стволовых клеток костного мозга оценивали с использованием камеры Бойдена. Образцы получали растворением очищенного белка S100A8 или S100A9 в концентрации 0,1 нг/мкл в DMEM, или путем разбавления экстракта кожи мышей в возрасте двух суток четырьмя объемами DMEM, и их добавляли в нижнее отделение камеры Бойдена. Аналогично использовали отрицательный контроль, полученный следующим образом: белок экстрагировали из клеток, трансфицированных контрольным вектором, который не несет кДНК S100A8 или S100A9 в качестве вставки; а затем фракцию элюировали с колонки HiTrap GST FF. После добавления образца в нижнее отделение сверху помещали поликарбонатную мембрану с микропорами 8 мкм. Затем верхнее отделение (объем 50 мкл) камеры Бойдена контактировали с мембраной и в верхнюю камеру добавляли суспензию происходящих из костного мозга мезенхимальных стволовых клеток (5×104 клеток/50 мл культуральной среды (DMEM, дополненная 10% эмбриональной телячьей сывороткой)). Камеру инкубировали в инкубаторе с CO2 при 37°C в течение от четырех до 24 часов. После инкубации верхнее отделение камеры удаляли. Тонкую силиконовую пленку открепляли и посредством окрашивания клеток определяли количество происходящих из костного мозга мезенхимальных стволовых клеток, мигрировавших в нижнее отделение через микропоры (фиг.23).

(7) Мышам в возрасте восьми недель инъецировали 250 мкл описанных выше очищенных рекомбинантных белков GST-S100A8 или S100A9 (1 нг/мкл) через хвостовую вену. Через 12 часов после инъекции 1 мл периферической крови отбирали из сердца мышей под ингаляционной анестезией с изофлураном с использованием 1-мл покрытого гепарином шприца. Каждый из образцов крови смешивали с 3 мл PBS, а затем наслаивали на 3 мл Ficoll (GE healthcare). Полученные образцы центрифугировали с использованием центрифуги при 400×g при 25°C в течение 40 минут. Клетки мутного среднего слоя собирали в качестве фракции мононуклеарных клеток. К собранным клеткам добавляли 1 мл раствора HLB (Immuno-Biological Laboratories Co., Ltd.), гемолитического средства, и клетки инкубировали при комнатной температуре в течение пяти минут. Эту гемолитическую обработку повторяли дважды. После добавления 10 мл PBS, клетки центрифугировали при 440×g при 25°C в течение пяти минут. Полученные супернатанты удаляли и клетки собирали. 1000000 клеток инкубировали при комнатной температуре в течение 20 минут с меченным PE антителом против PDGFRα мыши (e-Bioscience), меченным PE антителом против PDGFRβ мыши (e-Bioscience), меченным FITC антителом против CD45 мыши (BD biosciences) и меченным PerCy5 антителом против CD44 мыши (BD biosciences), каждое из которых разбавлено в 100 раз посредством PBS. Затем клетки центрифугировали при 440×g при 25°C в течение пяти минут. Супернатанты удаляли. К клеткам добавляли 400 мкл PBS, содержащего 1% параформальдегид, для подготовки образцов для анализа проточной цитометрией. Антитела использовали в следующих комбинациях:

(I) PDGFRα/CD45/CD44

(II) PDGFβ/CD45/CD44

Исходя из результата анализа определяли отношение клеток, экспрессирующих PDGFRα (или β) и CD44, к клеткам, которые были слабо положительными или отрицательными по CD45 (фиг.24A и B).

Результаты: образцы кожи, вырезанные у мышей в возрасте двух суток и шести недель, оценивали в отношении активности привлечения мезенхимальных стволовых клеток костного мозга. Было показано, что активность экстракта кожи от мышей в возрасте двух суток была более высокой, чем активность экстракта кожи от мыши в возрасте шести недель. Сильная экспрессия S100A9 в коже от мышей в возрасте двух суток была выявлена посредством анализа ДНК на микрочипах. Неочищенные образцы экстрактов кожи, очищенные на колонке с гепарином, проявляли корреляцию между активностью миграции мезенхимальных стволовых клеток и содержанием S100A9 и S100A8. Экспрессирующие векторы для этих белков конструировали, и рекомбинантные белки продуцировали с использованием HEK293 и очищали. Активность в отношении миграции мезенхимальных стволовых клеток костного мозга подтверждали в очищенных образцах S100A8 и S100A9 посредством анализов с использованием камеры Бойдена. Более того, при внутривенном введении мышам белки также проявляли активность привлечения популяции двойных положительных по PDGFRα и CD44 клеток в периферическую кровь (фиг.24).

Обсуждение: авторы настоящего изобретения впервые в мире открыли в настоящем изобретении, что свободные фрагменты кожи продуцируют S100A8 и S100A9, и продуцированные белки S100A8 и S100A9 имели выраженную активность привлечения происходящих из костного мозга мезенхимальных стволовых клеток. Тем временем, мезенхимальные стволовые клетки костного мозга известны в качестве плюрипотентных стволовых клеток, которые дифференцируются в костные ткани, жировые ткани, хрящевые ткани, фибробласты и т.п. Недавно было показано, что происходящие из костного мозга клетки также включают плюрипотентные стволовые клетки, которые дифференцируются в ткани, такие как сердечная мышца, нервные клетки и эпидермальные клетки. Поскольку настоящее изобретение демонстрирует, что эпидермальные клетки, клетки волосяных фолликулов, фибробласты подкожных тканей и т.п. в пересаженной коже формируются из происходящих из костного мозга клеток, можно предположить, что S100A8 и S100A9 ответственны за привлечение происходящих из ткани костного мозга стволовых клеток к трансплантату кожи для индукции функциональной репарации поврежденных тканей. Даже при внутривенной инъекции, S100A8 и S100A9 могут вовлекать мезенхимальные стволовые клетки костного мозга в периферическую кровь. Таким образом, S100A8 и S100A9 также можно вводить через периферический кровоток в ткани, расположенные глубоко в организме, где местное введение является трудным (головной мозг, сердце, спинной мозг и т.д.). Авторы настоящего изобретения полагают, что эффекты, такие как укорочение времени заживления, функциональная регенерация поврежденных тканей и т.п. можно ожидать в процессе заживления не только поврежденных тканей кожи, но также различных других поврежденных тканей, таких как головной мозг, мышца и кость, при использовании настоящего изобретения в фармацевтических средствах, которые обеспечивают местное привлечение происходящих из ткани костного мозга стволовых клеток, включающих мезенхимальные стволовые клетки, для регенерации поврежденных тканей.

Справочный пример 6

Задача: оценка терапевтического эффекта S100A8 на кожную язву у нормальных и диабетических мышей.

Способы: рекомбинантный белок S100A8 вводили модельным мышам с кожной язвой для оценки его терапевтического эффекта на язву. Использованные тестируемые мыши представляли собой мышей C57/B16, которым трансплантировали клетки костного мозга, экспрессирующие GFP, и BKS.Cg-m+/+Leprdb/J (мыши db), которые представляют собой модельных мышей с диабетом. На коже мышей формировали кожные язвы диаметром 6 мм. После формирования у мышей кожной язвы, окружающая кожа вблизи дефекта кожи быстро сужается. В этом эксперименте для создания терапевтической модели дефекта кожи, в которой дефект кожи лечат не посредством сужения, а посредством покрытия его регенерировавшей кожей, кремнекаучуковый диск с внешним диаметром 10 мм, внутренним диаметром 6 мм и толщиной 0,5 мм фиксировали в области дефекта кожи, окружавшей язву, с использованием адгезивного средства для хирургии кожи (Aron alpha A) и нейлонового шва, для подготовки модели для лечения дефекта кожи путем покрытия его регенерировавшей кожей, не посредством сужения кожи. Затем рекомбинантный белок S100A8 непосредственно вводили на поверхность язвы в количестве 1,5 мкг/сутки каждые сутки в течение семи суток. Более того, поверхность язвы защищали пленочной повязкой Tegaderm (3M) для предотвращения обезвоживания поверхности язвы. Для оценки терапевтического эффекта измеряли площадь поверхности язвы с течением времени.

Результаты и обсуждение: у нормальных мышей, площадь поверхности язвы значительно снижалась в группе введения S100A8 через семь суток после начала лечения по сравнению с контрольной группой (фиг.25). Более того, у мышей с диабетом поверхность язвы также была существенно снижена в группе введения S100A8 через семь суток после начала лечения по сравнению с контрольной группой (фиг.26). Иными словами, значительный эффект уменьшения кожной язвы наблюдали как у нормальных, так и у диабетических мышей. Этот результат подтверждает, что S100A8 имеет терапевтический эффект на кожную язву не только у нормальных, но также у диабетических мышей.

Справочный пример 7

Задача: вовлечение стволовых клеток ткани костного мозга в периферическую кровь с использованием факторов индукции происходящих из ткани костного мозга стволовых клеток в экстракте ткани кожи.

Способы: для достижения указанной выше задачи проводили исследование способом, описанным ниже.

(1) Получение индуктора происходящих из ткани костного мозга стволовых клеток. Свободные фрагменты кожи, полученные от 25 новорожденных мышей (в возрасте двух суток) погружали в 25 мл фосфатно-солевого буфера (PBS), pH 7,4. После инкубации в течение 24 часов при 4°C образец центрифугировали при 440 G при 4°C в течение десяти минут для удаления ткани. Супернатант собирали в качестве экстракта кожи (SE).

Тем временем из кожи новорожденных мышей C57/Bl6 экстрагировали РНК с использованием Trizol (Invitrogen), а затем синтезировали кДНК с использованием набора SuperScript III cDNA Synthesis Kit (Invitrogen). С использованием этой кДНК в качестве матрицы проводили полимеразную цепную реакцию (ПЦР) для амплификации кДНК HMGB1. кДНК HMGB1 встраивали в плазмидный вектор для экспрессии белков клеток млекопитающих, pCAGGS, для экспрессии белка, в котором с N-концом аминокислотной последовательности связана последовательность Flag-метки (Asp-Tyr-Lys-Asp-Asp-Asp-Lys, SEQ ID NO: 30) (фиг.32). Плазмидный вектор трансфицировали в HEK293 (культивированная клеточная линия, происходящая из клеток почки эмбриона человека). Клетки культивировали в течение 48 часов для экспрессии белка. Каждый образец клеток, экспрессирующих белок HMGB1, и культуральный супернатант инкубировали при 4°C в течение 16 часов, а затем центрифугировали при 4400×g в течение пяти минут. Супернатант собирали и к нему добавляли гель с антителом против Flag (Sigma) в количестве 100 мкл на 50 мл супернатанта. Смесь инкубировали при 4°C в течение 16 часов. Гель собирали центрифугированием, а затем пять раз промывали PBS. Затем гель элюировали 3× пептидом Flag (конечная концентрация 100 мкг/мл). Концентрацию элюированного белка определяли с использованием набора HMGB1 ELISA Kit (Shino-Test Co.). После лиофилизации концентрацию белка доводили до 200 мкг/мл с помощью PBS.

(2) Мышам в возрасте восьми недель (C57/Bl6) вводили 500 мкл описанного выше экстракта кожи (SE), или 500 мкл PBS в качестве группы отрицательного контроля, через хвостовую вену с использованием шприцов, к которым присоединена игла для инъекций 30G 1/2 (фиг.33). Через шесть, 12, 24 и 48 часов после введения из сердца мышей отбирали 1 мл периферической крови под ингаляционной анестезией с помощью изофлурана с использованием покрытого гепарином 1-мл шприца. Каждый из образцов крови смешивали с 3 мл PBS, а затем осторожно наслаивали на 3 мл Ficoll (GE healthcare). Полученные образцы центрифугировали с использованием центрифуги при 400×g при 25°C в течение 40 минут. Клетки мутного среднего слоя собирали в качестве фракции мононуклеарных клеток. К собранным клеткам добавляли 1 мл раствора HLB (Immuno-Biological Laboratories Co., Ltd.), гемолитического средства. Клетки инкубировали при комнатной температуре в течение пяти минут. Эту гемолитическую обработку повторяли дважды. После добавления 10 мл PBS клетки центрифугировали при 440×g при 25°C в течение пяти минут. Супернатанты удаляли и клетки собирали. 1000000 клеток инкубировали при комнатной температуре в течение 20 минут с антителами, каждое из которых разбавлено 100-кратно PBS, включающим меченное PE антитело против PDGFRα мыши (e-Bioscience), меченное PE антитело против PDGFRβ мыши (e-Bioscience) и меченное PerCy5 антитело против CD44 мыши (BD biosciences). После инкубации клетки центрифугировали при 440×g при 25°C в течение пяти минут. Супернатант удаляли. К клеткам добавляли 400 мкл PBS, содержащего 1% параформальдегид, для подготовки образцов для анализа проточной цитометрией.

Мышам в возрасте восьми недель (C57/Bl6) вводили 250 мкл HMGB1 мыши (1 мкг/мкл), или 250 мкл PBS в качестве группы отрицательного контроля, через хвостовую вену с использованием шприцов, к которым присоединена игла для инъекций 30G 1/2 (фиг.35). Через 12 часов после введения отбирали 1 мл периферической крови из сердца мышей под ингаляционной анестезией с помощью изофлурана с использованием покрытого гепарином 1-мл шприца. Каждый из образцов крови смешивали с 3 мл PBS, а затем осторожно наслаивали на 3 мл Ficoll (GE healthcare). Полученные образцы центрифугировали с использованием центрифуги при 400×g при 25°C в течение 40 минут. Клетки мутного среднего слоя собирали в качестве фракции мононуклеарных клеток. К собранным клеткам добавляли 1 мл раствора HLB (Immuno-Biological Laboratories Co., Ltd.), гемолитического средства. Клетки инкубировали при комнатной температуре в течение пяти минут. Эту гемолитическую обработку повторяли дважды. После добавления 10 мл PBS клетки центрифугировали при 440×g при 25°C в течение пяти минут. Супернатанты удаляли и клетки собирали. 1000000 клеток инкубировали при комнатной температуре в течение 20 минут с антителами, каждое из которых 100-кратно разбавлено PBS, включающим меченное PE антитело против PDGFRα мыши (e-Bioscience) и меченное PerCy5 антитело против CD44 мыши (BD biosciences). После инкубации клетки центрифугировали при 440×g при 25°C в течение пяти минут. Супернатант удаляли. К клеткам добавляли 400 мкл PBS, содержащего 1% параформальдегид, для подготовки образцов для анализа проточной цитометрией.

Результаты: было показано, что двойные положительные по PDGFRα и CD44 клетки в значительной степени вовлекаются в периферическую кровь через 12 часов после инъекции экстракта кожи (SE) (фиг.34). Более того, было показано, что двойные положительные по PDGFRα и CD44 клетки в значительной степени вовлекаются в периферическую кровь через 12 часов после инъекции HMGB1 (фиг.36).

Справочный пример 8

Задача: тестирование того, вовлекаются ли мезенхимальные стволовые клетки в периферическую кровь посредством внутривенного введения рекомбинантного белка HMGB1.

Способы: мышам C57BL6 (возраст от восьми до десяти недель, самцы) вводили 400 мкл физиологического раствора, содержащего 100 мкг/мл рекомбинантного белка HMGB1 (40 мкг HMGB1) или 400 мкл физиологического раствора отдельно через хвостовую вену. Через 12 часов у мышей проводили взятие периферической крови. Образцы крови разбавляли PBS до общего объема 4 мл. Разбавленные образцы крови наслаивали на 3 мл Ficoll-Paque Plus (GE), помещенного в центрифужные пробирки. Образцы центрифугировали при 100 G при 18°C в течение десяти минут. Средний слой, содержавший мононуклеарные клетки, переносили в свежую центрифужную пробирку и в нее добавляли 45 мл PBS. Пробирку центрифугировали при 440 G при 18°C в течение пяти минут. Супернатант удаляли. Снова добавляли 45 мл PBS и пробирку центрифугировали при 440 G при 18°C в течение пяти минут. Супернатант удаляли. Полученные мононуклеарные клетки инкубировали с меченным фикоэритробилином (PE) антителом против PDGFRα мыши и меченным аллофикоцианином (APC) антителом против CD44 мыши. Затем оценивали увеличение содержания двойных положительных по PDGFRα и CD44 клеток во фракции мононуклеарных клеток с помощью проточной цитометрии (Facscan; Becton, Dickinson and Company).

Результаты: было показано, что количество двойных положительных по PDGFRα и CD44 клеток, и PDGFRα-положительных, CD44-отрицательных клеток во фракции мононуклеарных клеток периферической крови значительно возрастало через 12 часов после введения HMGB1 (фиг.37). Конкретно, было продемонстрировано, что HMGB1 обладает активностью вовлечения PDGFRα-положительных клеток в периферическую кровь из костного мозга. PDGFRα известен в качестве маркера мезенхимальных стволовых клеток.

Обсуждение: PDGFRα и CD44 известны в качестве поверхностных маркеров мезенхимальных стволовых клеток костного мозга, которые являются иллюстративными для происходящих из костного мозга плюрипотентных стволовых клеток. Мезенхимальные стволовые клетки костного мозга представляют собой плюрипотентные стволовые клетки, способные дифференцироваться в нервные клетки, эпителиальные клетки или сходные с ними, а также в остеоциты, хондроциты и адипоциты. Тем временем, фрагменты кожи, использованные в этом эксперименте, находятся в ишемизированном состоянии. Таким образом, происходит постепенный некроз тканей и внутриклеточные белки, такие как ядерные белки, а также белки клеточной поверхности, высвобождаются наружу. HMGB1 представляет собой белок, содержащийся в экстракте кожи. При трансплантации кожи или сходных с ней, такие белки служат в качестве сигнала для привлечения происходящих из ткани костного мозга стволовых клеток в пересаженную кожу. Таким образом, предполагается, что функциональная регенерация кожи в трансплантате кожи достигается восстановлением эпидермиса, гиподермы, фолликулярных тканей или сходных с ними, обусловленным клетками костного мозга. Исходя из этого эксперимента, в настоящем изобретении было успешно открыто, что происходящие из ткани костного мозга стволовые клетки вовлекаются в периферический кровоток внутривенным введением HMGB1 или экстракта кожи, как описано выше. Это открытие обеспечивает новые терапевтические способы для лечения трудноизлечимых заболеваний с повреждениями тканей, таких как инфаркт головного мозга, инфаркт миокарда, перелом кости и кожная язва, которые основаны на вовлечении происходящих из костного мозга плюрипотентных стволовых клеток в периферическую кровь. Кроме того, клетки, вовлеченные в периферическую кровь, можно собирать общепринятым способом сбора крови. Таким образом, настоящее изобретение обеспечивает более простые и более безопасные способы сбора происходящих из ткани костного мозга стволовых клеток по сравнению с общепринятым способом лечения инфаркта головного мозга, в случае которого клетки собирают из костного мозга.

Промышленная применимость

Настоящее изобретение обеспечивает сбор биологически функциональных клеток минимально инвазивным способом, который был ранее трудным. Можно ожидать, что это продвинет фундаментальные исследования с использованием биологически функциональных клеток, а также регенерационную медицину, с использованием собранных клеток. Таким образом, ожидается, что настоящее изобретение является новым способом, который обеспечит пациентам, страдающим трудноизлечимыми заболеваниями, новый тип лекарственного средства. Более того, емкости, имплантируемые в организм, выступают в качестве источника для развития новых медицинских материалов, и, таким образом, ожидается, что они внесут вклад в развитие промышленности в данной области.

1. Способ сбора популяции клеток, содержащей клетки костного мозга, из имплантируемой медицинской емкости, извлеченной из-под кожи организма, указанный способ включает стадию имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель, где популяция клеток мобилизована в емкость с помощью любого из материалов (а)-(f), описанных ниже, или смеси любых двух или более из материалов (а)-(f), описанных ниже:
(a) белок HMGB1;
(b) белок HMGB2;
(c) белок HMGB3;
(d) белок S100A8;
(e) белок S100A9 и
(f) гиалуроновая кислота.

2. Способ сбора клеток костного мозга, который включает стадию имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель и выделения клеток костного мозга из популяции клеток, собранной из емкости, имплантированной под кожу, где популяция клеток мобилизована в емкость с помощью любого из материалов (а)-(f), описанных ниже, или смеси любых двух или более из материалов (а)-(f), описанных ниже:
(a) белок HMGB1;
(b) белок HMGB2;
(c) белок HMGB3;
(d) белок S100A8;
(e) белок S100A9 и
(f) гиалуроновая кислота.

3. Способ по п. 2, который включает стадию сбора популяции клеток из имплантируемой медицинской емкости, извлеченной из организма, перед стадией выделения клеток костного мозга из популяции клеток.

4. Способ сбора популяции клеток, содержащей клетки костного мозга, который включает стадии:
(I) имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель и
(II) сбора популяции клеток из емкости,
где способ включает стадию введения любого из (а)-(f) или смеси любых двух или более из (а)-(f) в кровеносный сосуд или мышцу после стадии (I):
(a) белок HMGB1;
(b) белок HMGB2;
(c) белок HMGB3;
(d) белок S100A8;
(e) белок S100A9 и
(f) гиалуроновая кислота.

5. Способ сбора популяции клеток, содержащей клетки костного мозга, который включает стадии:
(I) имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель и
(II) сбора популяции клеток из емкости, где емкость содержит любой или смесь любых двух или более следующих материалов:
(а) белок HMGB1;
(b) белок HMGB2;
(c) белок HMGB3;
(d) белок S100A8;
(e) белок S100A9 и
(f) гиалуроновая кислота.

6. Способ сбора клеток костного мозга, который включает стадии:
(I) имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель;
(II) сбора популяции клеток из емкости и
(III) выделения клеток костного мозга из собранной популяции клеток,
где способ включает стадию введения любого из (a)-(f) или смеси любых двух или более из (а)-(f) в кровеносный сосуд или мышцу после стадии (I):
(a) белок HMGB1;
(b) белок HMGB2;
(c) белок HMGB3;
(d) белок S100A8;
(e) белок S100A9 и
(f) гиалуроновая кислота.

7. Способ сбора клеток костного мозга, который включает стадии:
(I) имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель;
(II) сбора популяции клеток из емкости и
(III) выделения клеток костного мозга из собранной популяции клеток,
где емкость содержит любой или смесь любых двух или более следующих материалов:
(a) белок HMGB1;
(b) белок HMGB2;
(c) белок HMGB3;
(d) белок S100A8;
(e) белок S100A9 и
(f) гиалуроновая кислота.



 

Похожие патенты:

Изобретение относится к биотехнологии, регенеративной медицине и может быть использовано в цитологии, гистологии, трансплантологии, микробиологии, биомедицинских исследованиях.

Изобретение относится к биотехнологии, а именно к выделенному пептиду, который имеет индуцибельность цитотоксических Т-лимфоцитов (CTL), а также к его применению. Предложенный пептид может использоваться в противораковой иммунотерапии, более конкретно, в противораковых вакцинах.

Изобретение относится к области молекулярной биологии. Предложено применение терапевтически эффективного количества плацентарных стволовых клеток в получении фармацевтической композиции для использования в лечении индивидуума, имеющего заболевание, расстройство или патологическое состояние легких, причем терапевтически эффективное количество представляет собой количество, достаточное для того, чтобы вызвать детектируемое улучшение одного или нескольких симптомов указанного заболевания, расстройства или патологического состояния; где указанное заболевание, расстройство или патологическое состояние легкого представляет собой легочный саркоидоз, астму, бронхит или острый респираторный дистресс-синдром, и при этом плацентарные стволовые клетки являются CD10+, CD34-, CD105+ и CD200+, что определяется с помощью проточной цитометрии.

Изобретение относится к медицине. Для получения культуры клеток ретинального пигментного эпителия (РПЭ) взрослого донора-трупа производят удаление из глазного яблока донора-трупа роговично-склерального диска.

Изобретение относится к области молекулярной биологии. Предложен способ получения постоянной линии клеток-амниоцитов человека, включающий трансфекцию зародышевых клеток-амниоцитов человека молекулой нуклеиновой кислоты, содержащей последовательность нуклеиновой кислоты, кодирующую продукты генов аденовирусов Е1А и Е1В, причем указанную последовательность нуклеиновой кислоты получают из серотипа 5 аденовируса человека, и последующую трансфекцию постоянной линии клеток-амниоцитов человека, полученной на первом этапе, молекулой нуклеиновой кислоты, содержащей последовательность нуклеиновой кислоты, кодирующую большой SV40 Т-антиген.

Изобретение относится к биотехнологии и трансплантологии (клеточной терапии). Описан способ получения пациент (донор)-специфических фибробластоподобных клеток из индуцированных плюрипотентных стволовых клеток человека.

Изобретение относится к области биотехнологии. Описан способ предифференцировки стромальных стволовых клеток костного мозга.

Группа изобретений относится к области биотехнологии. Способ выделения ганглиозида GM1 предусматривает получение тканей не бычьего и не свиного происхождения, содержащих клетки, продуцирующие GM1; выделение из указанных тканей клеток, продуцирующих ганглиозид GM1; экспансию указанных клеток, продуцирующих GM1, в культуре при подходящих условиях, способствующих экспансии указанных клеток; экспрессию ганглиозида GM1 в культуре при подходящих условиях; выделение указанного ганглиозида GM1 из указанной культуры, который может быть использован для лечения болезни Паркинсона и других неврологических заболеваний.

Изобретение относится к медицине и биотехнологии, в том числе к медицинской и косметической трансплантологии, и представляет собой микротрансплантат (MKT), состоящий из клеток человека, прикрепившихся на поверхности микроносителя, состоящего из полигликолидных волокон, или их группы, диаметром до 20 мкм и длиной от 100 до 1000 мкм.
Группа изобретений относится к области биотехнологии и предназначена для получения биологического референтного материала для производства стандартных образцов состава мочи, содержащих ртуть, кадмий, свинец.

Изобретение относится к биотехнологии. Предложены: клещевой аллерген домашней пыли, представляющий собой полипептид, содержащий определенную аминокислотную последовательность, приведенную в описании в перечне списка последовательностей; кодирующая полипептид молекула ДНК; экспрессирующий вектор на её основе и трансформированная им рекомбинантная клетка для экспрессии полипептида.

Изобретение относится к области биохимии, в частности к способу получения мутеинов липокалина 2 (Lcn2, hNGAL) человека. Способ основан на мутагенезе молекулы нуклеиновой кислоты, кодирующей белок Lcn2 человека.

Группа изобретений относится к медицине, а именно к гематологии и может быть использована при лечении расстройств, ассоциированных с кровотечением. Способ по изобретению включает введение субъекту химерного полипептида фактора VIIa, где указанный химерный полипептид фактора VIIa включает домен EGF-2 и каталитический домен фактора VII; домен GLA, выбранный из группы, состоящей из домена GLA фактора VII, домена GLA фактора IX и домена GLA белка S; и домен EGF-1, выбранный из группы, состоящей из домена EGF-1 фактора IX и домена EGF-1 белка S.

Настоящее изобретение относится к области иммунологии. Предложен выделенный пептид, представляющий собой фрагмент белка CDC45L и обладающий способностью индуцировать цитотоксические Т-лимфоциты в форме комплекса с молекулой HLA-A*2402 или HLA-A*0201.

Изобретение относится к области биотехнологии, конкретно к интернализации терапевтических молекул внутрь клетки, и может быть использовано в медицине. Получают композицию для доставки молекул нуклеиновых кислот в клетки, содержащую по меньшей мере один пептид с по меньшей мере 92% идентичностью к GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); или YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), присоединенный к одной или нескольким молекулам нуклеиновых кислот.

Группа изобретений относится к способам для лечения или предупреждения заболеваний, вызванных неоваскуляризацией хориоидеи человека (неоваскулярной макулопатией), а также к фармацевтическим композициям, содержащим в качестве активного ингредиента по меньшей мере один пептид из пептидов, содержащих аминокислотную последовательность, полученную из белка VEGF-рецептора 1, и обладающих активностью индуцировать цитотоксические Т-клетки в присутствии антиген-представляющих клеток и по меньшей мере один пептид из пептидов, содержащих аминокислотную последовательность, полученную из белка VEGF-рецептора 2 и обладающих активностью индуцировать цитотоксические Т-клетки в присутствии антиген-представляющих клеток или кодирующие их полинуклеотиды, где клетки сосудистого эндотелия, вовлеченные в неоваскуляризацию хориоидеи у человека, экспрессируют VEGFR-1 рецепторный белок на поверхности клеток.

Изобретение относится к области биотехнологии. Представлен полипептид D-лактатдегидрогеназы, который содержит полипептид с аминокислотной последовательностью, которая характеризуется идентичностью по последовательности на уровне не менее 80% с аминокислотной последовательностью, показанной в SEQ ID NO:1 или 2, раскрытые в описании, где указанный полипептид обладает D-лактатдегидрогеназной активностью.

Изобретение относится к области биотехнологии, а именно к способу разделения лактоферринов человека и козы. Способ включает иммуноафинную хроматографию с использованием мини-антител a-hLF-1 и a-hLF-4, аминокислотные последовательности которых представлены как SEQ ID NO:1 и SEQ ID NO:2.

Изобретение относится к новым молекулам-ингибиторам JNK, способам получения антител к указанным молекулам-ингибиторам JNK, а также к соответствующим антителам и клеткам, продуцирующим указанные антитела.
Наверх