Применение антитела против амилоида-бета при глазных заболеваниях



Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях
Применение антитела против амилоида-бета при глазных заболеваниях

 


Владельцы патента RU 2571859:

ДЖЕНЕНТЕК, ИНК. (US)
АЦ ИММУНЕ С.А. (CH)

Изобретение относится к биохимии. Описаны способы диагностики глазного заболевания, диагностики или определения предрасположенности к глазному заболеванию, мониторинга минимального остаточного глазного заболевания. Способы включают использование высокоспецифических и высокоэффективных антител, которые специфически распознают и связывают специфические эпитопы из диапазона β-амилоидных белков. Изобретение может быть использовано для глазных заболеваний, ассоциированных с патологическими нарушениями/изменениями тканей зрительной системы, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы. 3 н. и 41 з.п. ф-лы, 20 ил., 7 табл., 18 пр.

 

Перекрестные сведения на родственные заявки

По настоящей заявке испрашивается приоритет на основе предварительной заявки на патент США US 60/960617, поданной 5 октября 2007 г., которая включена в настоящее изобретение в виде ссылки.

Предпосылки создания изобретения

Настоящее изобретение относится к способам и композициям для диагностики и лечения амилоидозов - группы заболеваний и нарушений, связанных с амилоидным белком, например болезни Альцгеймера.

Амилоидоз означает не единственное заболевание, а разнородную группу прогрессирующих заболеваний, отличающихся внеклеточными тканевыми отложениями восковидного крахмалоподобного белка, называемого амилоидом, который накапливается в одном или нескольких органах или системах организма. По мере накопления отложений амилоида, они начинают мешать нормальному функционированию органа или системы организма. Имеется по меньшей мере 15 разных типов амилоидоза. Основными формами являются первичный амилоидоз без известных предшествующих проявлений заболевания, вторичный амилоидоз, проявляющийся после некоторого другого болезненного состояния, и наследственный амилоидоз.

Вторичный амилоидоз отмечают у людей с хронической инфекцией или воспалительным заболеванием, например, туберкулезом, бактериальной инфекцией, называемой семейной средиземноморской лихорадкой, костными инфекциями (остеомиелитами), ревматоидным артритом, воспалением тонкой кишки (грануломатозным илеитом), болезнью Ходжкина и лепрой.

Амилоидные отложения включают компонент амилоида Р (пентагональный, pentagonal-АР), гликопротеин, близкий к нормальному сывороточному амилоиду Р (serum amyloid Р - SAP), и сульфатированные гликозаминогликаны (glycosaminoglycans - GAG), сложные углеводы соединительной ткани. Амилоидные белковые фибриллы, которые составляют примерно до 90% амилоидного материала, представляют один из нескольких различных типов белков. Эти белки способны складываться в так называемые «бета-складчатые» плоские фибриллы - уникальную белковую конфигурацию, которая имеет сайты связывания для красителя Конго красного, и в результате возникает уникальное для амилоидного белка свойство - окрашивание.

Многие возрастные заболевания основаны или связаны с белками амилоидного типа и в частности характеризуются накоплением внеклеточных отложений амилоида или амилоидо-подобного материала, который участвует в патогенезе, а также в прогрессировании заболевания. К таким заболеваниям относятся, но ими не ограничиваются, неврологические заболевания, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви (Lewy body dementia - LBD), синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам. К другим заболеваниям, которые связаны с белками амилоидного типа, относятся прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированные со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящем к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Хотя патогенез этих заболеваний может быть различным, свойственные для них отложения часто содержат много общих молекулярных составляющих. В значительной степени они могут быть следствием местного активирования провоспалительных метаболических путей, связанных с одновременным отложением активированных компонентов комплемента, веществами острой фазы, иммунными модуляторами и другими медиаторами воспаления (McGeer и др., 1994).

Болезнь Альцгеймера (БА) является нейрологическим расстройством, предположительно вызываемым амилоидными бляшками, накоплением нарушенного отложения белков в мозге. Наиболее часто тип амилоида, обнаруженного в мозге больных, преимущественно состоит из фибрилл Aβ. Научное подтверждение заключается в том, что повышение выработки и накопления бета-амилоидного белка в бляшках приводит к отмиранию нервных клеток, которое влияет на развитие и прогрессирование БА. Утрата нервных клеток в стратегически важных участках мозга в свою очередь вызывает снижение содержания нейротрансмитеров и ухудшает память. К белкам, играющим основную роль в формировании бляшек, относятся амилоидный белок-предшественник (amyloid precursor protein - APP) и два презенилина (презенилин I и презенилин II). Последующее расщепление амилоидного белка-предшественника (APP), который экспрессируется конститутивно и подвергается катаболизму в большинстве клеток, ферментами β и γ секретазами приводит к высвобождению пептида Аβ, включающего от 39 до 43 аминокислот. Разрушение белков APP вероятно повышает их предрасположенность агрегировать в бляшки. Особенно это относится к фрагменту Аβ(1-42), который имеет высокую предрасположенность к связыванию агрегатов из-за двух в высокой степени гидрофобных аминокислотных остатков по С-концу. Поэтому предполагают, что фрагмент Аβ(1-42) преимущественно вовлечен и ответственен за инициацию формирования старческих бляшек у больных БА, и соответственно обладает высоким патологическим потенциалом. Таким образом, существует потребность в агентах для предупреждения формирования амилоидных бляшек и растворения имеющихся бляшек у больных БА.

Симптомы болезни Альцгеймера проявляются медленно и первым симптомом может быть небольшая забывчатость. На этой стадии индивидуумы могут забывать недавние события, поступки, имена знакомых людей или названия предметов и могут быть не в состоянии решить простые математические задачи. По мере прогрессирования заболевания симптомы становятся более заметными и достаточно серьезными, чтобы больные БА или их родственники стали обращаться за медицинской помощью. На средней стадии БА к симптомам относятся утрата способности выполнять простые задачи, например, поддержание личной гигиены, и проблемы, связанные с речью, пониманием, чтением или письмом. Пациенты на последующей стадии БА могут пребывать в состоянии обеспокоенности или агрессии, могут уйти из дома, а также могут полностью нуждаться в уходе.

В настоящее время единственным точным способом диагностики БА является идентификация бляшек и сплетений в ткани мозга при аутопсии после смерти индивидуума. Следовательно, врачи могут диагностировать БА только «приблизительно» или «примерно» при жизни пациента. С помощью современных методов врачи могут с точностью диагностировать БА до 90% случает, используя некоторые средства для диагностики «возможной» БА. Врачи проводят опрос об общем состоянии здоровья пациента, перенесенных заболеваниях, а также о появлении каких-либо осложнений в быту. Поведенческое тестирование памяти, решения задач, внимания, счета и речи дают информацию о когнитивном вырождении, а медицинские анализы, например, крови, мочи, спинномозговой жидкости и сканирование мозга, могут предоставить некоторую дополнительную информацию.

Поддержание состояния пациентов с БА заключается в медицинском и немедицинском уходе. Способы лечения, направленные на изменение течения болезни (откладывая или ревертируя ее прогрессирование), до настоящего времени почти совсем неэффективны. Было показано, что лекарственные средства, которые восстанавливают недостаточность (дефицит) или нарушенное действие химических посредников нервных клеток (нейротрансмиттеров), в частности ингибиторов холинэстеразы (cholinesterase inhibitor - ChEI), например, такрин и ривастигмин, проявляют улучшение симптомов. Ингибиторы ChEI препятствуют ферментативному разрушению нейротрансмитеров, тем самым, повышая содержание химических посредников, способных передавать нервный сигнал в мозг.

У некоторых людей на ранних и средних стадиях заболевания лекарственные средства такрин (продукт COGNEX®, Morris Plains, NJ), донепезил (продукт ARICEPT®, Токио, Япония), ривастигмин (продукт EXELON®, Восточный Гоновер, Нью-Джерси) или галантамин (продукт REMINYL®, Нью-Брунсвик, Нью-Джерси) могут помочь предупредить наихудшее проявление некоторых симптомов в течение ограниченного периода времени. Другое лекарственное средство, мемантин (продукт NAMENDA®, Нью-Йорк, Нью-Йорк), было одобрено для лечения БА, проявляющейся в формах от умеренных до тяжелых. Медикаментозные средства также применимы для лечения психиатрических проявлений БА. Кроме того, некоторые медикаментозные средства могут способствовать контролю поведенческих симптомов при БА, например, бессонницы, беспокойства, блуждания, состояния тревоги и депрессии. Лечение этих симптомов часто облегчает существование больных, делая его более комфортабельным, и облегчает уход за ними для персонала. К сожалению, несмотря на существенные преимущества лечения, показавшего, что агенты этого класса стабильно лучше плацебо, болезнь продолжает прогрессировать и обычное воздействие на ментальное функционирование проявляется умеренно. Многие лекарственные средства, используемые для лечения БА, например, ChEI, также обладают побочными эффектами, к которым относятся желудочно-кишечные расстройства, печеночная токсичность и потеря массы тела.

Кортикальная зрительная недостаточность часто ассоциирована с БА, несмотря на отрицательные данные исследования по ухудшению резкости зрения или глазному заболеванию. Посмертное доказательство на материале от пациентов с БА показало патологические изменения в предкорковых зрительных структурах и уменьшение волокон в зрительном нерве.

Развитие дисфункции зрения у БА также ассоциировано с неврологическими изменениями и патологией в вентральном проводящем пути нервной системы, который тянется от сетчатки с Р-ганглиозными клетками через мелкоклеточные слои латерального коленчатого узла (lateral geniculate nucleus - LGN), достигая нижней височной коры (inferior temporal cortex - IT) и в дорсальном проводящем пути нервной системы, который тянется от сетчатки с М-ганглиозными клетками через крупноклеточные слои LGN, достигая средней височной коры (middle temporal cortex - МТ). Старческие бляшки у пациентов с БА создают нарушения и дисфункции в указанных областях коры мозга. Старческие бляшки также вызывают утрату зрительного восприятия, например, дисфункцию при распознавании лиц знакомых людей, состояния, известного под названием «прозопагнозия (агнозия на лица)».

Другие заболевания, которые основаны или связаны с накоплением и отложением амилоидо-подобного белка, представляют умеренное когнитивное поражение, болезнь диффузных поражений телец Леви (Lewy body dementia - LBD), синдром Дауна (трисомия по 21 хромосоме), амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), миозит с включенными тельцами (МВТ) и глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Умеренное когнитивное расстройство (mild cognitive impairment - MCI) - общее название, которое обычно означает мягкое, но фиксируемое расстройство памяти. У индивидуума с MCI проявляются проблемы с памятью в большей степени, чем они возникают с возрастом, но нет других признаков слабоумия, например, нарушенного мышления или нарушенных умозаключений. MCI - состояние, которое часть отражает предклиническую стадию БА.

Предполагают, что отложение β-амилоида в энторинальной области коры головного мозга играет ключевую роль в развитии умеренного расстройства с когнитивным нарушением (mild cognitive impairment - MCI) у престарелых. Это согласуется с наблюдением, заключающемся в том, что уровни СМЖ-А Аβ(1-42) существенно снижаются, когда клиническое проявление симптомов БА становится очевидным. В отличие от СМЖ-Аβ(1-42), уровни СМЖ-тау существенно повышены на стадии MCI, и позднее эти величины продолжают повышаться, свидетельствую о том, что повышенные уровни СМЖ-тау могут помочь выявить субъектов с MCI, у которых прогнозируют развитие БА.

Болезнь диффузных поражений телец Леви (Lewy body dementia - LBD) является нейродегенеративным расстройством, которое может быть у людей старше 65 лет, при котором обычно проявляются симптомы когнитивного (умственного) ухудшения и нарушенного поведения. К симптомам могут относиться когнитивное ухудшение, нейрологические признаки, расстройство сна и недостаточность вегетативной нервной системы. Когнитивное ухудшение представляет симптом LBD в большинстве случаев. У пациентов повторяются приступы помрачения сознания, которые постепенно ухудшаются. Флуктуация когнитивной способности часто связана с изменением степеней проявления внимания и живости поведения. Когнитивное ухудшение и флюктуации мыслительной способности могут меняться на протяжении минут, часов или суток.

Тельца Леви формируются из фосфорилированных и нефосфорилированных нейрофиламентных белков; они содержат синаптический белок альфа-синуклеин, а также убиквитин, которые участвуют в элиминации поврежденных или аномальных белков. Помимо телец Леви также могут присутствовать нейриты Леви, которые являются тельцами-включениями в клеточные процессы нервных клеток. Амилоидные бляшки могут формироваться в мозге пациентов с LBD, однако проявляется тенденция к уменьшению их числа по сравнению с пациентами с болезнью Альцгеймера. Нейрофибриллярные сплетения и другие микропатологические признаки БА не являются основными симптомами болезни диффузных поражений телец Леви, но они часто присутствуют наряду с амилоидными бляшками.

Синдром Дауна (СД) или трисомия по 21 хромосоме представляет генетическое расстройство, вызванное наличием лишней хромосомы 21-й пары, целой или ее части, и часто связанное с некоторым нарушением когнитивных способностей и физического роста. Для синдрома Дауна свойственно преждевременное старение: у большинства индивидуумов в возрасте 40-50 лет развивается болезнь Альцгеймера, при этом происходит отложение белка амилоида-бета, формирующего бляшки, причем часто в более тяжелой форме, чем у большинства других пациентов с болезнью Альцгеймера. Кроме того, у многих больных с синдромом Дауна развивается катаракта, начинаясь в детском возрасте, причем у многих наблюдают врожденную глаукому. У людей ген предшественника амилоидного белка, расщепляющегося с формированием амилоида-бета, расположен на 21 хромосоме. У индивидуумов с синдромом Дауна накапливается и растворимый, и внутриклеточный бета-амилоид до внеклеточного амилоида-бета, ответственного за формирование старческих бляшек. Повышение уровней бета-амилоида при синдроме Дауна может быть следствием повышенной экспрессии и повышенных уровней фермента 2, расщепляющего предшественник белка бета-амилоида, локализованного на хромосоме 21.

Амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS) характеризуется дегенерацией нижних и верхних моторных нейронов. У некоторых пациентов с ALS может быть слабоумие или потеря речи (афазия) (ALS-D). Слабоумие в большинстве случаев является лобно-височным слабоумием (frontotemporal dementia - FTD), при этом у многих пациентов имеются убиквитин-положительные тау-отрицательные включения в нейронах зубчатой извилины медиальной и нижней поверхности полушария большого мозга и поверхностные слои лобных и височных долей.

Миозит с включенными тельцами (МВТ) (Inclusion-body myositis - IBM) является травматическим заболеванием, обычно выявляемым у людей старше 50 лет, у которых в мышечных волокнах формируется воспаление и начинается атрофия, но у которых сохранен мозг и полностью сохранен интеллект. Установлено, что в большинстве случаев содержание двух ферментов, участвующих в выработке белка амилоида-β, повышено в мышечных клетках пациентов этого наиболее распространенного прогрессирующего мышечного заболевания пожилых людей, у которых содержание амилоида-β также повышено.

Другим заболеванием, основанным или связанным с накоплением и отложением белка типа амилоида, является дегенерация желтого пятна.

Дегенерация желтого пятна представляет распространенное заболевание, при котором происходит повреждение желтого пятна, являющегося центральной областью сетчатки (ткани, толщиной с лист бумаги в задней части глаза, из которой светочувствительные клетки посылают зрительные сигналы в мозг). Острое, четкое, «прямое» зрение перерабатывается желтым пятном. Повреждение желтого пятна приводит к развитию слепых пятен и расплывчатому или искаженному восприятию. Возрастная дегенерация желтого пятна (ВДЖП) представляет основную причину ухудшения зрения в США, а для людей старше 65 лет она представляет основную причину развития практической (гражданской) слепоты среди представителей европеоидной расы. Примерно 1,8 миллионов американцев в возрасте 40 лет и старше, имеющие продвинутую форму ВДЖП, и другие 7,3 миллионов американцев, имеющие промежуточную форму ВДЖП, подвержены значительному риску потери зрения. По оценке правительства к 2020 году у 2,9 миллионов людей будет продвинутая форма ВДЖП. Жертвы ВДЖП часто удивляются и расстраиваются, узнав, что о причинах слепоты и ее лечении известно слишком мало.

Имеется две формы дегенерации желтого пятна: сухая дегенерация желтого пятна и влажная дегенерация желтого пятна. Сухая форма, при которой клетки желтого пятна начинают медленно разрушаться, диагностируют в 85% случаев дегенерации желтого пятна. Оба глаза обычно поражены сухой формой ВДЖП, хотя один глаз может потерять зрение при сохранности второго глаза. Старческие бляшки, которые представляют желтые отложения под сетчаткой, обычно представляют ранние симптомы сухой формы ВДЖП. Риск развития продвинутой сухой формы ВДЖП или влажной формы ВДЖП повышается по мере увеличения числа или размера старческих бляшек. Сухая форма ВДЖП может прогрессировать и вызвать потерю зрения без перехода к влажной форме заболевания, однако также возможен для ранней стадии сухой формы ВДЖП внезапный переход во влажную форму.

Влажная форма, хотя она встречается только в 15% случаев, в 90% приводит к слепоте, и рассматривается в виде продвинутой формы ВДЖП (нет ранней или промежуточной стадии у влажной формы ВДЖП). Влажной форме ВДЖП всегда предшествует сухая форма заболевания. По мере ухудшения сухой формы у некоторых людей начинается патологический рост кровеносных сосудов за желтым пятном. Эти сосуды очень хрупкие, и могут быть кровотечения (отсюда «влажная» дегенерация желтого пятна), вызывающие быстрое разрушение желтого пятна.

Сухая форма ВДЖП может в начальной стадии часто вызывать слегка расплывчатое зрение. Центр изображения в частности затем может стать расплывчатым, и эта область разрастается по мере прогрессирования заболевания. Симптомы могут остаться незамеченными, если поражен только один глаз. При влажной форме ВДЖП прямые линии могут казаться волнистыми, а утрата центрального зрения может происходить быстро.

Диагностика дегенерации желтого пятна обычно включает расширенный анализ глаз, используя метод, называемый фундоскопией, который способствует диагностике ВДЖП, и, если предполагается влажная форма ВДЖП, также могут проводить флуоресцентную ангиографию. Если сухая форма ВДЖП достигает продвинутых стадий, в настоящее время нет лечения для предупреждения потери зрения. Однако специфические высокие дозы формулы антиоксидантов и цинка могут отсрочить или предупредить промежуточную стадию ВДЖП от прогрессирования до продвинутой стадии. Продукт Macugen® (инъекция пегаптаниба натрия), коагуляция лазером и фотодинамическая терапия могут контролировать патологический рост кровеносных сосудов и кровотечение в желтом пятне, что полезно для некоторых людей с влажной формой ВДЖП, однако, такими способами утраченное зрение восстановить нельзя. Если зрение уже утрачено, существует мало средств, которые могут помочь улучшить качество жизни.

Одним из ранних признаков возрастной дегенерации желтого пятна (ВДЖП) является накопление внеклеточных отложений, известных под названием «старческих бляшек», между базальным слоем пигментированного эпителия сетчатки (retinal pigmented epithelium - RPE) и базальной пластинки, также называемой оболочкой Бруха (Bruch's membrane - ВМ). Предшествующие исследования, выполненные Anderson и др., подтвердили, что старческие бляшки содержат амилоид-бета (Experimental Eye Research 78, 2004, cc.243-256).

Современные исследования продолжают исследовать факторы внешней среды, генетические факторы и факторы питания, которые могут содействовать ВДЖП. Также исследуются новые стратегии лечения, включая трансплантаты клеток сетчатки, лекарственные средства, которые могут предупредить или понизить прогрессирование заболевания, радиационную терапию, генную терапию, имплантацию компьютерного чипа в сетчатку, которые могут помочь стимулировать зрение, и агенты, которые могут предупредить рост новых кровеносных сосудов под желтым пятном.

Важным фактором, который рассматривают при разработке новых лекарственных средств, является легкость применения пациентами, для которых они предназначены. Средства доставки пероральных лекарственных средств, особенно таблетки, капсулы и мази, составляют до 70% от всех потребляемых лекарственных форм, поскольку они удобнее для пациентов. Разработчики лекарственных средств полагают, что пациенты предпочитают пероральное введение в большей степени, чем инъекции или другие более инвазивные формы медикаментозного введения. Также предпочтительны составы, с увеличенными интервалами дозирования (т.е. раз в сутки или составы устойчивого высвобождения). Простота введения антибиотиков в пероральной лекарственной форме приводит к повышению соблюдения пациентом режима и схемы лечения. Необходимы эффективные способы и композиции для предупреждения или выявления осложнений, связанных с амилоидозом - группой заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы. В частности необходимы агенты, способные противодействовать физиологическим проявлениям заболевания, например, формированию бляшек, ассоциированных с агрегированием волокон амилоида или амилоидоподобного пептида.

Сообщалось, что антиамилоидные антитела, возникшие в результате инокуляции амилоидом Aβ1-42, смешанным с полным или неполным адъювантом Фройнда, снижают амилоидную нагрузку у трансгенных мышей, связанную с болезнью Альцгеймера человека (Schenk и др., 1999). Внутрибрюшинное введение тетрапальмитоилированного Aβ1-16, помещенного в липосомы, трансгенным мышам NORBA, высвобождает существенные титры антиамилоидных антител, о которых сообщалось, что они растворяют амилоидные волокна и бляшки in vitro и in vivo (Nicolau и др., 2002).

Возможный механизм, с помощью которого происходит растворение амилоидных бляшек и волокон, впервые был предложен Bard и др. (2000), которые заключили, что опсонизированные антителами бляшки были последовательно разрушены макрофагами микроглии. De Mattos и др. (2001) установили, что моноклональное антитело (MAb), направленное против центрального домена β-амилоида, способно связывать и полностью изолировать амилоид плазмы. Они пришли к заключению, что наличие моноклональных антител в кровеносном русле смещает баланс Ар между мозгом и плазмой, способствую периферическому очищению и катаболизму вместо отложения в мозге.

Пролонгированное лечение человека антителами грызунов может привести к антиглобулиновому ответу, который выявляется примерно на 8-12 сутки после введения и достигает пика примерно на 20-30 сутки. Если такой антиглобулиновый ответ возникает, лечение должно быть прервано после не более чем примерно 10 суток, и возобновление лечения на более поздний срок обычно не допускают, поскольку оно может привести к быстрому началу вторичного антиглобулинового ответа. Хотя антитела грызунов разделяют в значительной степени консервативную последовательность с антителами человека, имеется много отличий в последовательностях у антител грызунов и людей, достаточных для того, чтобы антитела грызунов были иммуногенными для людей.

Эта проблема может быть преодолена выработкой антител непосредственно у людей или созданием «гуманизированных» антител (также называемых «переформированными» антителами). Гуманизированные антитела имеют аминокислотную последовательность вариабельной области, которая содержит полученные от грызунов области CDR, вкрапленные в последовательности каркасных участков человека, или последовательности, близкие к ним. Поскольку специфичность гуманизированного антитела обеспечивается полученными от грызунов областями CDR, их остатки используют в существенной степени неизменными, всего лишь с минорными модификациями, являющимися допустимыми, которые существенно не влияют на сродство и специфичность антитела в отношении его целевого антигена. Остатки каркасного участка могут быть получены от примата, или особенно от какой-либо вариабельной области человека, или могут быть их комбинацией, и получаемая сконструированная вариабельная область может быть существенно перегруппирована.

Для максимизации вероятности того, что сродство будет сохранено у заново собранного антитела, важно произвести правильный отбор каркасной области. Известно, что последовательности каркасных участков способствуют поддержанию областей CDR в их точной пространственной ориентации для взаимодействия с антигеном, и что остатки каркасных участков могут иногда даже участвовать в связывании антигена. Для поддержания сродства антитела с его антигеном полезно выбрать последовательности каркасных участков человека, которые наиболее близки последовательностям каркасных участков грызунов. Кроме того, может понадобиться заместить одну или несколько аминокислот в последовательности каркасного участка человека соответствующим остатком в каркасном участке грызуна, чтобы избежать утраты сродства. Такому замещению может способствовать компьютерное моделирование.

Настоящее изобретение предусматривает новые способы и композиции, включающие высоко специфичные и высоко эффективные антитела, особенно химерные антитела, включая их фрагменты, более предпочтительно частично или полностью гуманизированные антитела, включая их фрагменты, способные специфически распознавать и связывать специфические эпитопы разных β-амилоидных антигенов, которые могут быть презентированы антителу в мономерной, двухмерной, трехмерной и т.д. полимерной форме, в форме агрегата, волокон, филаментов или в конденсированной форме бляшки. Антитела по настоящему изобретению особенно применимы для лечения амилоидоза - группы заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие заболевания, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированные со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, приводящие к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; и в роговице, приводящие к решетчатой дистрофии роговицы.

Краткое описание изобретения

По одному из вариантов осуществления настоящее изобретение относится к химерному антителу или его фрагменту, гуманизированному антителу или его фрагменту, которые распознают и связывают по меньшей мере один особый сайт связывания, особенно по меньшей мере два особых сайта связывания, и более предпочтительно по меньшей мере три особых сайта связывания на β-амилоидном белке, причем указанный один, указанные по меньшей мере два, и указанные по меньшей мере три сайта связывания каждый включает по меньшей мере один или два последовательных аминокислотных остатка, которые особенно участвуют в связывании антитела.

В частности химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент по настоящему изобретению связывает по меньшей мере два, особенно по меньшей мере три отличительных сайта связывания на β-амилоидном белке, причем по меньшей мере три отличительных сайта связывания включают по меньшей мере два последовательных аминокислотных остатка, преимущественно участвующих в связывании антитела и по меньшей мере три отличительных сайта связывания включают по меньшей мере один аминокислотный остаток.

По меньшей мере два разных сайта связывания, включающих по меньшей мере два последовательных аминокислотных остатка, преимущественно вовлеченных в связывание антитела, локализованы в тесной близости друг к другу на антигене, разделенные и/или фланкированные по меньшей мере одним аминокислотным остатком, не участвующим в связывании антитела, или на существенно меньшем расстоянии по сравнению с указанными по меньшей мере двумя последовательными аминокислотными остатками, таким образом, формируя конформационный прерывистый эпитоп.

По меньшей мере три разные сайты связывания, включающие по меньшей мере два последовательных аминокислотных остатка и по меньшей мере один аминокислотный остаток, соответственно, которые преимущественно участвуют в связывании антитела, локализованы в тесной близости друг к другу на эпитопе, разделены и/или фланкированы по меньшей мере одним аминокислотным остатком, не участвующим в связывании антитела, или существенно меньшей протяженности по сравнению с аминокислотными остатками, которые преимущественно вовлечены в связывании антитела, таким образом формируя конформационный прерывистый эпитоп.

В частности предусмотрены химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которые распознают и связывают по меньшей мере один отличающийся сайт, особенно по меньшей мере два разных сайта связывания, более предпочтительно по меньшей мере три разных сайта связывания на β-амилоидном белке, причем указанный по меньшей мере один, или указанные по меньшей мере два разных сайта связывания каждый включает по меньшей мере два последовательных аминокислотных остатка, предпочтительно вовлеченных в связывание антитела, причем по меньшей мере двумя последовательными аминокислотными остатками, представляющими первый сайт связывания, являются -Phe-Phe-, погруженные в коровую последовательность (SEQ ID NO:9):

Хаа3-Phe-Phe-Хаа4-Хаа5-Хаа6, в которой

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile,

Xaa4 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, Ser и Ile,

Хаа5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp,

Хаа6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, причем указанные аминокислотные остатки Хаа3 Хаа4, Хаа5 и Хаа6 не участвуют в связывании антитела или в существенно меньшей степени по сравнению с сайтом связывания -Phe-Phe-.

В другом варианте осуществления настоящего изобретения предусмотрены химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, в которых

Хаа3 обозначает Val или Leu, но особенно Val,

Хаа4 обозначает Ala или Val, но особенно Ala,

Хаа5 обозначает Glu или Asp, но особенно Glu,

Хаа6 обозначает Glu или Asp, но особенно Asp.

В частности предусмотрены химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которые распознают и связывают по меньшей мере один отличающийся сайт, особенно по меньшей мере два разных сайта связывания, более предпочтительно по меньшей мере три разных сайта связывания на β-амилоидном белке, причем указанные отличающиеся сайты связывания включают по меньшей мере один и по меньшей мере два последовательных аминокислотных остатка, соответственно, преимущественно участвующих в связывании антитела, причем по меньшей мере двумя последовательно расположенными аминокислотными остатками, представляющими первый сайт связывания, являются -Phe-Phe-, и по меньшей мере одним аминокислотным остатком является -His-, погруженный в следующую коровую последовательность:

-Xaa1-His-Хаа3-Хаа4-Хаа5-Хаа6-Phe-Phe-Хаа7-Xaa8-Xaa9-,

в которой

Xaa1 обозначает аминокислотный остаток, выбранный из группы, состоящей из His, Asn, Gln, Lys и Arg

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln

Хаа4 обозначает аминокислотный остаток, выбранный из группы, состоящей из His, Asn, Gln, Lys и Arg

Хаа5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, Ser и Ile,

Хаа6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile

Хаа7 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu и Ile,

Хаа8 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp,

Xaa9 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, причем аминокислотные остатки Хаа1, Хаа3, Хаа6, Хаа7, Хаа8 и Xaa9, не участвуют в связывании антитела или в меньшей или существенно меньшей степени по сравнению с -His- и -Phe-Phe- сайтом связывания, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрены химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, в которых

Хаа3 обозначает Gln или Asn, но особенно Gln,

Хаа4 обозначает Lys

Хаа5 обозначает Leu

Хаа6 обозначает Val или Leu, но особенно Val,

Хаа7 обозначает Ala или Val, но особенно Ala,

Xaa8 обозначает Glu или Asp, но особенно Glu, и

Хаа9 обозначает Asp или Glu, но особенно Asp.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которое распознает и связывает по меньшей мере один отличительный сайт связывания, особенно по меньшей мере два отличительных сайта связывания, более предпочтительно по меньшей мере три отличительных сайта связывания на β-амилоидном белке, причем указанный по меньшей мере один или указанные по меньшей мере два отличительных сайта связывания каждый включают по меньшей мере два последовательно расположенных аминокислотных остатка, предпочтительно участвующих в связывании антитела, причем по меньшей мере двумя последовательно расположенными аминокислотными остатками, представляющими второй сайт связывания, являются -Lys-Leu-, погруженные в следующую коровую последовательность (SEQ ID NO:10):

Xaa1-Хаа2-Lys-Leu-Хаа3 в которой

Xaa1 обозначает аминокислотный остаток, выбранный из группы, состоящей из His, Asn, Gln, Lys и Arg,

Хаа2 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln,

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile, причем указанные аминокислотные остатки Хаа2, Хаа3, не участвуют в связывании антитела или в меньшей или в существенно меньшей степени по сравнению с сайтом связывания -Lys-Leu-.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которое распознает и связывает по меньшей мере один отличительный сайт связывания, особенно по меньшей мере два отличительных сайта связывания, более предпочтительно по меньшей мере три отличительных сайта связывания на β-амилоидном белке, причем указанные отличные сайты связывания включают по меньшей мере один, по меньшей мере два последовательно расположенных аминокислотных остатка, соответственно, преимущественно участвующие в связывании антитела, причем по меньшей мере одним и по меньшей мере двумя последовательно расположенными аминокислотами, которые разделены по меньшей мере одним аминокислотным остатком, не участвующим в связывании антитела или участвующим в существенно меньшей степени по сравнению с аминокислотными остатками, преимущественно участвующими в связывании антитела, являются -His- и -Lys-Leu-, соответственно, погруженные в следующую коровую последовательность:

His-Хаа2-Lys-Leu-Хаа3-Хаа4-Хаа5-Хаа6--Хаа7-Xaa8, в которой

Хаа2 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln,

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile,

Хаа4 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile,

Хаа5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile,

Хаа6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, Ser и Ile,

Хаа7 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp,

Xaa8 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp,

причем указанные аминокислотные остатки Хаа2, Хаа3, Хаа6, Хаа7, Xaa8 не участвуют в связывании антитела, или участвуют в меньшей или существенно меньшей степени по сравнению с -His- и -Lys-Leu- сайтом связывания, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем

Хаа2 обозначает Gln или Asn, но особенно Gln,

Хаа3 обозначает Val или Leu, но особенно Val,

Хаа4 обозначает Phe,

Хаа5 обозначает Phe,

Хаа6 обозначает Ala или Val, но особенно Ala,

Хаа7 обозначает Glu или Asp, но особенно Glu, и

Xaa8 обозначает Asp или Glu, но особенно Asp.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которое распознает и связывает по меньшей мере два отличительных сайта связывания на β-амилоидном белке, причем указанные по меньшей мере два отличительных сайта связывания каждый включают по меньшей мере два последовательно расположенных аминокислотных остатка, преимущественно участвующих в связывании антитела, причем по меньшей мере две последовательно расположенные аминокислоты разделены, по меньшей мере, одним аминокислотным остатком, не участвующим в связывании антитела, или участвующим в существенно меньшей степени по сравнению с указанными последовательно расположенными аминокислотными остатками, которыми являются -Phe-Phe- и -Lys-Leu-, соответственно, представляющие первый и второй сайт связывания, погруженные в следующую коровую последовательность:

Xaa1-Хаа2-Lys-Leu-Хаа3-Phe-Phe-Хаа4-Хаа5-Хаа6, причем

Xaa1 обозначает аминокислотный остаток, выбранный из группы, состоящей из His, Asn, Gln, Lys и Arg,

Хаа2 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln,

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile,

Хаа4 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, Ser и Ile,

Хаа5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp,

Хаа6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, причем указанные аминокислотные остатки Хаа2, Хаа3, Хаа4, Хаа5, и Xaa6 не участвуют в связывании антитела, или участвуют в меньшей степени или в существенно меньшей степени по сравнению с -Lys-Leu- и -Phe-Phe- сайтом связывания, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которое распознает и связывает по меньшей мере один отличительный сайт связывания, особенно по меньшей мере два отличительных сайта связывания, более предпочтительно по меньшей мере три отличительных сайта связывания на β-амилоидном белке, причем указанные отличные сайты связывания включают по меньшей мере один и по меньшей мере два последовательно расположенных аминокислотных остатка, соответственно, преимущественно участвующих в связывании антитела, причем по меньшей мере одна и по меньшей мере две последовательно расположенные аминокислоты разделены, по меньшей мере, одним аминокислотным остатком, не участвующим в связывании антитела, или участвующим в существенно меньшей степени по сравнению с аминокислотными остатками, которые преимущественно участвуют в связывании антитела, причем указанными аминокислотными остатками являются -His-, -Phe-Phe- и -Lys-Leu-, соответственно, погруженные в следующую коровую последовательность:

His-Хаа2-Lys-Leu-Хаа3-Phe-Phe-Хаа4-Хаа5-Хаа6, в которой

Хаа2 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln,

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, норлейцина, Met, Phe и Ile,

Хаа4 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu, Ser и Ile,

Хаа5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp,

Xaa6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, причем указанные аминокислотные остатки Хаа2, Хаа3, Хаа4, Хаа5, Хаа6 не участвуют в связывании антитела или в меньшей или существенно меньшей степени по сравнению с -His-, -Lys-Leu- и -Phe-Phe- сайтом связывания, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем

Хаа2 обозначает Gln или Asn, но особенно Gln,

Хаа3 обозначает Val или Leu, но особенно Val,

Хаа4 обозначает Ala или Val, но особенно Ala,

Хаа5 обозначает Glu или Asp, но особенно Glu, и

Хаа6 обозначает Asp или Glu, но особенно Asp.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которое распознает и связывает по меньшей мере два отличительных сайта на β-амилоидном белке, причем указанные по меньшей мере два отличительных сайта связывания включают по меньшей мере два последовательно расположенных аминокислотных остатка, преимущественно участвующих в связывании антитела, причем по меньшей мере две последовательно расположенные аминокислоты разделены, по меньшей мере, одним аминокислотным остатком, не участвующим в связывании антитела, или участвующим в существенно меньшей степени по сравнению с аминокислотными остатками, которыми являются -Phe-Phe- и -Lys-Leu-, соответственно, представляющие первый и второй сайт связывания, погруженные в следующую коровую последовательность:

Хаа1-Хаа2-Lys-Leu-Хаа3-Phe-Phe-Хаа4-Хаа5-Хаа6, в которой:

Xaa1 обозначает аминокислотный остаток, выбранный из группы, состоящей из His, Asn, Gln, Lys и Arg,

Хаа2 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln,

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Val, Ala, Leu, Met, Phe, норлейцина и Ile,

Хаа4 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala, Val, Leu и Ile,

Хаа5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp,

Хаа6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, причем указанные аминокислотные остатки Хаа2, Хаа3, Хаа4, Хаа5, Хаа6 не участвуют в связывании антитела или участвуют в меньшей или существенно меньшей степени по сравнению с -Lys-Leu- и the -Phe-Phe сайтом связывания, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем

Xaa1 обозначает His или Arg, но особенно His,

Хаа2 обозначает Gln или Asn, но особенно Gln,

Хаа3 обозначает Val или Leu, но особенно Val,

Хаа4 обозначает Ala или Val, но особенно Ala,

Хаа5 обозначает Glu или Asp, но особенно Glu, и

Хаа6 обозначает Asp или Glu, но особенно Asp.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которое распознает и связывает по меньшей мере два отличительных сайта связывания на β-амилоидном белке, причем указанные по меньшей мере два отличительных сайта связывания каждый включает по меньшей мере два последовательно расположенных аминокислотных остатка, преимущественно участвующих в связывании антитела, которыми являются - Phe-Phe-Ala-Glu-, особенно -Phe-Phe-Ala-, более предпочтительно -Phe-Phe- и -Lys-Leu-, соответственно, причем указанные по меньшей мере два отличительных сайта связывания представляют аминокислотную последовательность -Val-Phe-Phe-Ala-Glu-Asp-, представленную в SEQ ID NO:7, и аминокислотную последовательность His-Gln-Lys-Leu-Val-, представленную в SEQ ID NO:8, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которое распознает и связывает по меньшей мере один отличительный сайт связывания, особенно по меньшей мере два отличительных сайта связывания, более предпочтительно по меньшей мере три отличительных сайта связывания на β-амилоидном белке, причем указанные по меньшей мере один или указанные по меньшей мере два отличительных сайта связывания включают по меньшей мере один и по меньшей мере два последовательно расположенных аминокислотных остатка, соответственно, преимущественно участвующих в связывании антитела, которыми являются -Phe-Phe-, и -Lys-Leu, - и -His-, соответственно, причем указанные отличные сайты связывания погружены в аминокислотную последовательность -Val-Phe-Phe-Ala-Glu-, и аминокислотную последовательность -His-Gln-Lys-Leu-Val-, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, включает сайт распознавания и связывания антигена, который распознает и связывает по меньшей мере два отличительных сайта связывания на β-амилоидном белке, причем указанные по меньшей мере два отличительных сайта связывания каждый включает по меньшей мере два последовательных аминокислотных остатка в аминокислотной последовательности, приведенной в SEQ ID NOs:7 и 8, соответственно, причем указанные последовательные аминокислотные остатки, особенно -Phe-Phe- и -Lys-Leu-, являются преимущественно вовлеченными в связывание β-амилоидного белка.

В одном из вариантов осуществления настоящего изобретения сайты распознавания и связывания, описанные выше в настоящем изобретении, формируют конформационный прерывистый эпитоп, локализованный в области β-амилоидного белка между аминокислотными остатками с 12 по 24, особенно между аминокислотными остатками 14-23, более предпочтительно между аминокислотными остатками 14-20, причем по меньшей мере два отличительных сайта распознавания и связывания каждый включает по меньшей мере 2 аминокислотных остатка, расположенных в положениях 16 и 17 и в положениях 19 и 20, соответственно, причем по меньшей мере один отличительный сайт распознавания и связывания, включающий по меньшей мере 1 аминокислотный остаток, локализованный в положении 14, эти остатки преимущественно участвуют в связывании β-амилоидного белка, причем указанные сайты распознавания и связывания по меньшей мере с одной стороны фланкированы аминокислотными остатками, преимущественно остатками 21 и 22, и разделены одним аминокислотным остатком, локализованным в положениях 15 и 18, эти аминокислотные остатки непосредственно не участвуют в связывании антигена, или по меньшей мере участвуют в существенно меньшей степени.

В еще одном из вариантов осуществления настоящего изобретения указанные по меньшей мере три отличительных сайта распознавания и связывания фланкированы по обеим сторонам аминокислотными остатками, особенно остатками 12 и 13, и остатками 21 и 22 и разделены одним аминокислотным остатком, локализованным в положениях 15 и 18, эти аминокислотные остатки непосредственно не участвуют в связывании антигена, или по меньшей мере участвуют в существенно меньшей степени.

В другом варианте осуществления настоящего изобретения указанные последовательно расположенные аминокислотные остатки, особенно -Lys-Leu- в положении 16 и 17 и -Phe-Phe- в положении 19 и 20, которые преимущественно участвуют в связывании β-амилоидного белка, погружены в следующую коровую область:

Val- His- His- Gln- Lys- Leu- Val- Phe- Phe- Ala- Glu- Asp
12 13 14 15 16 17 18 19 20 21 22 23

В другом варианте осуществления настоящего изобретения указанные аминокислотные остатки, особенно -Lys-Leu- в положении 16 и 17 и -Phe-Phe- в положении 19 и 20, и -His- в положении 14, которые преимущественно участвуют в связывании β-амилоидного белка, погружены в следующую коровую область:

Val- His- His- Gln- Lys- Leu- Val- Phe- Phe- Ala- Glu- Asp- Val- Gly-
12 13 14 15 16 17 18 19 20 21 22 23 24 25

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело или его фрагмент, которое включает в вариабельной области легкой и тяжелой цепи, соответственно, по меньшей мере одну область CDR, происходящую не от человека, особенно две области CDR, происходящие не от человека, более предпочтительно три области CDR, происходящие не от человека, погруженные в одну или несколько областей каркасных участков, полученных от человека или примата, и необязательно константную область, происходящую от антитела человека или примата, причем гуманизированное антитело или его фрагмент способны специфически распознавать и связывать β-амилоидный белок, особенно β-амилоидный мономерный пептид, более предпочтительно β-амилоидный полимерный пептид, еще более предпочтительно β-амилоидные волокна, фибриллы или филаменты отдельно или в качестве части β-амилоидной бляшки, по эпитопу, включающему следующую аминокислотную последовательность (SEQ ID NO:11):

Xaa1-Хаа2-Lys-Leu-Хаа3-Phe-Phe-Xaa4-Xaa5-Хааб, в которой

Xaa1 обозначает аминокислотный остаток, выбранный из группы, состоящей из His, Asn, Gln, но особенно His,

Хаа2 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln, но особенно Gln, и

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Val, Leu и Ile, но особенно Val,

Xaa4 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala и Val, но особенно Ala,

Xaa5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, но особенно Glu,

Хаа6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, но особенно Asp.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело или его фрагмент, которое включает в вариабельной области легкой и тяжелой цепи, соответственно, по меньшей мере одну область CDR, происходящую не от человека, особенно две области CDR, происходящие не от человека, более предпочтительно три области CDR, происходящие не от человека, погруженные в одну или несколько областей каркасного участка, происходящих от человека или примата, и необязательно константную область, происходящую от антитела человека или примата, причем гуманизированное антитело или его фрагмент способно специфически распознавать и связывать β-амилоидный белок, особенно β-амилоидный мономерный пептид, более предпочтительно β-амилоидный полимерный пептид, еще более предпочтительно β-амилоидные волокна, фибриллы или филаменты отдельно или в качестве составляющих β-амилоидной бляшки, по эпитопу, включающему следующую аминокислотную последовательность:

His-Хаа2-Lys-Leu-Хаа3-Phe-Phe-Xaa4-Хаа5-Хаа6, причем

Хаа2 обозначает аминокислотный остаток, выбранный из группы, состоящей из Asn и Gln, но особенно Gln, и

Хаа3 обозначает аминокислотный остаток, выбранный из группы, состоящей из Val, Leu и Ile, но особенно Val,

Хаа4 обозначает аминокислотный остаток, выбранный из группы, состоящей из Ala и Val, но особенно Ala,

Хаа5 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, но особенно Glu,

Хаа6 обозначает аминокислотный остаток, выбранный из группы, состоящей из Glu и Asp, но особенно Glu, причем указанные аминокислотные остатки Хаа2, Хаа3, Xaa4, Хаа5, Хаа6 не участвуют в связывании антитела или участвуют в меньшей степени по сравнению с -His- и -Lys-Leu- и -Phe-Phe- сайтом связывания.

В одном из вариантов осуществления настоящего изобретения область CDR, происходящую не от человека, получают от антитела-донора, но особенно антитела-донора мыши, сформировавшегося против фрагмента антигена, который не содержит указанного отличительного сайта связывания. Это изменение в области эпитопа может быть по меньшей мере частично вызвано применением надмолекулярной антигенной конструкции, включающей антигенный пептид, соответствующий аминокислотной последовательности β-амилоидного пептида, особенно β-амилоидного пептида Aβ1-16, модифицированный гидрофильной частью молекулы, например, полиэтиленгликолем (ПЭГ), причем указанная гидрофильная часть молекулы ковалентно связана с каждым из концов антигенного пептида через по меньшей мере одну, особенно одну или две аминокислоты, например, лизин, глутаминовую кислоту и цистеин или какую-либо другую соответствующую аминокислоту или аминокислотный аналог, способный выступать в качестве контактного устройства для соединения гидрофильной части молекулы с фрагментом пептида согласно приведенному ниже описанию настоящего изобретения в процессе иммунизации. Если ПЭГ используют в качестве гидрофильной части молекулы, свободные от ПЭГ концы ковалентно связаны с фосфатидилэтаноламином или каким-либо другим соединением, которое может функционировать в качестве заякоривающего элемента, например, для погружения антигенной конструкции в двойной слой липосомы, по описанию, приведенному в настоящем изобретении.

В частности область CDR, происходящую не от человека, получают от антитела-донора мыши, которое проявляет специфические свойства антитела ACI-01-Ab7C2 (также называемого в настоящем описании антителом «mC2»), депонированного 01 декабря 2005 г. в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, по Будапештскому договору о международном признании депонирования микроорганизмов для целей патентной процедуры под номером DSM ACC2750.

В одном из вариантов осуществления настоящего изобретения область CDR, происходящую не от человека, получают от антитела-донора мыши ACI-01-Ab7C2 (также называемого в настоящем описании антителом «mC2»), депонированного 01 декабря 2005 г. в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, по Будапештскому договору о международном признании депонирования микроорганизмов для целей патентной процедуры под номером DSM ACC2750.

Кроме того, применение липида А в качестве части протокола иммунизации может повлиять на изменение в области эпитопа.

В одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу или его фрагменту, включающему интегрированный в каркасные участки, происходящие от человека или примата, по меньшей мере один пептид с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из последовательности SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (Heavy Chain Variable Region - HCVR), и SEQ ID NO:4, представляющей CDR1 вариабельной области легкой цепи (Light Chain Variable Region - LCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу или его фрагменту, причем указанное гуманизированное антитело включает интегрированный в каркасные участки тяжелой цепи, происходящие от человека или примата, по меньшей мере один пептид с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из последовательности SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (Heavy Chain Variable Region - HCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу или его фрагменту, причем указанное гуманизированное антитело включает интегрированный в каркасные участки легкой цепи, происходящей от человека или примата, пептид с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1 вариабельной области легкой цепи (LCVR).

Кроме того, настоящее изобретение относится к вариабельной области легкой цепи (Light Chain Variable Region - LCVR), включающей интегрированный в каркасные участки, происходящие от человека или примата, по меньшей мере один пептид с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1 вариабельной области легкой цепи (LCVR).

В другом варианте осуществления настоящее изобретение относится к вариабельной области тяжелой цепи (Heavy Chain Variable Region - HCVR), включающей интегрированный в каркасные участки, происходящие от человека или примата, по меньшей мере один пептид с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3 представляющей CDR3 вариабельной области тяжелой цепи (HCVR).

Настоящее изобретение также относится к гуманизированному антителу или его фрагменту, которые включают интегрированный в каркасные участки, происходящие от человека или примата, по меньшей мере два пептида, причем пептиды отличаются и проявляют аминокислотную последовательность, выбранную из группы последовательностей, состоящей из последовательности SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (HCVR), и SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR), причем одна и та же область CDR не может присутствовать в антителе дважды. В частности, если по меньшей мере две области CDR обе представляют CDR вариабельной области легкой цепи (LCVR), по меньшей мере одной из указанных CDR должна быть область CDR1, представленная последовательностью SEQ ID NO:4.

Настоящее изобретение также относится к гуманизированному антителу или его фрагменту, включающему интегрированный в каркасные участки тяжелой цепи, происходящие от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из последовательности SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (Heavy Chain Variable Region - HCVR), но особенно гуманизированному антителу или его фрагменту, причем одна и та же CDR не может содержаться в антителе дважды.

Кроме того, настоящее изобретение относится к вариабельной области тяжелой цепи (Heavy Chain Variable Region - HCVR), включающей интегрированный в каркасные участки тяжелой цепи, происходящие от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью, выбранной из группы последовательностей, включающей последовательность SEQ ID NO:1, представляющую CDR1, SEQ ID NO:2 представляющую CDR2, и SEQ ID NO:3 представляющую CDR3 вариабельной области тяжелой цепи (HCVR).

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу или его фрагменту, включающему интегрированный в каркасные участки, происходящие от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из последовательности SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR).

Кроме того, настоящее изобретение относится к вариабельной области легкой цепи (Light Chain Variable Region - LCVR), включающей интегрированный в каркасные участки легкой цепи, происходящей от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6 представляющей CDR3, вариабельной области легкой цепи (LCVR), причем одна и та же область CDR не может присутствовать дважды в антителе, в частности, по меньшей мере одна из указанных областей CDR должна быть областью CDR1, представленной последовательностью SEQ ID NO:4.

Настоящее изобретение также относится к гуманизированному антителу или его фрагменту, включающему интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, пептиды с аминокислотной последовательностью SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (HCVR), особенно в указанном выше порядке.

Кроме того, настоящее изобретение относится к вариабельной области тяжелой цепи (HCVR), включающей интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, пептиды с аминокислотной последовательностью SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (HCVR), особенно в указанном выше порядке.

Настоящее изобретение также относится к гуманизированному антителу или его фрагменту, включающему интегрированные в каркасные участки легкой цепи, происходящей от человека или примата, пептиды с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR), особенно в указанном выше порядке.

Кроме того, настоящее изобретение относится к вариабельной области легкой цепи (LCVR), включающей интегрированные в каркасные участки легкой цепи, происходящей от человека или примата, пептиды с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR), особенно в указанном выше порядке.

Настоящее изобретение также относится к гуманизированному антителу или его фрагменту, включающему интегрированные в каркасные участки, происходящие от человека или примата, по меньшей мере три пептида с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (HCVR), и последовательности SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR), но особенно гуманизированное антитело или его фрагмент, причем указанные одни и те же CDR не могут содержаться в антителе дважды.

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу или его фрагменту, включающему интегрированные в каркасные участки, происходящие от человека или примата, по меньшей мере четыре пептида с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (HCVR), и SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR), но особенно гуманизированное антитело или его фрагмент, причем указанные одни и те же CDR не могут содержаться в антителе дважды.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу или его фрагменту, включающему интегрированные в каркасные участки, происходящие от человека или примата, по меньшей мере пять пептидов с аминокислотной последовательностью, выбранной из группы последовательностей, состоящей из SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (HCVR), и SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR), но особенно гуманизированное антитело или его фрагмент, причем указанные одни и те же CDR не могут содержаться в антителе дважды.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу или его фрагменту, включающему интегрированные в каркасные участки, происходящие от человека или примата, пептиды с аминокислотной последовательностью SEQ ID NO:1, представляющей CDR1, SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3 вариабельной области тяжелой цепи (HCVR), и SEQ ID NO:4, представляющей CDR1, SEQ ID NO:5, представляющей CDR2, и SEQ ID NO:6, представляющей CDR3 вариабельной области легкой цепи (LCVR).

В одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, вариабельной области тяжелой цепи (HCVR), или ее фрагменту, причем указанное гуманизированное антитело, вариабельная область тяжелой цепи (HCVR) или ее фрагмент включает интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, по меньшей мере один пептид с аминокислотной последовательностью SEQ ID NO:2. представляющей CDR2 вариабельной области тяжелой цепи (HCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу, вариабельной области тяжелой цепи (HCVR) или ее фрагменту, причем указанное гуманизированное антитело, вариабельная область тяжелой цепи (HCVR) или ее фрагмент включает интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, по меньшей мере один пептид с аминокислотной последовательностью SEQ ID NO:3. представляющей CDR3 вариабельной области тяжелой цепи (HCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу, вариабельной области тяжелой цепи (HCVR) или ее фрагменту, причем указанное антитело, вариабельная область тяжелой цепи (HCVR) или ее фрагмент включает интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью SEQ ID NO:1, представляющей CDR1, и SEQ ID NO:2, представляющей CDR2, вариабельной области тяжелой цепи (HCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу, вариабельной области тяжелой цепи (HCVR) или ее фрагменту, причем антитело, вариабельная область тяжелой цепи (HCVR) или ее фрагмент включает интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью SEQ ID NO:1, представляющей CDR1, и SEQ ID NO:3, представляющей CDR3, вариабельной области тяжелой цепи (HCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу, вариабельной области тяжелой цепи (HCVR) или ее фрагменту, причем указанное антитело, вариабельная область тяжелой цепи (HCVR) или ее фрагмент включает интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью SEQ ID NO:2, представляющей CDR2, и SEQ ID NO:3, представляющей CDR3, вариабельной области тяжелой цепи (HCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу, вариабельной области легкой цепи (LCVR) или его фрагменту, причем антитело, вариабельная область легкой цепи (LCVR) или его фрагмент включает интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1, и SEQ ID NO:5, представляющей CDR2, вариабельной области легкой цепи (LCVR).

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу, вариабельной области легкой цепи (LCVR) или его фрагменту, причем антитело, вариабельная область легкой цепи (LCVR) или его фрагмент включает интегрированные в каркасные участки тяжелой цепи, происходящей от человека или примата, по меньшей мере два пептида с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1, и SEQ ID NO:6, представляющей область CDR3 вариабельной области легкой цепи (LCVR).

Настоящее изобретение также предусматривает гуманизированное антитело или его фрагмент, причем и вариабельная область тяжелой цепи (HCVR), и вариабельная область легкой цепи (LCVR) антитела мыши С2 каждая вносит по меньшей мере от одной из присущим им областей CDR до по меньшей мере двух областей CDR гуманизированного антитела. Таким образом, образуемое гуманизированное антитело или его фрагмент могут включать:

- по меньшей мере аминокислотную последовательность SEQ ID NO:1, представляющую CDR1 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:2, представляющую CDR2 (HCVR), в комбинации с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:3, представляющую CDR3 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:4, представляющей CDR1 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:1, представляющую CDR2 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:5, представляющей CDR1 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:2, представляющую CDR2 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:5, представляющей CDR2 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:2, представляющую CDR2 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:6, представляющей CDR3 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:1, представляющую CDR3 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:6, представляющей CDR1 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:3, представляющую CDR3 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:5, представляющей CDR2 (LCVR),

- по меньшей мере аминокислотную последовательность SEQ ID NO:3, представляющую CDR3 (HCVR) в комбинации с аминокислотной последовательностью SEQ ID NO:6, представляющей CDR3 (LCVR).

В еще одном варианте осуществления настоящее изобретение относится к химерному антителу или его фрагмент, или гуманизированному антителу или его фрагменту, описанному выше в настоящем изобретении, причем антитело включает константную область легкой цепи и/или тяжелой цепи, происходящей от человека или примата.

В другом варианте осуществления настоящее изобретение относится к химерному антителу или его фрагменту, или к гуманизированному антителу или его фрагменту, причем по меньшей мере один аминокислотный остаток, или несколько, но не более 5 аминокислотных остатков, более предпочтительно по меньшей мере один, но не более 4, еще более предпочтительно по меньшей мере один, но не более 3, но особенно предпочтительно по меньшей мере один, но не более 2 аминокислотных остатков областей CDR легкой цепи и/или тяжелой цепи, согласно приведенным последовательностям SEQ ID NO:1-6, изменены путем консервативных замещений таким образом, что антитело полностью поддерживает свою функциональность.

В частности настоящее изобретение относится к химерному антителу или его фрагменту, или к гуманизированному антителу или его фрагменту, причем в CDR2 вариабельной области легкой цепи (LCVR), приведенной в SEQ ID NO:5, Lys в положении 50 по нумерации Kabat замещен на аминокислотный остаток из группы, состоящей из Arg, Gln и Glu, особенно Arg.

В частности настоящее изобретение относится к вариабельной области легкой цепи (LCVR), причем в CDR2, приведенной в SEQ ID NO:5, Lys в положении 50 по нумерации Kabat замещен на аминокислотный остаток, выбранный из группы, состоящей из Arg, Gln и Glu, особенно Arg.

В другом варианте осуществления настоящее изобретение относится к химерному антителу или его фрагменту, или к гуманизированному антителу или его фрагменту, причем в CDR2 вариабельной области легкой цепи (LCVR), приведенной в SEQ ID NO:5, Ser в положении 53 по нумерации Kabat замещен на аминокислотный остаток, выбранный из группы, состоящей из Asn или Thr, но особенно предпочтительно Asn.

В частности настоящее изобретение относится к вариабельной области легкой цепи (LCVR), причем в CDR2, приведенной в SEQ ID NO:5, Ser в положении 53 по нумерации Kabat замещен на аминокислотный остаток из группы, состоящей из Asn или Thr, но особенно Asn.

В одном из вариантов осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем вариабельная область тяжелой цепи (HCVR) имеет аминокислотную последовательность, которая на 90%, предпочтительно 95%, более предпочтительно 98% идентична последовательности SEQ ID NO:15 и 16, соответственно.

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем вариабельная область легкой цепи (LCVR) имеет аминокислотную последовательность, которая на 90%, предпочтительно 95%, более предпочтительно 98% идентична последовательности SEQ ID NO:12 и 13, соответственно.

В еще одном из вариантов осуществления настоящего изобретения предусмотрено гуманизированное антитело или его фрагмент, причем по меньшей мере две, но особенно три из областей CDR вариабельной области тяжелой цепи (HCVR) имеют аминокислотную последовательность, которая на 90%, предпочтительно 95%, более предпочтительно 98% идентична соответствующей области CDR, обозначенной в SEQ ID NO:1-3.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело или его фрагмент, причем по меньшей мере две, но особенно три из областей CDR вариабельной области легкой цепи (LCVR) имеют аминокислотную последовательность, которая на 90%, предпочтительно 95%, более предпочтительно 98% идентична соответствующей области CDR, обозначенной SEQ ID NO:4-6.

В еще одном из вариантов осуществления настоящее изобретение относится к химерному антителу или его фрагменту, или гуманизированному антителу или его фрагменту по настоящему изобретению, описанным выше, причем вариабельная область тяжелой цепи (HCVR) имеет аминокислотную последовательность, которая на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична последовательности, обозначенной в SEQ ID NO:15 и 16, соответственно.

В еще одном из вариантов осуществления настоящее изобретение относится к химерному антителу или его фрагменту, или гуманизированному антителу или его фрагменту по настоящему изобретению, описанным выше, причем вариабельная область легкой цепи (LCVR) имеет аминокислотную последовательность, которая на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична последовательности, обозначенной в SEQ ID NO:12 и 13, соответственно.

В еще одном из вариантов осуществления настоящее изобретение относится к химерному антителу или его фрагменту, или гуманизированному антителу или его фрагменту по настоящему изобретению, описанному выше, причем по меньшей мере одна область CDR, особенно по меньшей мере две области CDR, но более предпочтительно три области CDR из числа областей CDR вариабельной области тяжелой цепи (HCVR), имеют аминокислотную последовательность, которая на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична последовательности, обозначенной в SEQ ID NO:1-3.

В еще одном из вариантов осуществления настоящее изобретение относится к химерному антителу или его фрагменту, или гуманизированному антителу или его фрагменту по настоящему изобретению, описанному выше, причем по меньшей мере одна область CDR, особенно по меньшей мере две области CDR, но более предпочтительно три области CDR, из числа областей CDR вариабельной области легкой цепи (LCVR), имеют аминокислотную последовательность, которая на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична соответствующей области CDR, приведенной в SEQ ID NO:4-6.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу по настоящему изобретению, описанному выше, в котором по меньшей мере одна из аминокислот, представляющих акцепторные последовательности каркасного участка, полученные из последовательностей VH и VK зародышевой линии человека, изменена, а именно замещена на аминокислоту из соответствующей области антитела ACI-01-Ab7C2 мыши или на консервативную ей аминокислоту.

В частности, настоящее изобретение относится к гуманизированному антителу, в котором аминокислота Trp в положении 47 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на аминокислоту, выбранную из группы, состоящей из Leu, норлейцина, Ile, Val, Met, Ala и Phe, особенно Leu и Ile, но особенно предпочтительно Leu.

Настоящее изобретение также относится к гуманизированному антителу, в котором Arg по положению 94 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на аминокислоту, выбранную из группы, состоящей из Ser и Thr, но особенно Ser.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором Thr по положению 47 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на аминокислоту, выбранную из группы, состоящей из Leu, норлейцина, Ile, Val, Met, Ala и Phe, особенно Leu или Ile, но особенно Leu, и аминокислота Arg по положению 94 по нумерации Kabat замещена на аминокислоту, выбранную из группы, состоящей из Ser и Thr, но особенно Ser.

Настоящее изобретение также относится к гуманизированному антителу, в котором Gln по положению 45 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VK зародышевой линии человека из подгруппы Kabat VKII вариабельной области легкой цепи, показанной в SEQ ID NO:12, замещена на аминокислоту, выбранную из группы, состоящей из Lys, Arg, Gln и Asn, особенно Lys и Arg, но особенно Lys.

Настоящее изобретение также относится к гуманизированному антителу, в котором Leu в положении 50 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VK зародышевой линии человека из подгруппы Kabat VKII вариабельной области легкой цепи, показанной в SEQ ID NO:12, замещена на аминокислоту, выбранную из группы, состоящей из Lys, Arg, Gln и Asn, особенно Lys и Arg, наиболее предпочтительно Lys.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором Tyr в положении 87 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VK зародышевой линии человека из подгруппы Kabat VKII вариабельной области легкой цепи, показанной в SEQ ID NO:12, замещена на аминокислоту, выбранную из группы, состоящей из Phe, Leu, Val, Ile и Ala, особенно Leu и Phe, наиболее предпочтительно Phe.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором Asn в положении 53 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VK зародышевой линии человека из подгруппы Kabat VKII вариабельной области легкой цепи, показанной в SEQ ID NO:12, может быть замещена на аминокислоту, выбранную из группы, состоящей из Gln, His, Lys и Arg, но особенно His и Gln.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором аминокислота Trp в положении 47 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на аминокислоту, выбранную из группы, состоящей из Leu, норлейцина, Ile, Val, Met, Ala и Phe, особенно Leu и Ile, более предпочтительно Leu, и аминокислота Arg в положении 94 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на аминокислоту, выбранную из группы, состоящей из Ser и Thr, но особенно Ser, и аминокислота Tyr в положении 87 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VK зародышевой линии человека из подгруппы Kabat VKII вариабельной области легкой цепи, показанной в SEQ ID NO:12, замещена на аминокислоту, выбранную из группы, состоящей из Phe, Leu, Val, Ile и Ala, особенно Leu и Phe, но особенно Phe.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором аминокислота Trp в положении 47 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на аминокислоту, выбранную из группы, состоящей из Leu, норлейцина, Ile, Val, Met, Ala и Phe, предпочтительно Leu и Ile, но особенно Leu.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором аминокислота Arg в положении 94 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на аминокислоту, выбранную из группы, состоящей из Ser и Thr, но особенно Ser.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором аминокислота Trp в положении 47 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена Leu или Ile, но особенно Leu, и Arg в положении 94 по Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на Ser.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором аминокислота Tyr в положении 87 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VK зародышевой линии человека из подгруппы Kabat VKII вариабельной области легкой цепи, показанной в SEQ ID NO:12, замещена Phe.

В еще одном из вариантов осуществления настоящее изобретение относится к гуманизированному антителу, в котором аминокислота Trp в положении 47 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена Leu или Ile, но особенно Leu, и Arg в положении 94 по Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VH зародышевой линии человека из подгруппы Kabat VHIII вариабельной области тяжелой цепи, показанной в SEQ ID NO:15, замещена на Ser и Tyr в положении 87 по нумерации Kabat в акцепторной последовательности каркасного участка, полученной из последовательностей VK зародышевой линии человека из подгруппы Kabat VKII вариабельной области легкой цепи, показанной в SEQ ID NO:12, замещена Phe.

В одном из вариантов осуществления настоящее изобретение относится к вариабельной области легкой цепи SEQ ID NO:12.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает вариабельную область легкой цепи SEQ ID NO:12.

В одном из вариантов осуществления настоящее изобретение относится к вариабельной области легкой цепи, включая сигнальные последовательности, что показано в SEQ ID NO:13.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает всю вариабельную область легкой цепи, включая сигнальные последовательности, что показано в последовательности SEQ ID NO:13.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает вариабельную область легкой цепи последовательности SEQ ID NO:12 и константную область легкой цепи последовательности SEQ ID NO:14.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает всю вариабельную область легкой цепи последовательности SEQ ID NO:13 и константную область легкой цепи последовательности SEQ ID NO:14.

В одном из вариантов осуществления настоящее изобретение относится к вариабельной области тяжелой цепи SEQ ID NO:15.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает вариабельную область тяжелой цепи последовательности SEQ ID NO:15.

В одном из вариантов осуществления настоящее изобретение относится к вариабельной области тяжелой цепи, включая сигнальные последовательности, что показано в SEQ ID NO:16.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает всю вариабельную область тяжелой цепи, включая сигнальные последовательности, что показано в SEQ ID NO:16.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает вариабельную область тяжелой цепи последовательности SEQ ID NO:15 и константную область тяжелой цепи последовательности SEQ ID NO:17.

В другом варианте осуществления настоящего изобретения предусмотрено гуманизированное антитело, которое включает вариабельную область тяжелой цепи последовательности SEQ ID NO:16 и константную область тяжелой цепи последовательности SEQ ID NO:17.

В одном из вариантов осуществления настоящего изобретения гуманизированное антитело по настоящему изобретению при инкубировании с Аβ мономерным пептидом, имеющим по меньшей мере 30, предпочтительно по меньшей мере 35, более предпочтительно по меньшей мере 38, еще более предпочтительно по меньшей мере 40 аминокислотных остатков, и/или с Аβ полимерным растворимым амилоидным пептидом, включающим множество указанных Аβ мономерных единиц, но особенно с Аβ1-42 мономерным и/или Аβ полимерным растворимым амилоидным пептидом, включающим множество указанных Аβ1-42 мономерных единиц, особенно при мольном соотношении концентраций антитела к Aβ1-42 до 1:1000, но особенно при мольном соотношении концентраций от 1:10 до 1:100, ингибирует агрегирование Аβ мономеров в высокомолекулярные полимерные фибриллы.

В частности, совместное инкубирование антитела по настоящему изобретению с амилоидными мономерными и/или полимерными растворимыми пептидами проводят в течение от 24-60 ч, особенно в течение 30-50 ч, более предпочтительно в течение 48 ч, но особенно предпочтительно в течение 24 ч, при температуре от 28°С до 40°С, особенно от 32°С до 38°С, но особенно предпочтительно при 37°С.

В одном из вариантов осуществления настоящего изобретения совместное инкубирование с амилоидными мономерными и/или полимерными растворимыми амилоидными пептидами проводят в течение 24 ч при температуре 37°С.

В частности, антитело, особенно гуманизированное антитело по настоящему изобретению, включая какое-либо функционально эквивалентное антитело или его функциональные части, связывается с Aβ1-42 мономерным пептидом и/или Аβ полимерным растворимым амилоидным пептидом, включающим множество указанных Aβ1-42 мономерных единиц, и при совместном инкубировании с Aβ1-42 мономерным пептидом и/или Аβ полимерным растворимым амилоидным пептидом, включающим множество указанных Аβ1-42 мономерных единиц, ингибирует агрегирование Аβ мономеров и/или полимеров до высокомолекулярных полимерных фибрилл.

В одном из вариантов осуществления настоящего изобретения антитело, особенно гуманизированное антитело по настоящему изобретению, включая какое-либо функционально эквивалентное антитело или его функциональные части, ингибирует агрегирование Аβ мономеров и/или Аβ растворимых полимеров, включающих множество указанных Аβ мономерных единиц, до высокомолекулярных полимерных фибрилл по меньшей мере на 50%, особенно по меньшей мере на 60%, особенно по меньшей мере на 65%, более предпочтительно по меньшей мере на 75%, еще более предпочтительно по меньшей мере на 80%, но особенно предпочтительно по меньшей мере на 85-90% или более по сравнению с соответствующими мономерами амилоидных пептидов, инкубированных в буфере (контроль), при мольном соотношении концентраций антитела и Aβ1-42 до 1:1000, особенно при соотношении мольной концентрации от 1:10 до 1:100, но особенно при соотношении мольной концентрации 1:10.

В одном из вариантов осуществления настоящего изобретения антитело, особенно гуманизированное антитело по настоящему изобретению, включая какое-либо функционально эквивалентное антитело или его функциональные части, ингибирует агрегирование Аβ мономеров и/или Аβ растворимых полимеров, включающих множество указанных Аβ мономерных единиц, до высокомолекулярных полимерных фибрилл по меньшей мере на 30% при мольном соотношении концентраций антитела и Aβ1-42 1:100.

В другом варианте осуществления настоящего изобретения антитело, особенно гуманизированное антитело по настоящему изобретению, включая какое-либо функционально эквивалентное антитело или его функциональные части, ингибирует агрегирование Аβ мономеров и/или Аβ растворимых полимеров, включающих множество указанных Аβ мономерных единиц, до высокомолекулярных полимерных фибрилл по меньшей мере на 80% при мольном соотношении концентраций антитела и Aβ1-42 1:10.

Связывание антител по настоящему изобретению с описанными в настоящем изобретении амилоидными мономерными и/или полимерными пептидами, но, предпочтительно, с амилоидной формой (1-42), приводит к подавлению агрегирования мономерных и/или полимерных амилоидогенных пептидов до высокомолекулярных фибрилл или филаментов. За счет ингибирования агрегирования амилоидогенных и/или полимерных пептидов антитела по настоящему изобретению способны предотвратить или понизить формирование амилоидных бляшек, особенно амилоидной формы (1-42), о которой известно, что она становится нерастворимой за счет изменения вторичной конформации и является значительной частью амилоидных бляшек в мозге больных животных или людей.

Способность антитела по настоящему изобретению ингибировать способность к агрегированию может быть определена каким-либо соответствующим методом, известным в данной области, в частности ультрацентрифугированием в градиенте плотности с последующим анализом осадка SDS-PAGE на полученном градиенте и/или с помощью тиофлавин Т (Th-Т) флуоресцентного анализа.

В одном из вариантов осуществления настоящее изобретение относится к антителу, особенно к гуманизированному антителу по настоящему изобретению, включая какое-либо функционально эквивалентное антитело или его функциональные части, причем антитело при совместном инкубировании, особенно в соотношении мольных концентраций от 1:10 до 1:1000, более предпочтительно в соотношении 1:100, с предварительно сформированными высокомолекулярными полимерными амилоидными фибриллами или филаментами, полученными путем агрегирования Аβ мономерных пептидов, имеющих по меньшей мере 30, особенно по меньшей мере 35, более предпочтительно по меньшей мере 38, еще более предпочтительно по меньшей мере 40 аминокислотных остатков, но особенно Аβ1-42 мономерных пептидов, способно дезагрегировать предварительно сформированные полимерные фибриллы или филаменты по меньшей мере на 20%, особенно по меньшей мере на 30%, более предпочтительно по меньшей мере на 35%, еще более предпочтительно по меньшей мере на 40%, но особенно по меньшей мере на 50% или более.

В одном из вариантов осуществления настоящего изобретения подавление агрегирования и способность к дезагрегированию антителом, соответственно, определяют ультрацентрифугированием в градиенте плотности с последующим анализом осадка SDS-PAGE на полученном градиенте.

В другом варианте осуществления настоящего изобретения подавление агрегирования и способность к дезагрегированию антителом, соответственно, определяют с помощью тиофлавин Т (Th-T) флуоресцентного анализа.

В еще одном из вариантов осуществления настоящего изобретения антитело по настоящему изобретению совместно инкубируют с амилоидными заранее сформированными высокомолекулярными полимерными фибриллами или филаментами в течение 12-36 ч, особенно в течение 18-30 ч, более предпочтительно в течение 24 ч при температуре от 28°С до 40°С, особенно от 32°С до 38°С, более предпочтительно при 37°С.

В частности совместное инкубирование с заранее сформированными высокомолекулярными полимерными амилоидными фибриллами или филаментами проводят в течение 24 ч при температуре 37°С.

В одном из вариантов осуществления настоящее изобретение относится к антителу, особенно к гуманизированному антителу по настоящему изобретению, включая какое-либо функционально эквивалентное антитело или его функциональные части, которое способно к дезагрегированию заранее сформированных полимерных фибрилл или филаментов по меньшей мере на 24% при мольном соотношении концентраций антитела и Аβ1-42 1:100.

В другом варианте осуществления настоящего изобретения антитело, особенно гуманизированное антитело по настоящему изобретению, включая какое-либо функционально эквивалентное антитело или его функциональные части, которое способно к дезагрегированию заранее сформированных полимерных фибрилл или филаментов по меньшей мере на 32% при мольном соотношении концентраций антитела и Aβ1-42 1:10.

За счет дезагрегирования амилоидогенных полимерных фибрилл или филаментов, антитела по настоящему изобретению способны предупреждать или снижать формирование амилоидных бляшек, которые приводят к облегчению симптомов, связанных с заболеванием и задержкой или отменой его прогрессирования.

Таким образом, это еще один вариант осуществления настоящего изобретения для получения антитела, особенно гуманизированного антитела, в том числе какое-либо функционально эквивалентное антитело или его функциональные части, описанные в настоящем изобретении, причем антитело способно понизить общее количество Аβ в мозге животного, особенно млекопитающего, особенно человека с заболеванием или состоянием, приводящим к повышенной концентрации Аβ в мозге.

В другом варианте осуществления настоящее изобретение относится к гуманизированному антителу по настоящему изобретению, описанному выше, причем антитело обладает двойной эффективностью, заключающейся в том, что оно проявляет и способность подавлять агрегирование, и способность дезагрегировать, особенно связанную с высокой степенью конформационной чувствительности.

В частности, настоящее изобретение относится к описанному выше химерному антителу или его фрагменту, или гуманизированному антителу или его фрагменту по настоящему изобретению, причем антитело при совместном инкубировании с амилоидными мономерными и/или полимерными растворимыми амилоидными пептидами, особенно с β-амилоидными мономерными пептидами, например, Аβ мономерными пептидами 1-39, 1-40, 1-41 или 1-42, и/или полимерным растворимым β-амилоидным пептидом, включающим множество указанных Аβ мономерных единиц, но особенно с Aβ1-42 мономерными единицами, ингибирует агрегирование Аβ мономеров в высокомолекулярные полимерные фибриллы или филаменты, кроме того, при совместном инкубировании с заранее сформированными высокомолекулярными полимерными амилоидными фибриллами или филаментами, сформированными путем агрегирования амилоидных мономерных пептидов, особенно β-амилоидных мономерных пептидов, например, Аβ мономерных пептидов 1-39, 1-40, 1-41 или 1-42, но особенно Aβ1-42 мономерных пептидов, способно дезагрегировать заранее сформированные полимерные фибриллы или филаменты.

Другой объект настоящего изобретения относится к описанному выше химерному антителу или его фрагменту, или гуманизированному антителу или его фрагменту по настоящему изобретению, причем антитело способно индуцировать переход конформации β-слоя в α-спираль и/или к конформации произвольной спирали, но особенно к конформации произвольной спирали, еще более предпочтительно к конформации произвольной спирали в конкретном положении в молекуле, особенно в окружении Tyr10 и Val12 белка Аβ, которая приводит к повышению конформации произвольной спирали при расходовании конформации β-слоя и повышенной растворимости ранее сформированных высокомолекулярных полимерных амилоидных фибрилл или филаментов. В частности количественное снижение конформации β-слоя по меньшей мере на 30%, особенно по меньшей мере на 35% и более предпочтительно по меньшей мере на 40% и более по сравнению с соответствующими ранее сформированными амилоидными полимерными фибриллами или филаментами, инкубированными в буфере (контроль).

Способность антитела индуцировать перемену вторичной структуры определяют с помощью твердотельной 13С ЯМР спектроскопии, в частности, путем измерения интегральной интенсивности конформаций Tyr10 и Val12 Сβ в пептиде Аβ1-42.

В другом варианте осуществления настоящее изобретение относится к описанному выше химерному антителу или его фрагменту, или гуманизированному антителу или его фрагменту по настоящему изобретению, включающему по меньшей мере одну легкую цепь или ее фрагмент, или по меньшей мере одну тяжелую цепь или ее фрагмент, причем указанное антитело или его фрагмент связывается с Аβ мономером со связывающим сродством от по меньшей мере примерно 1×10-7 до по меньшей мере примерно 1×10-12, особенно от по меньшей мере примерно 1×10-8 до по меньшей мере примерно 1×10-11, более предпочтительно от по меньшей мере примерно 1×10-9 до по меньшей мере примерно 1×10-10, еще более предпочтительно по меньшей мере примерно от 1×10-8 до по меньшей мере примерно 2×10-8, но предпочтительно не проявляет какой-либо существенной перекрестной реакционоспособности с амилоидным белком-предшественником (АРР).

В другом варианте осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент по настоящему изобретению, которые были описаны выше в настоящем изобретении, включающее по меньшей мере одну легкую цепь или ее фрагмент, или по меньшей мере одну тяжелую цепь или ее фрагмент, причем указанное антитело или его фрагмент связывается с Аβ волокнами, фибриллами или филаментами со связывающим сродством, составляющим по меньшей мере примерно от 1×10-7 до по меньшей мере примерно 1×10-12, особенно по меньшей мере примерно от 1×10-8 до по меньшей мере примерно 1×10-11, более предпочтительно по меньшей мере примерно от 1×10-9 до по меньшей мере примерно 1×10-10, еще более предпочтительно по меньшей мере примерно от 2×10-9 до по меньшей мере примерно 5×10-9, но предпочтительно не проявляет какой-либо существенной перекрестной реакционоспособности с амилоидным белком-предшественником (АРР).

В другом варианте осуществления настоящего изобретения антитело по настоящему изобретению или его фрагмент согласно приведенному выше проявляют связывающее сродство с Аβ волокнами, фибриллами или филаментами, которое по меньшей мере в 10 раз, особенно по меньшей мере в 15 раз, более предпочтительно по меньшей мере в 20 раз, но особенно по меньшей мере в 25 раз выше, чем связывающее сродство с Аβ мономером.

В другом варианте осуществления настоящего изобретения согласно приведенному выше описанию настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем антитело существенным образом связывается с агрегированным Аβ, включая бляшки Аβ, у млекопитающих, особенно в мозге человека, но предпочтительно не проявляет какой-либо существенной перекрестной реакционоспособности с амилоидным белком-предшественником (АРР).

В другом варианте осуществления настоящего изобретения согласно приведенному выше описанию настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем антитело существенным образом связывается с растворимым полимерным амилоидом, особенно амилоидом β (Аβ), включая мономеры Аβ, у млекопитающих, особенно в мозге человека, но предпочтительно не проявляет какой-либо существенной перекрестной реакционной способности с амилоидным белком-предшественником (amyloid precursor protein - АРР).

Также согласно приведенному выше описанию настоящего изобретения в нем предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, причем антитело существенным образом снижает нагрузку Аβ бляшек у млекопитающих, особенно в мозге человека. Это может быть достигнуто либо связыванием антитела с бляшками, либо сдвигом равновесия между амилоидом, особенно амилоидом β (Аβ) в его растворимой и агрегированной форме, в сторону растворимой формы за счет дезагрегирования волокон в растворимые поли- и мономерные формы путем индукции сдвига конформации и связыванием и стабилизацией дезагрегированных и растворимых амилоидных форм, особенно форм амилоида β (Аβ), в ткани и/или тканевых жидкостях субъекта, включая млекопитающих и людей, особенно в мозге субъектов. Через действие антитела по настоящему изобретению периферическое очищение и катаболизм таким образом преобладают над отложением в ткани и/или тканевых жидкостях субъекта, особенно в мозге. Полезное действие антитела по настоящему изобретению, таким образом, может быть получено без связывания антитела с бляшками.

За счет такого стабилизирующего действия антитело по настоящему изобретению может нейтрализовывать токсические эффекты полимерного и менее агрегированного растворимого амилоидного белка, особенно амилоидного β (Аβ) белка, в ткани и/или тканевых жидкостях субъекта, особенно млекопитающего, и более предпочтительно человека, в частности в мозге субъекта. В одном из вариантов осуществления настоящего изобретения антитело по настоящему изобретению может таким образом достичь полезных эффектов без необходимости связывать агрегированный амилоид-бета в мозге субъекта.

В другом варианте осуществления настоящего изобретения согласно приведенному выше описанию настоящего изобретения предусмотрено гуманизированное антитело или его фрагмент, которое включает по меньшей мере одну легкую цепь или ее фрагмент или по меньшей мере одну тяжелую цепь или ее фрагмент, внедряя по меньшей мере одну, особенно две, и более предпочтительно три области CDR, полученные от антитела-донора мыши, особенно от антитела ACI-01-Ab7C2 мыши (в настоящем описании обозначаемого «mC2», а гуманизированное С2 антитело человека обозначается «hC2»), депонированного 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) по адресу: Braunschweig, Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750, причем указанное антитело или его фрагмент имеет сродство с Аβ антигеном, которое по меньшей мере в 5 раз, особенно по меньшей мере в 8 раз, более предпочтительно по меньшей мере в 10 раз, но особенно предпочтительно по меньшей мере в 15 раз выше по сравнению со сродством к антителу-донору мыши.

Антитело по настоящему изобретению может быть в одном из вариантов осуществления целым антителом (например, с двумя легкими цепями полной длины и двумя тяжелыми цепями полной длины) какого-либо изотипа и подтипа (например, IgM, IgD, IgG1, IgG2, IgG3, IgG4, IgE, IgA1 и IgA2), но особенно антителом изотипа IgG4, в другом варианте в другом осуществлении настоящего изобретения оно может быть антигенсвязывающим фрагментом (например, Fab, F(ab')2, и Fv) целого антитела.

Настоящее изобретение также относится к антигенсвязывающим фрагментам антитела, описанным в настоящем изобретении. В одном из вариантов осуществления настоящего изобретения фрагмент выбран из группы, состоящей из Fab фрагмента, Fab' фрагмента, F(ab)2 фрагмента и Fv фрагмента, включая продукты библиотеки экспрессии Fab иммуноглобулина и эпитоп-связывающие фрагменты какого-либо антитела и фрагментов, указанных выше.

В другом варианте осуществления настоящего изобретения антитело или антигенсвязывающий фрагмент по настоящему изобретению конъюгирован с полиэтиленгликолем. В еще одном варианте осуществления настоящего изобретения константная область антитела по настоящему изобретению модифицирована для понижения по меньшей мере одной биологической эффекторной функции, связанной с константной областью, относительно немодифицированного антитела. В другом варианте осуществления настоящего изобретения антитело или антигенсвязывающий фрагмент по настоящему изобретению включает область Fc с измененной эффекторной функцией.

Настоящее изобретение также относится к нуклеотидной молекуле, включающей нуклеотидную последовательность, кодирующую химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент по настоящему изобретению и описанной выше.

В частности настоящее изобретение относится к нуклеотидной молекуле, включающей нуклеотидную последовательность, кодирующую отрезок расположенных подряд аминокислотных молекул, приведенную в SEQ ID NO:2 и 3, соответственно, или комплементарную последовательность, представляющую комплементарно детерминируемые области (CDR) 2 и 3 вариабельной области тяжелой цепи (HCVR).

Особенно настоящее изобретение относится к нуклеотидной молекуле, включающей нуклеотидную последовательность, кодирующую отрезок расположенных подряд аминокислотных молекул, приведенную в SEQ ID NO:4, или комплементарную последовательность, представляющую комплементарно детерминируемую область (CDR) 1 вариабельной области легкой цепи (LCVR).

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность, представленную в SEQ ID NO:18 и SEQ ID NO:19, или комплементарную последовательность, кодирующую аминокислотную последовательность CDR 2 и CDR 3, соответственно, вариабельной области тяжелой цепи (HCVR).

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность, приведенную в виде SEQ ID NO:20, или комплементарную последовательность, кодирующую нуклеотидную последовательность CDR 1 вариабельной области легкой цепи (LCVR).

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность SEQ ID NO:21, или комплементарную последовательность, кодирующую вариабельную область легкой цепи.

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность SEQ ID NO:22, или комплементарную последовательность, кодирующую всю вариабельную область легкой цепи, включая сигнальные последовательности.

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность, кодирующую вариабельную область легкой цепи последовательности SEQ ID NO:22 и константную область легкой цепи последовательности SEQ ID NO:23. Настоящее изобретение также включает комплементарную цепь указанной нуклеотидной молекулы.

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность SEQ ID NO:24, кодирующую вариабельную область тяжелой цепи. Настоящее изобретение также включает комплементарную цепь указанной нуклеотидной молекулы.

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность SEQ ID NO:25, кодирующая всю вариабельную область тяжелой цепи, включая сигнальные последовательности. Настоящее время также включает комплементарную цепь указанной нуклеотидной молекулы.

В другом варианте осуществления настоящего изобретения предусмотрена нуклеотидная молекула, включающая нуклеотидную последовательность, кодирующую вариабельную область тяжелой цепи SEQ ID NO:25 и константную область тяжелой цепи SEQ ID NO:26. Настоящее изобретение также включает комплементарную цепь указанной нуклеотидной молекулы.

К настоящему изобретению также относится нуклеотидная последовательность, которая гибридизируется с одной из нуклеотидных последовательностей, кодирующих описанное выше антитело по настоящему изобретению, в частности ее комплементарная цепь отдельно или в качестве части более крупной нуклеотидной молекулы.

В частности настоящее изобретение также относится к нуклеотидной последовательности, которая гибридизируется в обычных условиях гибридизации, особенно в жестких условиях гибридизации, с какой-либо из нуклеотидных последовательностей, приведенных в последовательностях SEQ ID NO:18-26 и 29-32, особенно к их комплементарным цепям.

В другом варианте осуществления настоящего изобретения предусмотрен вектор экспрессии, включающий молекулу нуклеиновой кислоты по настоящему изобретению, указанную в настоящем описании выше.

В другом варианте осуществления настоящего изобретения предусмотрены клетки, включающие вектор экспрессии, включающий нуклеиновую кислоту по настоящему изобретению, указанную в настоящем описании выше.

В другом варианте осуществления настоящее изобретение относится к композиции, включающей антитело по настоящему изобретению, особенно химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент по настоящему изобретению и, согласно описанному выше, включающей какое-либо функционально эквивалентное антитело, или какое-либо его производное или его функциональные части, в терапевтически эффективном количестве, особенно к композиции, которая является фармацевтической или терапевтической композицией, необязательно также включающей терапевтически приемлемый носитель.

В другом варианте осуществления настоящего изобретения указанная композиция включает антитело в терапевтически эффективном количестве.

К настоящему изобретению также относится композиция, включающая антитело, особенно моноклональное антитело по настоящему изобретению, особенно химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент по настоящему изобретению, описанные выше, включая какое-либо функционально эквивалентное антитело или какие-либо его производные или его функциональные части, в терапевтически эффективном количестве и необязательно также биологически действующее вещество, и/или фармацевтически приемлемый носитель, и/или растворитель, и/или эксципиент.

В частности настоящее изобретение относится к композиции или смеси, в которых дополнительное биологически действующее вещество является соединением, используемым в лечении амилоидоза - группы заболеваний и расстройств, связанных с амилоидом или амилоидоподобным белком, например, Аβ белком, вовлеченным в болезнь Альцгеймера.

В другом варианте осуществления настоящего изобретения другое биологически действующее вещество или соединение также может быть терапевтическим агентом, который может быть применен в лечении амилоидоза, вызванного амилоидом β, или может быть применен в лечении других нейрологических расстройств.

Другое биологически действующее вещество или соединение может проявлять биологическое действие тем же или сходным механизмом, что и антитело по настоящему изобретению, или по другому механизму действия, или с помощью множества родственных и/или неродственных механизмов действия.

Обычно к другим биологически активным соединениям могут относиться нейтрон-трансмиссионные энхансеры, психотерапевтические лекарственные средства, ингибиторы ацетихолинэстеразы, блокаторы кальциевых каналов, биогенные амины, бензодиазепиновые транкливизаторы, энхансеры синтеза, сохранности и высвобождения ацетилхолина, агонисты постсинаптического рецептора ацетилхолина, ингибиторы моноаминоксидазы-А или -В, антагонисты рецептора N-метил-D-аспартат-глутамата, нестероидные противовоспалительные лекарственные средства, антиоксиданты и антагонисты серотинэргического рецептора.

Точнее настоящее изобретение относится к композиции или смеси, включающей по меньшей мере одно соединение из группы, состоящей из соединений, эффективных против оксидативного стресса, анти-апоптических соединений, хелаторов металлов, ингибиторов репарации ДНК, например, пирензепина и метаболитов, 3-амино-1-пропансульфоновой кислота, 1,3-пропандисульфоната, активаторов α-секретазы, ингибиторов β- и γ-секретазы, тау белков, нейротрансмиттеров, нарушителей β-слоев, аттрактантов для амилоид-бета очищающих/истощающих клеточных компонентов, ингибиторов усеченного по N-концу амилоида-бета, включая амилоид-бета 3-42 в форме пироглутамата, противовоспалительных молекул или ингибиторов холинэстеразы (cholinesterase inhibitor - ChEI), например, такрина, ривастигмина, донепезила и/или галантамина, агонистов M1 и других лекарственных средств, включая какой-либо амилоид или тау модифицированное лекарственное средство и пищевые добавки, и пищевые добавки вместе с антителом по настоящему изобретению, а также необязательно фармацевтически приемлемый носитель, и/или растворитель, и/или эксципиент.

Настоящее изобретение также относится к композиции или смеси, в которой соединением является ингибитор холинэстеразы (ChEI), особенно смесь, в которой соединение является выбранным из группы, состоящей из такрина, ривастигмина, донепезила, галантамина, ниацина и мемантина.

В еще одном из вариантов осуществления настоящего изобретения композиции по настоящему изобретению могут включать ниацин или мемантин вместе с антителом по настоящему изобретению и необязательно с фармацевтически приемлемым носителем, и/или растворителем, и/или эксципиентом.

В другом варианте осуществления настоящего изобретения предусмотрены композиции, которые включают «атипичные антипсихотические средства», например, клозапин, ципразидон, рисперидон, арипипразол или оланзапин, для лечения положительных и отрицательных психотических симптомов, включающих галлюцинации, бред, нарушения мышления (проявляемые в форме выраженной бессвязности, неадекватности, расстройстве ассоциативного мышления), аномального или дезорганизованного поведения, например, ангедонии, аффекта в форме уныния, апатии и социальной замкнутости, вместе с антителом, особенно моноклональным антителом по настоящему изобретению, но особенно химерным антителом или его фрагментом, или гуманизированным антителом или его фрагментом по настоящему изобретению, описанным в настоящем изобретении, и необязательно фармацевтически приемлемый носитель, и/или растворитель, и/или эксципиент.

В отдельном варианте осуществления настоящего изобретения композиции и смеси по настоящему изобретению, описанные выше в настоящем изобретении, включают антитело и биологически действующее вещество, соответственно, в терапевтически эффективном количестве.

Другие соединения, которые могут быть использованы в смесях в комбинации с антителом по настоящему изобретению, описаны в WO 2004/058258 (особенно см. сс.16 и 17), включающем мишени для терапевтических лекарственных средств (сс.36-39), алкансульфоновые кислоты и алканосульфуровые кислоты (сс.39-51), ингибиторы холинэстеразы (сс.51-56), антагонисты рецептора NMDA (сс.56-58), эстрогены (сс.58-59), нестероидные противовоспалительные лекарственные средства (сс.60-61), антиоксиданты (сс.61-62), агонисты рецептора, активированного ролифераторами пероксисом (peroxisome proliferators-activated receptor - PPAR) (сс.63-67), холестерин понижающие агенты (сс.68-75), ингибиторы амилоида (сс.75-77), ингибиторы формирования амилоида (сс.77-78), хелаторы металла (сс.78-79), антипсихотики и антидепрессанты (сс.80-82), пищевые добавки (сс.83-89) и соединения, повышающие доступность биологически действующих веществ в мозге (см. сс.89-93), и пролекарства (сс.93 и 94), причем указанный документ включен в настоящее изобретение в виде ссылки.

В другом варианте осуществления настоящее изобретение относится к композиции, включающей антитело, особенно моноклональное антитело по настоящему изобретению, но особенно химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент по настоящему изобретению и описанные выше в настоящем изобретении, и/или биологически активное вещество в терапевтически эффективном количестве. Настоящее изобретение также относится к применению антитела, особенно моноклонального антитела по настоящему изобретению, более предпочтительно химерного антитела или его фрагмента, или гуманизированного антитела или его фрагмента по настоящему изобретению, описанному выше в настоящем изобретении, и/или его функциональной части, и/или фармацевтической композиции, или смеси, включающей указанное антитело, для получения лекарственного средства для лечения или облегчения проявлений амилоидоза - группы заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, неврологические расстройства, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие заболевания, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящем к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Настоящее изобретение также относится к способу получения антитела, особенно моноклонального антитела по настоящему изобретению, предпочтительно химерного антитела или его фрагмента, или гуманизированного антитела или его фрагмента по настоящему изобретению, описанных в настоящем изобретении выше, и/или их функциональной части, и/или фармацевтической композиции, или смеси, включающей указанное антитело и/или его функциональную часть, особенно в терапевтически эффективном количестве, включающему переработку антитела, особенно моноклонального антитела по настоящему изобретению, более предпочтительно химерного антитела или его фрагмента, или гуманизированного антитела или его фрагмента по настоящему изобретению в фармацевтически приемлемой форме, для использования в способе предупреждения, лечения или облегчения проявлений амилоидоза - группы заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, и нейрологические расстройства, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие, включая глазные заболевания, особенно ассоциированное со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящем к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Настоящее изобретение также относится к способу предупреждения, лечения или облегчения проявлений амилоидоза - группы заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая неврологические расстройства, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие заболевания, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированные со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, причем указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы, путем введения антитела и/или его функциональной части, более предпочтительно гуманизированного антитела и/или его функциональной части, или композиции, или смеси, включающих такое антитело и/или его функциональную часть, субъекту, включая млекопитающее или человека с указанным расстройством, в терапевтически эффективном количестве.

Настоящее изобретение также предусматривает способ лечения амилоидоза - группы заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), и других заболеваний, включая глазные заболевания, связанные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно связанные со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, деградацией нейронов, причем патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящем к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы, путем введения субъекту, особенно млекопитающему или человеку с таким заболеванием, антитела, особенно фармацевтической композиции по настоящему изобретению, описанной выше.

В одном из вариантов осуществления настоящего изобретения предусмотрен способ сохранения или повышения когнитивного объема памяти, особенно восстановления когнитивного объема памяти у субъекта, особенно млекопитающего или человека, с ухудшением памяти путем введения субъекту, особенно млекопитающему или человеку, нуждающемуся в этом, антитела, особенно фармацевтической или терапевтической композиции по настоящему изобретению, описанной выше. Согласно еще одному объекту настоящего изобретения предусматривается терапевтическая композиция и способ получения такой композиции, а также способ лечения амилоидоза - группы заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), и другие заболевания, глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Настоящее изобретение также относится к способу диагностики заболевания или состояния, связанного с амилоидом, включающему выявление иммуноспецифического связывания антитела или его действующего фрагмента с эпитопом амилоидного белка в образце или in situ, который включает следующие стадии:

(а) приведения образца, или специфической части тела, или области тела, в которых предположительно содержится амилоидный белок, в соприкосновение с антителом, особенно моноклональным антителом по настоящему изобретению, предпочтительно химерным антителом или его фрагментом, или гуманизированным антителом или его фрагментом по настоящему изобретению, описанным выше, и/или его функциональной частью, причем указанное антитело связывает эпитоп амилоидного белка,

(б) осуществления связывания антитела и/или его функциональной части с амилоидным белком для формирования иммунологического комплекса,

(в) выявления формирования иммунологического комплекса, и

(г) корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоидного белка в образце, или специфической части тела, или области тела субъекта.

Также предусмотрен способ определения степени нагрузки амилоидогенных бляшек в ткани и/или жидкостях тела субъекта, нуждающегося в этом, включающий:

(а) получение образца, представляющего ткань и/или жидкости тела исследуемого субъекта,

(б) тестирование указанного образца на наличие амилоидного белка с помощью антитела, особенно моноклонального антитела по настоящему изобретению, более предпочтительно химерного антитела или его фрагмента, или гуманизированного антитела или его фрагмента по настоящему изобретению, описанных выше, и/или их функциональных частей,

(в) определения количества антитела, связанного с белком, и

(г) подсчета нагрузки бляшек в ткани и/или жидкостях тела субъекта.

В частности настоящее изобретение относится к способу определения степени нагрузки амилоидогенных бляшек в ткани и/или жидкостях тела субъекта, нуждающегося в этом, причем формирование иммунологического комплекса на стадии (в) определяют таким образом, что наличие или отсутствие иммунологического комплекса коррелирует с наличием или отсутствием амилоидного белка.

В другом варианте осуществления настоящего изобретения предусмотрен набор для выявления и диагностики связанных с амилоидом заболеваний и состояний у субъекта, включающий антитело, особенно моноклональное антитело по настоящему изобретению, предпочтительно химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент по настоящему изобретению, описанное выше, и/или его функциональную часть.

В частности настоящее изобретение относится к набору для выявления и диагностики связанных с амилоидом заболеваний и состояний, содержащему контейнер с одним или несколькими антителами по настоящему изобретению и/или их функциональными частями и инструкции по применению антитела для связывания амилоидного белка для формирования иммунологического комплекса и выявления формирования иммунологического комплекса таким образом, что наличие или отсутствие иммунологического комплекса коррелирует с наличием или отсутствием амилоидного белка.

В другом объекте настоящего изобретения предусмотрены способы и композиции для предупреждения, лечения или выявления заболевания, связанного с амилоидозом, у субъекта, нуждающегося в этом, используя иммуноглобулины, согласно описанию настоящего изобретения, которые также включают вариант области Fc, причем указанный вариант области Fc включает по меньшей мере одну модификацию аминокислоты относительно области Fc дикого типа. Область Fc опосредует эффекторную функцию антитела или его фрагмента. С помощью модулирования способности части Fc антитела или его фрагмента связывать или активировать соответствующий рецептор, можно аннулировать или повысить эффекторную функцию антитела или его фрагмента.

Таким образом, в другом объекте настоящего изобретения предусмотрено антитело или его фрагмент по настоящему изобретению, дополнительно включающее вариант области Fc, включающий по меньшей мере одну мутацию аминокислоты, которая снижает эффекторную функцию. В одном таком объекте по меньшей мере одна мутация аминокислоты снижает гликозилирование антитела или его фрагмента. В другом таком объекте по меньшей мере одна мутация аминокислоты снижает связывание с родственным рецептором Fc. В другом таком объекте по меньшей мере одна мутация аминокислоты снижает активирование родственного рецептора Fc по связыванию антитела или его фрагмента. В одном таком объекте вариант области Fc является вариантом области Fc IgG1. В одном из таких объектов антитело или его фрагмент включает мутацию D265A в области Fc.

В другом объекте настоящего изобретения предусмотрено антитело или его фрагмент по настоящему изобретению, дополнительно включающий вариант области Fc, включающее по меньшей мере одну аминокислотную мутацию, которая повышает эффекторную функцию. В одном таком объекте по меньшей мере одна мутация аминокислоты повышает гликозилирование антитела или его фрагмента. В другом таком объекте по меньшей мере одна мутация аминокислоты повышает связывание с родственным рецептором Fc. В другом таком объекте по меньшей мере одна мутация аминокислоты повышает активирование родственного рецептора Fc по связыванию антитела или его фрагмента. Эти и другие объекты, свойства и преимущества настоящего изобретения станут яснее после рассмотрения подробного описания вариантов его осуществления и приводимой формулы изобретения.

Краткое описание фигур

Фиг.1 (пример 2). Вектор экспрессии тяжелой цепи химерного антитела.

Фиг.2 (пример 2). Вектор экспрессии легкой цепи химерного антитела.

Фиг.3-1 и 3-2 (пример 2). Кассета экспрессии вариабельной области легкой цепи мыши химерного антитела.

Фиг.4-1 и 4-2 (пример 2). Кассета экспрессии вариабельной области тяжелой цепи мыши химерного антитела.

Фиг.5 (пример 5.2). Сравнение вариабельной области тяжелой цепи мыши с наиболее близкой последовательностью зародышевой линии мыши.

Фиг.6 (пример 8). Действие очищенного гуманизированного антитела С2.

Фиг.7 (пример 9). Связывающее действие антитела, вырабатываемого кратковременной экспрессией конструкций модифицированной области CDRL2 антитела С2 в соединении с химерной тяжелой цепью антитела С2, по сравнению с химерным антителом C2ChVHAF/ChVK, вырабатываемым в результате кратковременной трансфекции, и очищенным антителом.

Фиг.8 (пример 11). Результаты анализа иммуногистохимического связывания с химерным антителом AF (IgG4) и гуманизированным антителом H4K1 (IgG4).

Фиг.9 (пример 12). Функциональность антитела mC2 на амилоидных волокнах. А) сравнение спектра 13C CPMAS и соответствие с U-13С Tyr10 и Val12 мечеными амилоидными β1-42 волокнами, инкубированными с ФСБ (слева в качестве контроля) или ACI-7-C2 (справа) в течение 24 ч и затем лиофилизированными. Пик при 33 частях на миллион соответствует конформации бета-слоя волокон, а пик при 30 частях на миллион является результатом конформации по типу произвольной спирали. Б) Сравнение соответствующих параметров для двух конформации Val12 Сβ. Соответствующие химические сдвиги для двух конформации крайне схожи, но полные интенсивности весьма различны, что отражает снижение конформации исходного бета-слоя примерно на 35% (1-(53.5/81.7)), и соответствует величине, полученной в результате измерения флуоресценции.

Фиг.10 (пример 12). Связывающее сродство гуманизированного С2 по данным метода ELISA.

Фиг.11 (пример 14). Конформационно-специфическое связывание антитела mC2 с амилоидными белками разных классов. Получение осадка, приведенное в легенде к настоящей фигуре, относится к Аβ1-42 волокнам, получение супернатанта относится к амилоидным мономерам.

Фиг.12. Гуманизированные С2 VK последовательности, сравниваемые с последовательностью мыши и акцепторными последовательностями человека DPK15 и JK1.

Фиг.13. Гуманизированные С2 VH последовательности, сравниваемые с последовательностью мыши и акцепторными последовательностями человека DP54 и JH6.

Фиг.14-1 и 14-2. Полная последовательность ДНК и белка вариабельной области гуманизированного антитела С2, C2HuVK1.

Фиг.15-1 - 15-10. Полная последовательность ДНК и белка константной области легкой цепи (С каппа человека) гуманизированного С2 антитела.

Фиг.16-1 - 16-4. Полная последовательность ДНК и белка константной области тяжелой цепи (IgG4 ser228-pro человека) гуманизированного С2 антитела.

Фиг.17А-В (пример 15). Результаты экспериментов по картированию эпитопа моноклонального антитела hC2, выполненные методом ELISA. Результаты представлены в виде оптической плотности (ОП). (А) Связывание hC2 с перекрывающимися пептидами Аβ1-42. Связывание с пептидом полной длины Aβ1-42 и связывание с несвязывающимся химерным контрольным антителом, при использовании в качестве положительного и отрицательного контроля, соответственно. Номер пептида соответствует аминокислоте в последовательности Aβ1-42, с которой начинается пептид. (Б) Связывание hC2 с Aβ12-20 и аланин-замещенным Aβ12-20. Связывание с пептидом полной длины Aβ1-42 используют в качестве положительного контроля. Номер пептида соответствует аминокислоте, которая замещена на аланин. (В) Связывание hC2 с пептидами Аβ 13-21, 13-21G21, 14-22, 14-22А22, 15-23 и 15-23А23. Связывание с пептидом полной длины Aβ1-42 используют в качестве контроля.

Фиг.18 (пример 13). Результаты экспериментов по изучению агрегирования.

Фиг.19 (пример 13). Результаты экспериментов по изучению дезагрегирования.

Фиг.20 (пример 16). Результаты экспериментов по нейропротекции с гуманизированным антителом С2.

Краткое описание последовательностей

SEQ ID NO:1. Аминокислотная последовательность вариабельной области (CDR1) гуманизированной тяжелой цепи антитела С2 HuVH AF 4.

SEQ ID NO:2. Аминокислотная последовательность вариабельной области (CDR2) гуманизированной тяжелой цепи антитела С2 HuVH AF 4.

SEQ ID NO:3. Аминокислотная последовательность вариабельной области (CDR3) гуманизированной тяжелой цепи антитела С2 HuVH AF 4.

SEQ ID NO:4. Аминокислотная последовательность вариабельной области (CDR1) 1 гуманизированной легкой цепи антитела С2 HuVK.

SEQ ID NO:5. Аминокислотная последовательность вариабельной области (CDR2) гуманизированной легкой цепи антитела С2 HuVK 1.

SEQ ID NO:6. Аминокислотная последовательность вариабельной области (CDR3) гуманизированной легкой цепи антитела С2 HuVK 1.

SEQ ID NO:7. Аминокислотная последовательность области 2 эпитопа Аβ.

SEQ ID NO:8. Аминокислотная последовательность области 1 эпитопа Аβ.

SEQ ID NO:9. Аминокислотная последовательность модифицированной области 2 эпитопа Аβ.

SEQ ID NO:10. Аминокислотная последовательность модифицированной области 1 эпитопа Аβ.

SEQ ID NO:11. Аминокислотная последовательность полностью модифицированной области эпитопа.

SEQ ID NO:12. Аминокислотная последовательность вариабельной области гуманизированной легкой цепи антитела С2 HuVK 1.

SEY ID NO:13. Аминокислотная последовательность гуманизированной легкой цепи антитела С2.

SEQ ID NO:14. Аминокислотная последовательность константной области легкой цепи гуманизированного антитела С2.

SEQ ID NO:15. Аминокислотная последовательность вариабельной области гуманизированной тяжелой цепи антитела С2 HuVH AF 4.

SEQ ID NO:16. Аминокислотная последовательность тяжелой цепи гуманизированного антитела С2.

SEQ ID NO:17. Модифицированная область аминокислотной последовательности цепи С IG гамма-4.

SEQ ID NO:18. Нуклеотидная последовательность области CDR2 вариабельной области гуманизированной тяжелой цепи антитела С2 HuVH AF 4.

SEQ ID NO:19. Нуклеотидная последовательность области CDR3 вариабельной области гуманизированной тяжелой цепи антитела С2 HuVH AF 4.

SEQ ID NO:20. Нуклеотидная последовательность области CDR1 вариабельной области гуманизированной легкой цепи антитела С2 HuVK 1.

SEQ ID NO:21. Нуклеотидная последовательность вариабельной области гуманизированной легкой цепи антитела С2 HuVK I.

SEQ ID NO:22. Нуклеотидная последовательность гуманизированной легкой цепи антитела С2.

SEQ ID NO:23. Нуклеотидная последовательность константной области гуманизированной легкой цепи антитела С2.

SEQ ID NO:24. Нуклеотидная последовательность вариабельной области гуманизированной тяжелой цепи антитела С2 HuVH AF 4.

SEQ ID NO:25. Нуклеотидная последовательность гуманизированной тяжелой цепи антитела С2.

SEQ ID NO:26. Нуклеотидная последовательность константной области гуманизированной тяжелой цепи антитела С2.

SEQ ID NO:27. Аминокислотная последовательность вариабельной области легкой цепи антитела мыши С2.

SEQ ID NO:28. Аминокислотная последовательность вариабельной области тяжелой цепи антитела мыши С2.

SEQ ID NO:29. Нуклеотидная последовательность вариабельной области легкой цепи антитела мыши С2.

SEQ ID NO:30. Нуклеотидная последовательность легкой цепи антитела мыши С2.

SEQ ID NO:31. Нуклеотидная последовательность вариабельной области тяжелой цепи антитела мыши С2.

SEQ ID NO:32. Нуклеотидная последовательность тяжелой цепи антитела мыши С2.

Подробное описание изобретения

Антитела по настоящему изобретению, включая какие-либо функционально эквивалентные антитела или их функциональные части, или, что более предпочтительно, гуманизированное антитело, включая какое-либо функционально эквивалентное антитело или его функциональные части, описанные в настоящем изобретении, могут применяться для лечения глазных заболеваний, связанных с патологическими нарушениями/изменениями в тканях зрительной системы субъекта, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, деградации нейронов. Указанные патологические нарушения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, приводящие к кортикальной зрительной недостаточности; в передней камере глаза и глазном нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к глазному амилоидозу; в сетчатке, приводящие к первичной дегенерации сетчатки, включая дегенерацию желтого пятна, например, возрастную дегенерацию желтого пятна; в зрительном нерве, приводящие к старческим бляшкам зрительного нерва, зрительной невропатии и зрительному невриту; и в роговице, приводящие к решетчатой дистрофии роговицы.

В частности композиция, особенно терапевтическая композиция, включающая антитело, особенно гуманизированное антитело, включая какое-либо функционально эквивалентное антитело или его функциональные части, описанные в настоящем изобретении, в терапевтически эффективном количестве, могут применяться для лечения глазных заболеваний, ассоциированных с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические изменения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, приводящие к кортикальной зрительной недостаточности; в передней камере глаза и глазном нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к глазному амилоидозу; в сетчатке, приводящие к первичной дегенерации сетчатки, включая дегенерацию желтого пятна, например, возрастную дегенерацию желтого пятна; в зрительном нерве, приводящие к старческим бляшкам зрительного нерва, зрительной невропатии и зрительному невриту; и в роговице, приводящие к решетчатой дистрофии роговицы.

В другом варианте осуществления настоящего изобретения композиция по настоящему изобретению, применяемая в лечении глазных заболеваний, ассоциированных с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированных со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, причем указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы; предусмотрена в форме микстуры, в которой антитело и другое вещество биологического действия перемешаны в или с одним и тем же фармацевтически приемлемым растворителем и/или носителем, или антитело и другое вещество биологического действия может быть отдельно в качестве части отдельной композиции, которая может быть предложена отдельно или вместе в форме набора частей.

Глаукома - группа заболеваний зрительного нерва, включающая утрату ганглиозных клеток сетчатки (ГКС), свойственную зрительной нейропатии. Глаукома часто, но не всегда, сопровождается повышенным внутриглазным давлением, которое может быть результатом блокады циркуляции жидкости или ее дренажа.

Хотя повышенное внутриглазное давление представляет существенный фактор риска для развития глаукомы, нельзя выделить внутриглазное пороговое давление, которое может быть определяющим для развития глаукомы.

Поражение глаза также может быть выражено плохим кровоснабжением волокон зрительного нерва, слабостью структуры нерва и/или изменениями в здоровом состоянии самих нервных волокон.

При отсутствии лечения глаукома приводит к постоянному разрушению зрительного нерва и в результате к утрате поля зрения, которая может прогрессировать и перейти в слепоту.

Ретинальные ганглиозные клетки (ГКС) являются нервными клетками, которые передают зрительные сигналы в мозг. Каспаза-3 и каспаза-8 - два главных фермента в процессе апоптоза, активируются в процессе, приводящем к апоптозу ГКС. Каспаза-3 расщепляет белок-предшественник амилоида (amyloid precursor protein - АРР) с формированием нейротоксических фрагментов, включая амилоид β. Без защитного эффекта АРР накопление амилоида β в слое ретинальных ганглиозных клеток приводит к гибели ГКС и необратимой утрате зрения.

Разные типы глаукомы классифицируют на открытоугольные глаукомы, если условия хронические, или закрытоугольные глаукомы, если глаукома возникает внезапно. Глаукома обычно поражает оба глаза, но болезнь может прогрессировать быстрее в одном глазу по сравнению с другим.

Хроническая открытоугольная глаукома, также называемая первичной открытоугольной глаукомой, представляет наиболее распространенный тип глаукомы. Хроническая открытоугольная глаукома возникает в результате микроскопической блокады в трабекулярной сети, которая снижает дренаж оттока жидкости в шлемов канал и повышает внутриглазное давление. Первичная открытоугольная глаукома поражает оба глаза и жестко связана с возрастом и с положительным семейным анамнезом. Частота ее возникновения повышается у пожилых людей, поскольку механизм дренажа может постепенно осложняться с возрастом. Повышение внутриглазного давления у субъектов с хронической открытоугольной глаукомой не сопровождается какими либо симптомами до тех пор, пока утрата зрения не ощущается в центральном участке поля зрения.

Острая закрытоугольная глаукома или глаукома закрытого угла представляет относительно редкий тип глаукомы, отличающийся внезапным повышением внутриглазного давления с 35 до 80 мм Hg, приводящим к сильной боли и необратимой утрате зрения. Внезапное повышение давления вызывается закрытием фильтрующего угла и блокадой дренажных каналов. У индивидуумов с узкими углами повышен риск внезапного закрытия угла. Острая закрытоугольная глаукома обычно возникает в одном глазу, но существует риск поражения обоих глаз. Возраст, катаракта и псевдоэксфолиация также представляют факторы риска, поскольку они связаны с укрупнением хрусталика и уплотнением или сужением угла. Внезапное поражение глаукомой может быть связано с сильной болью в глазу и головной болью, воспалением глаза, тошнотой, рвотой и нечетким зрением.

Смешанная глаукома или глаукома комбинированного механизма представляет смесь или комбинацию открытоугольной и закрытоугольной глауком. Она поражает пациентов с острой открытоугольной глаукомой, у которых угол открывается после лазерной иридотомии, но которые продолжают нуждаться в лекарственных средствах для контроля ВГД, подобно пациентам с первичной открытоугольной глаукомой, у которых постепенно наступает сужение угла.

Глаукома с нормальным давлением, также называемая глаукомой, не сопровождающейся повышением внутриглазного давления, глаукомой низкого давления, характеризуется прогрессирующим поражением зрительного нерва и утратой периферийного зрения, схожей с наблюдаемой при других типах глаукомы; однако при этом внутриглазное давление в диапазоне нормы или даже ниже нормы.

Врожденная глаукома (детская глаукома) относительно редкое заболевание, наследуемый тип открытоугольной глаукомы. Недостаточное развитие дренажной области приводит к повышенному давлению в глазу, которое может привести к потере зрения из-за повреждения зрительного нерва и к увеличению глаза. Ранняя диагностика и лечение принципиально важны для сохранения зрения у младенцев и детей с этим заболеванием.

Вторичная глаукома может возникнуть в результате травмы глаза, воспаления радужной оболочки глаза (ирита), диабета, катаракты или применения стероидов индивидами, чувствительными к стероидам. Вторичная глаукома может также быть связана с отслоением сетчатки или с закупоркой или блокадой вен сетчатки.

Пигментная глаукома отличается отслоением гранул пигмента от сетчатки. Гранулы вызывают блокаду дренажной системы глаза, что приводит к повышению внутриглазного давления и повреждению зрительного нерва.

Эксфолиативная глаукома (псевдоэксфолиация) характеризуется отложением хлопьевидного материала на передней капсуле и в углу глаза. Накопление хлопьевидного материала блокирует дренажную систему и повышает глазное давление.

Диагноз глаукомы может быть поставлен при использовании различных тестов. С помощью тонометров определяют давление в глазу по измерению тона или устойчивости поверхности глаза. Для такого теста можно использовать несколько типов тонометра, обычно используют аппланационный тонометр. Батиметрия определяет толщину роговицы, которая в свою очередь соизмерима с глазным давлением. Гониоскопия позволяет исследовать фильтрующий угол и дренажную область глаза. Гониоскопия позволяет также определить, если нарушенное кровяное давление может блокировать отток жидкости из глаза. Офтальмоскопия позволяет исследовать зрительный нерв и может выявить понижение слоя нервных волокон, или изменение в слепом пятне или вдавленность (чашеобразное углубление) этой структуры, которые могут быть вызваны повышенным внутриглазным давлением или выпадением аксонов. Гониоскопию также используют при оценке повреждения нерва при пониженном кровоснабжении или повышенном внутриглазном давлении. Карты тестирования зрительного поля субъективно могут быть представить признаки повреждения зрительного нерва из-за глаукомы. Они отражают характерные признаки потери поля зрения. Оптическую когерентную томографию, позволяющую объективно замерить утрату слоя нервных волокон, проводят путем осмотра толщины слоя волокон зрительного нерва (измененного при глаукоме) по изменению в передаче света через поврежденную ткань аксона.

Старческие бляшки в зрительном нерве и глобулярные конкреции белка и солей кальция, которые предположительно поставляют секреции через врожденно измененные сосудистые структуры, влияющие на слой нервных волокон аксонов. Такие накопления происходят в околососочковом слое нервных волокон и предположительно повреждают слой нервных волокон аксонов, либо прямо путем компрессии, либо косвенно через разрушения снабжения через сосуды к слою нервных волокон. Они обычно становятся видимыми после первой декады жизни пораженных индивидуумов. Они присутствуют в большинстве случаев в обоих глазах, но может также поразить один глаз, и могут вызвать умеренную утрату периферического зрения на протяжении многих лет.

Зрительная невропатия - заболевание, отличающееся повреждением зрительного нерва, вызванным демиелинизацией, блокадой кровоснабжения, недостаточным поступлением питательных веществ или токсинами. Зрительные невропатии с демиелинизацией (см. ниже зрительные невриты) обычно связаны с лежащим в основе процессом демиелинизации, например, рассеянный склероз. Блокада кровоснабжения, называемая ишемической зрительной невропатией, может привести к гибели или дисфункции клеток зрительного нерва. Неартериитная ишемическая зрительная невропатия обычно наблюдается у людей среднего возраста. К факторам риска относятся высокое кровяное давление, диабет и атеросклероз. Артериитная ишемическая зрительная невропатия обычно наблюдается у пожилых людей после воспаления артерий (артериита), особенно височной артерии (височный артериит). Потеря зрения может быть быстрой или развиваться постепенно на протяжении 2-7 суток, при этом может быть поврежден один или оба глаза. У людей со зрительной невропатией, вызванной экспозицией токсином или пищевым голоданием, обычно поражены оба глаза.

Примерно у 40% людей с неартериитной ишемической зрительной невропатией со временем проявляется спонтанное улучшение. Неартериитную ишемическую зрительную невропатию лечат путем контроля кровяного давления, диабета и уровней холестерина. Артериитную ишемическую зрительную невропатию лечат высокими дозами кортикостероидов для предупреждения потери зрения во втором глазу.

Зрительный неврит ассоциирован с умеренной или тяжелой потерей зрения в одном или обоих глазах и может быть вызван системным процессом демиелинизации (см. выше), вирусной инфекцией, вакцинацией, менингитом, сифилисом, рассеянным склерозом и внутриглазным воспалением (увеитом). Движения глаза могут быть болезненны, и зрение может быть повреждено при повторных эпизодах. Диагностика включает оценку реакций зрачков и определение возможной припухлости диска зрительного нерва. Получение изображений методом ядерного магнитного резонанса (ЯМР) может подтвердить рассеянный склероз или, что бывает реже, давление опухоли на зрительный нерв, при этом зрение улучшается при ослаблении давления опухоли. В большинстве случаев зрительный неврит проходит через несколько месяцев при отсутствии лечения. В некоторых случаях может потребоваться лечение внутривенным введением кортикостероидов.

Катаракта представляет помутнение хрусталика или его оболочки. Катаракта обычно вызывает прогрессирующую потерю зрения и при отсутствии лечения может привести к слепоте. При морганиевой катаракте оболочка постепенно разжижается с формированием молочно-белой жидкости и может вызвать тяжелую форму воспаления, если капсула хрусталика разрывается и содержимое подтекает. Без лечения катаракта может также вызвать факоморфическую глаукому. Катаракта может быть наследственной по природе или вызванной генетическими факторами, старением, длительным воздействием ультрафиолета, действием радиации, диабетом, повреждением глаза или физической травмой.

Внекапсулярная хирургия (ЕССЕ) - наиболее эффективное средство лечения катаракты. При хирургическом вмешательстве хрусталик удаляют, но капсула хрусталика в основном сохраняется. Процесс факоэмульсификации - небольшого надрезания роговицы сбоку, обычно используют для разрушения хрусталика перед удалением.

Зрительный амилоидоз - наследственное заболевание, ассоциированное с семейной амилоидозной полиневропатией (Familial Amyloidotic Polyneuropathy - FAP) первого типа и отличающееся нарушенными сосудами конъюнктивы, кератоконъюнктивитной сухостью, пупиллярными нарушениями и в некоторых случаях помутнением стекловидного тела и вторичной глаукомой. FAP первого типа ассоциирована с мутациями в транстиретине, тетрамерном белке плазмы (преальбумине), синтезируемом в печени, пигментном эпителии сетчатки 2 и сосудистом сплетении мозга (thechoroid plexus). Разные мутации индуцируют полимеризацию транстиретина в складчатую структуру амилоидных фибрилл, приводящую к наследственному амилоидозу. Наиболее частой мутацией является мутация TTR-met303, при которой метионин замещен валином в положении 30 транстиретина.

FAP четвертого типа ассоциирована с решетчатой дистрофией роговицы (lattice corneal dystrophy - LCD). Решетчатая дистрофия роговицы представляет наследственный первичный обычно двухсторонний амилоидоз роговицы, для которого характерно наличие преломляющих решетчатых линий с двойным контуром в строме роговицы. LCD первого типа (Biber-Haab-Dimmer) представляет аутосомный доминант, двусторонне симметричное расстройство роговицы, для которого характерно наличие многочисленных полупрозрачных тонких решетчатых линий с белыми точками и слабым помутнением в поверхностных и средних слоях центральной стромы. Симптомы начинают проявляться в течение первой или второй декады жизни, вызывая постепенную потерю зрения. Большинство пациентов нуждается в трансплантации роговицы к сорокалетнему возрасту. LCD второго типа ассоциирована с системным амилоидозом (синдром Меетойя) и отличается наличием тонких решетчатых линий на краю роговицы, в центральной части роговицы и в строме. Зрение не нарушается до наступления старости. LCD третьего типа поражает людей среднего возраста и отличается наличием тонких решетчатых линий, которые тянутся от края до края роговицы. LCD третьего типа отличается накоплением амилоидных отложений в строме и наличием полос амилоида между стромой и слоем Боумана, LCD третьего типа А отличается от LCD третьего типа наличием эрозии роговицы, возникновением белей и аутосомной доминантной наследственной структурой.

Синдром Дауна (СД) или трисомия по 21 хромосоме представляет наиболее распространенное генетическое расстройство, встречающееся примерно с частотой 1 случай на 700 новорожденных, и часто связано с различными нарушениями когнитивных способностей. Это расстройство, вызванное наличием избыточной 21 хромосомы, ассоциировано с ранним отложением формирующего старческие бляшки белка амилоида-бета и развитием болезни Альцгеймера в среднем возрасте. Кроме того, у многих больных с синдромом Дауна развивается катаракта, начинаясь в детском возрасте, причем у многих наблюдают врожденную глаукому. Повышение уровней бета-амилоида при синдроме Дауна может быть следствием повышенной экспрессии и повышенных уровней фермента 2, расщепляющего предшественник белка бета-амилоида, локализованного на хромосоме 21 у людей.

Полностью вылечить глаукому нельзя. К лекарственным средствам для лечения глаукомы относятся агенты, которые снижают выработку водного содержимого глаза, например, бета-блокаторы (Timoptic, Betoptic), ингибиторы карбоангидразы (Trusopt, Azopt) и альфа-агонисты (Alphagan, Iopidine), а также агенты, которые направляют отток водного содержимого из глаза разными путями, например, простагландин (Xalatan). К лазерной хирургии относятся трабекулопластика, процедура, способствующая более эффективному оттоку жидкого содержимого из глаз. По данным Фонда глаукомы примерно 80% пациентов отвечает достаточно хорошо на такую процедуру, которая помогает отсрочить или избежать другого хирургического вмешательства. Однако по данным Национального института зрения (National Eye Institute) давление повышается снова в глазах у половины пациентов в течение двух лет после лазерной хирургии. Инцизионную хирургию проводят, если лечение и первоначальное применение лазера неудачны в плане снижения внутриглазного давления. Один из типов хирургического вмешательства, трабэкулоктомия, вскрывает стенку глаза таким образом, что влага может просачиваться. Однако примерно у трети пациентов после трабэкулоктомии катаракта развивается примерно в течение 5 лет (по данным Фонда глаукомы). Если трабэкулоктомия оказалась неудачной, к дополнительным инцизионным процедурам относятся помещение дренажной трубки в глаз между роговицей и радужкой и применение лазера или заморозки для разрушения ткани глаза, вырабатывающей внутриглазную жидкость. Путем хирургии можно спасти остаточное зрение пациента, но не улучшить зрение. Реально зрение после хирургического вмешательства может стать хуже.

Возрастная дегенерация желтого пятна (Age-related macular degeneration - AMD) является основной причиной слепоты у представителей белой расы старше 65 лет. Хотя ранее был получен значительный прогресс в исследовании дегенерации желтого пятна, нет способов лечения, которые предотвращают гибель нейронов при этом заболевании. Также нет эффективных способов лечения других глазных заболеваний, ассоциированных со связанной с амилоидом-бета деградацией нейронов, например, с кортикальной зрительной недостаточностью, старческими бляшками зрительного нерва, зрительной невропатией, зрительным невритом, зрительным амилоидозом и дистрофией сетчатки.

Следовательно, существует безотлагательная потребность улучшения способов лечения субъектов с глазными заболеваниями, ассоциированными с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированными со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, деградацией нейронов. Указанные патологические изменения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы. Настоящее изобретение соответствует указанной потребности за счет предоставления растворов, которые направлены на процесс, вызывающий глазное заболевание, ассоциированное со связанной с амилоидом-бета деградацией нейронов у субъекта с этим заболеванием.

Помимо этого объекта настоящее изобретение относится к применению антитела по настоящему изобретению и, согласно описанию настоящего изобретения, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, и/или фармацевтическую композицию по настоящему изобретению, или смеси по настоящему изобретению и, согласно описания настоящего изобретения, для приготовления лекарственного средства для лечения или облегчения действия глазных заболеваний, ассоциированных с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические изменения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

В еще одном из вариантов осуществления настоящего изобретения предусмотрена фармацевтическая композиция или смесь по настоящему изобретению и согласно приведенному в нем описанию, включающая антитело по настоящему изобретению, описанное в настоящем изобретении, особенно гуманизированное моноклональное антитело, включая какой-либо функциональный эквивалент антитела или его функциональные части, для использования в лечении или облегчении проявления болезней глаз, ассоциированных с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, деградации нейронов. Указанные патологические изменения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

В другом варианте осуществления настоящего изобретения предусматривают лекарственное средство, включающее гуманизированное моноклональное антитело, в том числе какое-либо функционально эквивалентное антитело или его функциональные части, фармацевтическую композицию или смесь, включающую антитело по настоящему изобретению, и, согласно описанию настоящего изобретения, в терапевтически эффективном количестве для предупреждения, лечения или облегчения проявления болезней глаз, ассоциированных с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, деградации нейронов. Указанные патологические изменения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Одним из объектов настоящего изобретения является способ уменьшения нагрузки старческих бляшек в слое ганглиозных клеток сетчатки субъекта, особенно млекопитающего, но особенно человека с болезнью глаз, ассоциированной с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированной со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, включающий введение субъекту, особенно млекопитающему, более предпочтительно человеку, нуждающемуся в таком лечении, терапевтически эквивалентного количества антитела, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композиции или смеси по настоящему изобретению согласно приведенному описанию. Патологические изменения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

В другом объекте настоящего изобретения гуманизированное моноклональное, антитело используемое в таких способах, является гуманизированным моноклональным антителом С2 или его функциональной частью, описанными в настоящем изобретении. В частности гуманизированное моноклональное антитело получают из мышиного антитела ACI-01-Ab7C2, депонированного 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) по адресу: Braunschweig, Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750. В частности, нагрузка бляшек снижается по меньшей мере на 20%, предпочтительно по меньшей мере на 25%, более предпочтительно по меньшей мере 30%, еще более предпочтительно более чем на 30%.

В качестве другого объекта настоящего изобретения предусмотрен способ понижения количества бляшек в слое ганглиозных клеток сетчатки субъекта, особенно млекопитающего, но особенно человека с глазным заболеванием, ассоциированным с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированным со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, причем указанные патологические нарушения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы, включающий введение субъекту, особенно млекопитающему, более предпочтительно человеку, нуждающемуся в таком лечении, терапевтически эффективного количества антитела, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композиции или смеси по настоящему изобретению, согласно описанию настоящего изобретения. В другом объекте настоящего изобретения гуманизированное моноклональное антитело, применяемое в таких способах, является гуманизированным антителом С2 или его функциональной частью, описанными в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) по адресу: Braunschweig, Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750. В частности количество бляшек в мозге снижается по меньшей мере на 10%, особенно по меньшей мере на 15%, более предпочтительно более чем на 15%.

В еще одном объекте настоящего изобретения предусмотрен способ снижения общего количества растворимого Аβ в слое ганглиозных клеток сетчатки у субъекта, особенно млекопитающего, но особенно человека с глазным заболеванием, ассоциированным с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированным со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, причем указанные патологические нарушения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы, включающий введение субъекту, особенно млекопитающему, более предпочтительно человеку, нуждающемуся в таком лечении, терапевтически эффективного количества антитела, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композиции или смеси по настоящему изобретению, согласно описанию настоящего изобретения. В другом объекте настоящего изобретения гуманизированное моноклональное антитело, применяемое в таких способах, является гуманизированным антителом С2 или его функциональной частью, описанными в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) по адресу: Braunschweig, Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750.

В качестве другого объекта настоящего изобретения предусмотрен способ предупреждения, лечения или облегчения проявлений глазного заболевания, ассоциированного с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированного со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, причем указанные патологические изменения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы, у животного, млекопитающего или человека с глазным заболеванием, ассоциированным со связанной с амилоидом-бета деградацией нейронов, путем введения терапевтически эффективного количества антитела, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композицию или смесь по настоящему изобретению, и, по описанию настоящего изобретения, субъекту, особенно млекопитающему, более предпочтительно человеку, нуждающемуся в таком лечении. В другом объекте настоящего изобретения гуманизированным моноклональным антителом, используемым в настоящих способах, является гуманизированное моноклональное антитело С2 или его функциональная часть согласно описанию в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) по адресу: Braunschweig, Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750.

В другом объекте настоящего изобретения предусмотрен способ диагностики глазного заболевания, ассоциированного с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированными со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, деградацией нейронов, у субъекта, включающий обнаружение иммуноспецифического связывания антитела, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композицию или смесь по настоящему изобретению, и, согласно описанному выше, с эпитопом амилоидного белка в образце или in situ, который включает стадии: а) приведения образца, или специфической части тела, или области тела, предположительно содержащих амилоидный белок, в контакт с антителом по настоящему изобретению, причем антитело связывает конформационный эпитоп амилоидного белка; (б) предоставления возможности для антитела связать какой-либо амилоидный белок с формированием иммунологического комплекса, (в) выявления формирования иммунологического комплекса, особенно таким образом, что наличие или отсутствие иммунологического комплекса коррелирует с наличием или отсутствием амилоидного белка; и (г) корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоидного белка в образце, или определенной части, или области организма. Согласно другому объекту настоящего организма гуманизированное моноклональное антитело, используемое в таких способах, представляет гуманизированное антитело С2 или его функциональные части, описанные в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750.

В другом объекте настоящего изобретения предусмотрен способ диагностики предрасположенности к глазному заболеванию, ассоциированному с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированного со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, у субъекта, включающий обнаружение специфического связывания антитела, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композицию или смесь по настоящему изобретению, и согласно описанию настоящего изобретения, с эпитопом амилоидного белка в образце или in situ, который включает стадии: (а) приведения образца, или специфической части тела, или области тела, предположительно содержащих амилоидный белок, в контакт с антителом, причем антитело связывает конформационный эпитоп амилоидного белка; (б) предоставления возможности для антитела связать какой-либо амилоидный белок в образце с формированием иммунологического комплекса, (в) выявления формирования иммунологического комплекса, (г) корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоидного белка в образце, или определенной части, или области организма, (д) сравнения количества указанного иммунологического комплекса с нормальной контрольной величиной, причем повышение количества комплекса по сравнению с нормальной контрольной величиной показывает, что у субъекта с заболеванием или риском развития заболевания все еще имеется минимальное остаточное глазное заболевание, ассоциированное с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы. В другом объекте настоящего изобретения гуманизированное моноклональное антитело, используемое в таких методах, является гуманизированным антителом С2 или его функциональной частью, описанной в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSMACC2750.

В другом объекте настоящего изобретения предусмотрен способ мониторинга минимального остаточного глазного заболевания, ассоциированного с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированного со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, у субъекта после лечения фармацевтической композицией по настоящему изобретению, причем способ включает: (а) приведения образца, или специфической части тела, или области тела, предположительно содержащих амилоидный белок, в контакт с антителом, особенно гуманизированным моноклональным антителом, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композицией или смесью по настоящему изобретению, и которое описано в настоящем изобретении, причем указанное антитело связывает эпитоп амилоидного белка, (б) предоставления возможности для антитела связать какой-либо амилоидный белок с формированием иммунологического комплекса, (в) выявления формирования иммунологического комплекса, (г) корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоидного белка в образце, или определенной части, или области организма, и (д) сравнения количества указанного иммунологического комплекса с нормальной контрольной величиной, причем повышение количества комплекса по сравнению с нормальной контрольной величиной показывает, что у субъекта все еще имеется минимальное остаточное глазное заболевание, ассоциированное с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы. В другом объекте настоящего изобретения гуманизированное моноклональное антитело, используемое в таких методах, является гуманизированным антителом С2 или его функциональной частью, описанной в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750.

Еще одним объектом настоящего изобретения является способ прогнозирования способности к реагированию субъекта, подвергаемого лечению фармацевтической композицией по настоящему изобретению, включающий стадии: (а) приведения образца, или специфической части тела, или области тела, предположительно содержащих амилоидный белок, в контакт с антителом, особенно гуманизированным моноклональным антителом, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композицией или смесью по настоящему изобретению, и которое описано в настоящем изобретении, причем указанное антитело связывает эпитоп амилоидного белка, (б) предоставления возможности для антитела связать какой-либо амилоидный белок с формированием иммунологического комплекса, (в) выявления формирования иммунологического комплекса, (г) корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоидного белка в образце, или определенной части, или области организма, и (д) сравнения количества указанного иммунологического комплекса до и после начала лечения, причем снижение количества иммунологического комплекса показывает, что субъект обладает большим потенциалом ответа на лечение. В другом объекте настоящего изобретения гуманизированное моноклональное антитело, используемое в таких методах, является гуманизированным антителом С2 или его функциональной частью, описанной в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750.

Другим объектом настоящего изобретения является способ сохранения или повышения глазного давления в глазах субъекта, особенно млекопитающего, более конкретно человека с глазным заболеванием, ассоциированным с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированным со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например деградацией нейронов, причем указанным патологические нарушения могут быть, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы, включающий введение субъекту, особенно млекопитающему, точнее человеку, нуждающемуся в таком лечении, терапевтически эффективного количества антитела, особенно гуманизированного моноклонального антитела, включая какое-либо функционально эквивалентное антитело или его функциональные части, или композицию или смесь по настоящему изобретению, согласно описанию настоящего изобретения. В другом объекте настоящего изобретения гуманизированным моноклональным антителом, используемым в таких методах, является гуманизированное антитело С2 или его функциональная часть, описанные в настоящем изобретении. В частности гуманизированное моноклональное антитело вырабатывают из антитела мыши ACI-01-Ab7C2, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, под номером DSM ACC2750.

Определения

Понятия «полипептид», «пептид» и «белок» в контексте настоящего изобретения взаимозаменяемы и означают биомолекулу, состоящую из аминокислот, связанных пептидными связями.

В контексте настоящего изобретения существительные в единственном числе могут означать «один или несколько» или подразумевать множественное число, если это не противоречит контексту. Понятие «заболевания и расстройства, которые вызываются или которые связаны с амилоидными или амилоидоподобными белками» относится, но ими не ограничивается, к заболеваниям и расстройствам, вызванным наличием или действием амилоидоподобных белков в мономерной, фибрильной или полимерной форме, или какой-либо комбинации всех трех форм. К таким заболеваниям и расстройствам относятся, но ими не ограничиваются, амилоидоз, эндокринные опухоли и другие заболевания, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Фраза «глазные заболевания, ассоциированные с патологическими изменениями/нарушениями в тканях зрительной системы, особенно ассоциированные со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов» относится к патологическим нарушениям, ассоциированным с нарушенной функцией β-амилоида или отложением, приводящем к деградации нейронов, которые могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Понятие «амилоидоз» относится к группе заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая, но ими не ограничиваясь, вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), включая заболевания или состояния, характеризующиеся утратой когнитивного объема памяти, например, умеренное когнитивное нарушение (УКН), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), миозит с включенными тельцами (МВТ), диабет взрослых, старческий кардиальный амилоидоз, и другие заболевания, включая глазные заболевания, связанные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно связанные с амилоид-бета-связанными патологическими нарушениями/изменениями в тканях зрительной системы, например, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Понятия «обнаружение» и «обнаруженный», применяемые в контексте настоящего изобретения, означают применение известных методик для выявления биологических молекул, например, иммунохимических или гистологических методик, и относятся к качественному или количественному определению наличия или концентрации исследуемой биомолекулы

Понятие «полимерный растворимый амилоид» относится к множественным агрегированным мономерам амилоидных пептидов, или амилоидо-подобных пептидов, или модифицированных иди усеченных амилоидных пептидов или других производных амилоидных пептидов, формируя олигомерные или полимерные структуры, которые растворимы в организме млекопитающего иди человека, более предпочтительно в мозге, но особенно относится к множественным агрегированным мономерам амилоида β (Аβ), или модифицированным, или усеченным пептидам амилоида β (Аβ), или их производным, которые растворимы в организме млекопитающего иди человека, более предпочтительно в мозге.

Понятия «амилоид β, Аβ или β-амилоид» представляют известный в данной области термин и относятся к белкам и пептидам амилоида β, белку-предшественнику амилоида β (АРР), а также к модификациям, фрагментам и каким-либо их функциональным эквивалентам. В частности амилоид β в контексте настоящего изобретения означает какой-либо фрагмент, получаемый в результате протеолитического расщепления АРР, но особенно те фрагменты, которые вовлечены или связаны с амилоидными патологиями, включая, но ими не ограничиваясь, Aβ1-38, Aβ1-39, Aβ1-40, Aβ1-411-42 и Aβ1-43.

Структуры и последовательности амилоидных β пептидов, указанных выше, известны специалистам в данной области, а способы получения указанных пептидов или их экстракции из мозга и других тканей описаны, например, в работе Glenner, Wong, Biochem Biophys Res Comm 129, 1984, сс.885-890. Кроме того, амилоидные β пептиды в различных формах также коммерчески доступны.

Понятие «выделенный» означает биологическую молекулу, которая не содержит по меньшей мере некоторые из компонентов, с которыми такая молекула естественным образом соприкасается.

Понятия «антитело» или «антитела» в контексте настоящего изобретения являются известными в данной области терминами и означают молекулы или действующие фрагменты молекул, которые связываются с известными антигенами, особенно молекулы иммуноглобулина, и иммунологически действующие части молекул иммуноглобулина, т.е. молекул, которые содержат сайт связывания, который специфически связывает антиген. Иммуноглобулин является белком, включающим один или несколько полипептидов, которые в основном кодируются генами константных областей иммуноглобулина каппа и лямбда, альфа, гамма, дельта, эпсилон и мю, а также генами бесчисленного количества вариабельных областей иммуноглобулина. Легкие цепи классифицируют на каппа или лямбда. Тяжелые цепи классифицируют на гамма, мю, альфа, дельта или эпсилон, которые в свою очередь характеризуют классы иммуноглобулина IgG, IgM, IgA, IgD и IgE, соответственно. Также известны подклассы тяжелой цепи. Например, тяжелые цепи IgG у человека могут принадлежать к какому-либо из подклассов IgG1, IgG2, IgG3 и IgG4. Иммуноглобулин по настоящему изобретению может принадлежать к какому-либо классу (IgG, IgM, IgD, IgE, IgA и IgY), или подклассу (IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) молекул иммуноглобулинов.

В контексте настоящего изобретения фраза «специфически связывает» относится к антителу и означает, что антитело связывается с антигеном-мишенью, к которому обладает большим сродством по сравнению со сродством к структурно отличному антигену (антигенам).

Известно, что типичная структура иммуноглобулина представляет тетрамер. Каждый тетрамер состоит из двух идентичных пар полипептидных цепей, причем каждая пара содержит одну «легкую» (примерно 25 кДа) и одну «тяжелую» цепь (примерно 50-70 кДа). N-конец каждой цепи означает вариабельную область примерно из 100-110 аминокислот, в основном ответственную за распознавание антигена. Понятия вариабельная легкая цепь (VL) и вариабельная тяжелая цепь (VH) относятся к легкой и тяжелой цепи, соответственно.

Антитела представляют интактные антитела полной длины или ряд хорошо охарактеризованных фрагментов, вырабатываемых расщеплением различными пептидазами или химическими реагентами. Например, пепсин расщепляет антитело ниже дисульфидных связей в шарнирной области для формирования F(ab')2, представляющего димер Fab, который сам означает легкую цепь, соединенную с VH-CH1 дисульфидной связью. Фрагмент F(ab')2 может быть редуцирован в мягких условиях для разрушения дисульфидной связи в шарнирной области, тем самым конвертируя димер F(ab')2 в мономер Fab'. Мономер Fab' в основном представляет фрагмент Fab с частью шарнирной области (см. кн.: «Fundamental Immunology», 1993, под ред. W. E. Paul, изд-во Raven Press, Нью-Йорк, с более подробным описанием других фрагментов антител). Хотя различные фрагменты антител выражены в понятиях расщепления интактного антитела, специалисту очевидно, что какой-либо из различных фрагментов антител может быть синтезирован de novo или химически, или методом рекомбинантной ДНК. Таким образом, понятие антитела, используемое в настоящем изобретении, также включает фрагменты антитела, либо полученные путем модификации целых антител, либо синтезированные de novo, или антитела и фрагменты, полученные с помощью применения методик рекомбинации ДНК.

«Антитела», подпадающие под рамки охвата настоящего изобретения, включают моноклональные антитела, поликлональные антитела, химерные антитела, одноцепочечные, двухвалентные, симинизированные, антитела человека и гуманизированные антитела, а также их действующие фрагменты. К примерам действующих фрагментов молекул, которые связываются с известными антигенами, относятся разделенные легкие и тяжелые цепи, фрагменты Fab, Fab/c, Fv, Fab' и F(ab')2, включая продукты библиотеки экспрессии Fab иммуноглобулинов и эпитоп-связывающие фрагменты какого-либо антитела и фрагментов, указанных выше.

Такие действующие фрагменты могут быть получены из антитела по настоящему изобретению с помощью ряда методик. Например, моноклональные антитела могут быть расщеплены ферментом, например, пепсином, и подвергнуты HPLC гель фильтрации. Соответствующая фракция, содержащая фрагменты Fab, затем может быть собрана и сконцентрирована мембранной фильтрацией и прочее. Дальнейшее описание основных методик по выделению действующих фрагментов антител см. в публикациях Khaw В. А. и др., J. Nucl. Med. 23, 1982, cc.1011-1019; Rousseaux и др. Methods Enzymology, 121, 1986, изд. Academic Press, cc.663-669.

Рекомбинантно полученные антитела могут быть антителами обычной полной длины, действующими фрагментами антитела, получаемыми в результате протеолитического расщепления, уникальными фрагментами действующего антитела, например, фрагментом Fv или одноцепочечным фрагментом Fv (single chain Fv - scFv), антителом с делегированным доменом и другими. Фрагмент Fv антитела имеет размер примерно 50 кДа и включает вариабельные области легкой и тяжелой цепи. Одноцепочечный полипептид Fv (single chain Fv - scFv) является ковалентно связанным гетеродимером VH::VL, который может быть экспрессирован с нуклеиновой кислоты, включая VH- и VL-кодирующие последовательности, соединенные непосредственно или через пептид-кодирующий линкер. См. Huston и др. Proc. Nat. Acad. Sci. USA, 85, 1988, cc.5879-5883. Ряд структур для конверсии природно агрегированных, но химически разделенных легкой и тяжелой цепей полипептида от области V антитела в молекулу scFv, которая может сложиться в трехмерную структуру, существенным образом близкую к структуре сайта связывания антигена. См., например, US 5091513, 5132405 и 4956778.

Комбинированный сайт относится к части молекулы антитела, которая участвует в связывании антигена. Сайт связывания антигена сформирован аминокислотными остатками N-концевых вариабельных (variable - V) областей тяжелой (heavy - Н) и легкой (light - L) цепей. Вариабельные области антитела включают три в высокой степени дивергентных отрезка, называемых «гипервариабельными областями» или «комплементарно детерминируемыми областями (complementarity determining region - CDR)», которые размещены между более консервативными фланкирующими отрезками, называемыми «каркасными участками (framework regions - FR)». В молекуле антитела три гипервариабельных области легкой цепи (LCDR1, LCDR2 и LCDR3) и три гипервариабельных области тяжелой цепи (HCDR1, HCDR2 и HCDR3) расположены относительно друг друга в трехмерном пространстве для формирования поверхности или кармана связывания антигена. Следовательно, сайт комбинирования антитела представляет аминокислоты, которые составляют области CDR антитела, и какие-либо остатки каркасного участка, которые составляют карман сайта связывания.

Идентичность аминокислотных остатков в определенном антителе, которые составляют комбинируемый сайт, может быть определена известными в данной области методами. Например, области CDR антитела могут быть идентифицированы в качестве гипервариабельных областей, первоначально определенных Kabat и др. (см. кн.: Е. Kabat и др. «Sequences of Proteins of Immunological Interest», изд-во Министерства здравоохранения и социального обеспечения США, Johnson G., Wu Т.Т. Nucleic Acids Research, 29, 2001, cc.205-206, http://immuno.bme.nwa.edu). Положения областей CDR также могут быть идентифицированы в качестве петлевидных структур, изначально описанных Chothia и др. (см. Chothia, Lesk, J. Mol. Biol. 196, 1987, с.901, Chothia и др., Nature 342, 1989, с.877, Tramontane и др., J. Mol. Biol. 215, 1990, с.175). К другим способам относится «определение AbM», которое представляет компромисс между определениями Kabat и Chothia и получается в результате применения компьютерной программы моделирования антитела Oxford Molecular's AbM (которая в настоящее время обозначается «Accelrys») или «определение контакта» CDR по Macallum и др. (J Mol Biol., 262(5), 1996, cc.732-45). Приводимая ниже схема идентифицирует области CDR по разным известным системам идентификации.

Loop Kabat AbM Chothia Contact
- - - - -
L1 L24 -- L34 L24 -- L34 L24 -- L34 L30 -- L36
L2 L50 -- L56 L50 -- L56 L50 -- L56 L46 -- L55
L3 L89 -- L97 L89 -- L97 L89 -- L97 L89 -- L96
H1 (нумерация по Kabat) Н31 -- Н35В Н26 -- Н35В Н26 -- Н32..34 Н30 -- Н35В
H1 (нумерация по Chothia) Н31 -- Н35 Н26 -- Н35 Н26 -- Н32 Н30 -- Н35
Н2 Н50 -- Н65 Н50 -- Н58 Н52 -- Н56 Н47 -- Н58
Н3 Н95 -- Н102 Н95 -- Н102 Н95 -- Н102 Н93 -- Н101

Общепринятыми руководящими принципами, с помощью которых можно идентифицировать области CDR в антителе только из одной последовательности, являются следующие:

LCDR1:

Старт - примерно остаток 24.

Остатком впереди всегда является Cys.

Остатком сзади всегда является Trp. Обычно за TRP следует TYR-GLN, но также может следовать LEU-GLN, PHE-GLN или TYR-LEU.

Длина составляет 10-17 остатков.

LCDR2:

Старт - 16 остатков после конца L1.

Последовательностью впереди обычно является ILE-TYR, но также могут быть VAL-TYR, ILE-LYS или ILE-PHE.

Полная длина состоит из 7 остатков.

LCDR3:

Старт - обычно 33 остатка после конца L2.

Остатком впереди является Cys.

Последовательностью после является PHE-GLY-X-GLY.

Длина составляет 7-11 остатков.

HCDR1:

Старт - примерно с остатка 26 (четыре остатка после CYS) [Chothia / AbM определение]

Старт по Kabat - на пять остатков позже.

Последовательностью впереди является CYS-X-X-X.

Остатком после является TRP, обычно затем следует VAL, но также может быть ILE или ALA.

Длина составляет 10-12 остатков по определению AbM, хотя по определению Chothia исключены последние 4 остатка.

HCDR2:

Старт - 15 остатков после конца по определению Kabat /AbM последовательности CDR-H1.

Последовательностью впереди обычно является LEU-GLU-TRP-ILE-GLY (SEQ ID NO. 1), но также возможен ряд вариаций.

Последовательностью после является LYS/ARG-LEU/ILE/VAL/PHE/THR/ALA-THR/SER/ILE/ALA

Длина составляет 16-19 остатков по определению Kabat (по определению AbM короче на 7 остатков).

HCDR3:

Старт - 33 остатка после конца CDR-H2 (два остатка после CYS).

Последовательность впереди: CYS-X-X (обычно CYS-ALA-ARG).

Последовательность после: TRP-GLY-X-GLY.

Длина составляет 3-25 остатков.

Идентичность аминокислотных остатков в определенном антителе, которые находятся за пределами областей CDR, но, несмотря на это, составляют часть сайта комбинирования за счет боковой цепи, которая является частью сайта комбинирования (т.е. возможна связь через сайт комбинирования), может быть определена, используя способы, известные в данной области, например, метод молекулярного моделирования и рентгенокристаллографии. См., например, Riechmann и др., Nature, 332, 1988, cc.323-327.

Химерными являются антитела, у которых одна или несколько областей антитела происходят от одного вида животного и одна или несколько областей происходят от другого вида животного. Предпочтительное химерное антитело является антителом, которое включает области от иммуноглобулина примата. Обычно известно, что химерное антитело для клинического применения людьми содержит вариабельные области от животного (но не от человека), например, от грызуна, вместе с константными областями от человека. Напротив, гуманизированное антитело содержит области CDR от антитела, не от человека, с большинством или со всеми вариабельными каркасными участками от всех константных областей от иммуноглобулина человека. Обычно известно, что химерное антитело человека содержит вариабельные области от грызуна. Типичное химерное антитело человека содержит константные области тяжелой цепи человека и константные области легкой цепи человека с вариабельными областями и тяжелой, и легкой цепи, полученной от антитела грызуна. Химерное антитело может включать некоторые изменения в нативной аминокислотной последовательности константных областей человека и последовательности нативной вариабельной области грызуна. Химерное и гуманизированное антитела могут быть получены методами, известными в данной области, включая подходы к пересадке CDR (см., например, US 5843708, 6180370, 5693762, 5585089, 5530101), стратегию перетасовки цепи (см., например, US 5565332, Rader и др., Proc. Natl. Acad. Sci. USA (1998) 95:8910-8915), стратегии молекулярного моделирования (US 5639641) и др.

В контексте настоящего изобретения понятие «гуманизированное антитело», используемое в случае двух цепей человека, означает, что по меньшей мере одна цепь гуманизирована. Цепь гуманизированного антитела содержит вариабельную область, в которой один или несколько каркасных участков происходят от человека. Гуманизированное антитело, являющееся одноцепочечным, представляет антитело, в котором цепь имеет вариабельную область, в которой один или несколько каркасных участков происходят от человека. Части вариабельной области, происходящие не от человека, цепи гуманизированного антитела или его фрагмента происходят не от человека, а обычно от грызуна. Вклад в гуманизированное антитело, происходящий не от человека, обычно предусмотрен в форме по меньшей мере одной области CDR, которая рассеяна среди каркасных участков, происходящих от одного (или нескольких) иммуноглобулинов человека. Кроме того, поддерживающие каркасные участки остатки могут быть изменены для сохранения связывающего сродства.

Гуманизированное антитело может дополнительно включать константные области (например, по меньшей мере одну константную область или ее часть в случае легкой цепи, и предпочтительно три константные области в случае тяжелой цепи). Если имеются константные области гуманизированного антитела, они обычно происходят от человека.

Способы получения «гуманизированного антитела» известны специалистам в данной области. (См., например. Queen и др., Proc. Natl Acad Sci USA, 86, 1989, cc.10029-10032, Hodgson и др., Bio/Technology, 9, 1991, с.421).

«Гуманизированное антитело» может также быть получено с помощью нового генно-инженерного подхода, который позволяет получать поликлональные антитела типа антител человека со сформировавшимся сродством у многих животных, например, кроликов и мышей (см., например, US 6632976).

Понятие «константная область» (constant region - CR) в контексте настоящего изобретения относится к генам константных областей иммуноглобулина. Гены константной области кодируют часть молекулы антитела, которая обусловливает эффекторные функции. Для химерных антител человека и гуманизированных антител, обычно не от человека (например, от мыши), константные области замещены константными областями человека. Константные области химерных или гуманизированных антител субъекта обычно происходят от иммуноглобулинов человека. Константная область тяжелой цепи может быть выбрана из какого-либо из пяти изотипов: альфа, дельта, эпсилон, гамма или мю. Кроме того, тяжелые цепи различных подклассов (например, подклассов тяжелых цепей подклассов IgG) ответственны за разные эффекторные функции и, таким образом, путем выбора определенной требуемой константной области тяжелой цепи, могут быть получены антитела с определенной эффекторной функцией. Константными областями, которые могут применяться в рамках охвата настоящего изобретения, являются гамма 1 (IgG1), особенно Fc областью гамма 1 (IgG1) изотипа, гамма 3 (IgG3) и особенно гамма 4 (IgG4). Константная область легкой цепи может быть типа каппа или лямбда, предпочтительно типа каппа. В одном из вариантов осуществления настоящего изобретения константная область легкой цепи является константной цепью каппа человека (Heiter и др., Cell 22, 1980, cc.197-207) и тяжелая константная цепь является константной цепью IgG4 человека.

Понятие «область Fc» используют для определения C-концевой области тяжелой цепи иммуноглобулина. Понятие «область Fc» может относиться к нативной последовательности области Fc или варианта области Fc. Хотя границы области Fc тяжелой цепи иммуноглобулина могут варьировать, область Fc тяжелой цепи IgG человека обычно определяют в качестве отрезка от аминокислотного остатка в положении Cys226, или от Pro230 и до его С-конца. Область Fc иммуноглобулина обычно включает два константных домена, СН2 и СН3.

«Функциональная область Fc» обладает «эффекторной функцией» области Fc нативной последовательности. К примерам «эффекторной функции» относятся связывание C1q, комплементарно детерминируемая цитотоксичность, связывание рецептора Fc, антителозависимая клеточно опосредованная цитотоксичность (antibody-dependent cell-mediated cytotoxicity - ADCC), фагоцитоз, пониженная регуляция рецепторов на поверхности клеток (например, рецептора В клеток - В cell receptor (BCR)) и др. Такие эффекторные функции обычно нуждаются в том, чтобы область Fc была скомбинирована со связывающим доменом (например, вариабельным доменом антитела) и могут быть оценены, используя различные методы анализа, описанные в настоящем изобретении. Функциональная область Fc обычно включает две тяжелые цепи СН2 и СН3, содержащие полипептиды, находящиеся в связи.

«Область нативной последовательности Fc» включает аминокислотную последовательность, идентичную аминокислотной последовательности области Fc, обнаруженной в ее природных вариантах.

«Вариант области Fc» включает аминокислотную последовательность, которая отличается от аминокислотной последовательности нативной последовательности области Fc на основании по меньшей мере одной «аминокислотной модификации», согласно описанию настоящего изобретения. Предпочтительно вариант области Fc содержит по меньшей мере одно аминокислотное замещение по сравнению с нативной последовательностью области Fc или с областью Fc исходного полипептида, например, примерно от одной до примерно десяти замещенных аминокислот, предпочтительно примерно от пяти аминокислотных замещений в нативной последовательности области Fc или в области Fc исходного полипептида. Вариант области Fc в контексте настоящего изобретения может предпочтительно обеспечивать по меньшей мере примерно 80% гомологии с областью нативной последовательности Fc и/или областью Fc исходного полипептида, и наиболее предпочтительно по меньшей мере примерно 90% гомологии с нею, более предпочтительно по меньшей мере примерно 95% гомологии с нею.

Понятие «аминокислотной модификации» относится к изменению аминокислотной последовательности предопределенной аминокислотной последовательности. К примерам модификаций относятся аминокислотные замещения, инсерции и/или делеции. Предпочтительная аминокислотная модификация в контексте настоящего изобретения является замещением.

«Аминокислотная модификация по определенному положению», например в области Fc, относится к замещению или делеции определенного остатка, или к инсерции по меньшей мере одного аминокислотного остатка, смежного с определенным остаткам. Инсерция определенного «смежного» остатка означает инсерцию одного или двух остатков. Инсерция может быть N-концевой или C-концевой применительно к определенному остатку.

«Аминокислотное замещение» относится к замещению по меньшей мере одного имеющегося аминокислотного остатка в предварительно определенной аминокислотной последовательности другим отличным «замещенным» аминокислотным остатком. Замещенный остаток (остатки) может быть «природным аминокислотным остатком» (т.е. кодированным генетическим кодом) и выбранным из группы, состоящей из: аланина (Ala), аргинина (Arg), аспарагина (Asn), аспарагиновой кислоты (Asp), цистеина (Cys), глутамина (Gln), глутаминовой кислоты (Glu), глицина (Gly), гистидина (His), изолейцина (Ile), лейцина (Leu), лизина (Lys), метионина (Met), фенилаланина (Phe), пролина (Pro), серина (Ser), треонина (Thr), триптофана (Trp), тирозина (Tyr) и валина (Val). Предпочтительно замещенный остаток не является цистеином. Замещение одного или нескольких неприродных аминокислотных остатков также относится к понятию аминокислотного замещения в контексте настоящего изобретения.

Понятие «неприродного аминокислотного остатка» относится к остатку, отличному от перечисленных выше аминокислотных остатков, которые могут ковалентно связывать смежные аминокислотные остатки (остаток) в полипептидной цепи. К примерам неприродных аминокислотных остатков относятся норлейцин, омитин, норвалин, гомосерин и другие аминокислотные остатки, аналогичные описанным Ellman и др., Meth. Enzym. 202, 1991, cc.301-336. Для выработки таких неприродных аминокислотных остатков может быть использована методика Noren и др. Science 244, 1989, с.182, и Ellman и др., указанная выше. Вкратце, такие методики представляют химическое активирование супрессорной тРНК с остатком неприродной аминокислоты с последующей транскрипцией и трансляцией РНК in vitro.

Понятие «аминокислотные инсерции» относится к включению по меньшей мере одной аминокислоты в заранее определенную аминокислотную последовательность. Хотя инсерция обычно состоит из инсерции одного или двух аминокислотных остатков, в настоящем изобретении рассматриваются более крупные «пептидные инсерции», например, инсерция примерно из 3-5 и до 10 аминокислотных остатков. Инсертированные остатки (остаток) могут быть природными и неприродными, описанными выше.

Понятие «аминокислотной делеции» относится к удалению по меньшей мере одного аминокислотного остатка из заранее сформированной аминокислотной последовательности.

Понятие «антителозависимой клеточно опосредованной цитотоксичности (ADCC)» относится к форме цитотоксичности, при которой секретированное антитело связано с антигеном-мишенью, экспрессированным клетками-мишенями, распознается рецепторами Fc (FcR), присутствующими на определенных цитотоксических клетках (например, клетках природных киллерах - Natural Killer (NK), нейтрофилах и макрофагах), благодаря которым эти цитотоксические эффекторные клетки специфически связываются для распознавания покрытых антителом клеток-мишеней и в результате убивают клетки-мишени цитотоксинами. Первичные клетки для опосредования ADCC, клетки NK, экспрессируют только Fc.gamma.RIII, поскольку моноциты экспрессируют Fc.gamma.RI, Fc.gamma.RII и Fc.gamma.RIII. Экспрессия FcR на гематопоэтических клетках суммирована в табл.3 на с.464 в статье Ravetch, Kinet, Annu. Rev. Immunol 9, 1991, cc.457-492. Для оценки действия ADCC исследуемой молекулы может быть проведен анализ ADCC in vitro, например, описанный в US 5500362 или 5821337. К соответствующим эффекторным клеткам для такого анализа относятся мононуклеарные клетки периферической крови (МКПК) и клетки киллеры (NK). В другом варианте или дополнительно действие ADCC исследуемой молекулы может быть оценено in vivo, например, в животной модели, например, описанной Clynes и др. PNAS (USA) 95, 1998, cc.652-656.

«Иммунными эффекторными клетками» являются лейкоциты, которые экспрессируют один или несколько FcR и осуществляют эффекторные функции. Предпочтительно клетки экспрессируют по меньшей мере Fc.gamma.RIII и осуществляют эффекторную функцию ADCC. К примерам лейкоцитов человека, которые опосредуют ADCC, относятся мононуклеарные клетки периферической крови (МКПК), природные клетки киллеры (NK), моноциты, цитотоксические Т-клетки и нейтрофилы, предпочтительно клетки МКПК и NK. Эффекторные клетки могут быть выделены из нативного источника, например, из крови или МКПК, согласно описанию в контексте настоящего изобретения.

«Комплементзависимая цитотоксичность (CDC)» относится к комплементзависимому лизису клеток-мишеней, который связан с реактивностью антитела, антиген которого экспрессируется клетками-мишенями. Активация классического метаболического пути комплемента инициируется связыванием первого компонента системы комплемента (C1q) с антителами (соответствующего подкласса), которые связаны с их родственным антигеном. Для оценки активации комплемента может быть проведено исследование CDC, например, описанное Gazzano-Santoro и др., J. Immunol. Methods 202, 1996, с.163.

Полипептидом с вариантом IgG Fc с «измененным» FcR связывающим сродством или ADCC действием является полипептид, который имеет либо повышенное, либо пониженное FcR связывающее действие (Fc.gamma.R или FcRn) и/или ADCC действие по сравнению с исходным полипептидом или полипептидом, включающим область Fc нативной последовательности. Вариант Fc, который «проявляет повышенное связывание» с FcR, связывает по меньшей мере один рецептор FcR с повышенным сродством по сравнению с исходным полипептидом. Улучшение связывания по сравнению с исходным полипептидом может быть примерно в 3 раза, предпочтительно примерно в 5, 10, 25, 50, 60, 100, 150, 200 и до 500 раз или примерно от 25% до 1000%. Вариант полипептида, который «проявляет пониженное связывание» с FcR, связывает по меньшей мере один рецептор FcR с ухудшенным сродством по сравнению с исходным полипептидом. Снижение связывания по сравнению с исходным полипептидом может составлять примерно 40% или быть еще ниже. Такие варианты Fc, которые проявляют пониженное связывание с FcR, могут обладать малым или неприемлемым связыванием с FcR, например, 0-20% связыванием с FcR по сравнению с областью Fc нативной последовательности IgG, например, связыванием, описанным ниже в примерах.

Полипептид, включающий вариант области Fc, который «проявляет повышенную цитотоксичность ADCC» или опосредует антителозависимую клеточно опосредованную цитотоксичность (ADCC) в присутствии эффекторных клеток человека более эффективно по сравнению с полипептидом, имеющим Fc IgG дикого типа, является полипептидом, который in vitro или in vivo существенно более эффективен в опосредовании ADCC, если количества полипептида с вариантом области Fc и полипептида с вариантом области Fc дикого типа, использованных в анализе, существенно те же (все другие факторы равноценны). Обычно такие варианты могут быть идентифицированы, используя анализ ADCC in vitro, но также рассматриваются другие анализы или методы определения действия ADCC, например, в животной модели, и др. Предпочтительный вариант более эффективен в опосредовании ADCC примерно в 5-100 раз, например, примерно в 25-50, по сравнению с Fc дикого типа.

Понятие «моноклональное антитело» также известно в данной области и относится к антителу, являющемуся продуктом одной клонированной клетки, вырабатывающей антитело. Моноклональное антитела обычно получают путем гибридизации нормально короткоживущих антитело-продуцирующих В-клеток с быстрорастущими клетками, например раковыми клетками (иногда называемыми «бессмертными» клетками). Образуемые гибридные клетки, или гибридомы, быстро размножаются, создавая клон, который вырабатывает антитело.

Для цели настоящего изобретения понятие «моноклональное антитело» также подразумевает антитела, которые вырабатываются материнским клоном, который еще не достиг полной моноклональности. Понятие «функционально эквивалентное антитело» в рамках охвата настоящего изобретения относится к антителу, которое существенным образом разделяет по меньшей мере одно важное функциональное свойство с указанным выше антителом, и в контексте настоящего изобретения включает: связывающую специфичность в отношении β-амилоидного белка, особенно Aβ1-42 белка, и более конкретно в отношении области эпитопа 4-16 белка Aβ1-42, иммунореактивность in vitro, подавление агрегирования мономеров Aβ1-42 в высокомолекулярные полимерные фибриллы и/или дезагрегирования заранее сформированных полимерных фибрилл Aβ1-42, и/или свойство разрушения β-слоя и облегчения проявлений заболеваний и расстройств, которые связаны с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, например, заболевания, включающие, но ими не ограничивающиеся, нейрологические расстройства, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы, при профилактическом или терапевтическом введении. Антитела могут относиться к какому-либо классу, например, IgG, IgM, or IgA и др. или какому-либо подклассу, например, IgG1, IgG2a и др., и другим подклассам, описанным в настоящем изобретении или известным в данной области, но особенно к классу IgG4. Кроме того, антитела могут быть получены каким-либо способом, например, фаговым дисплеем, или могут быть получены в каком-либо организме или линии клеток, включая бактерий, насекомых, млекопитающих, или клеток или линии клеток другого типа, которые вырабатывают антитела с определенными свойствами, например, гуманизированные антитела. Антитела могут также быть получены комбинированием части Fab и области Fc от разных видов.

Понятие «гибридизировать» в контексте настоящего изобретения относится к обычным условиям гибридизации, предпочтительно к условиям гибридизации, к которым относятся 5 × SSPE, 1% SDS, 1 × раствор Денхардта, который используют в качестве раствора, и/или температуры гибридизации, находящиеся в интервале от 35°С до 70°С, предпочтительно 65°С. После гибридизации промывание предпочтительно проводят сначала с помощью 2 × SSC, 1% SDS и затем с помощью 0,2 × SSC при температуре от 35°С до 70°С, предпочтительно при 65°С (расшифровку SSPE, SSC и раствора Денхардта см. в статье Sambrook и др., приведенной выше). Условия жесткой гибридизации, например, описанные Sambrook и др., см. выше, являются особенно предпочтительными. Особенно предпочтительные условия жесткой гибридизации, например, применяют, если гибридизацию и промывку проводят при 65°С согласно указанному выше. Условия гибридизации, не являющиеся жесткими, например, с гибридизацией и промывкой, проводящимися при 45°С или меньше, предпочтительно при 35°С или меньше.

«Гомологию» между двумя последовательностями определяют по идентичности последовательностей. Если две сравниваемые друг с другом последовательности отличаются по длине, идентичность последовательностей предпочтительно относится к проценту нуклеотидных остатков более короткой последовательности, которая идентична нуклеотидным остаткам более длинной последовательности. Идентичность последовательности обычно может быть определена с применением компьютерных программ, например, программы Bestfit (Wisconsin Sequence Analysis Package, версия 8 для Unix, фирма Genetics Computer Group по адресу: University Research Park, 575 Science Drive Madison, WI 53711). Программа Bestfit использует алгоритм гомологии Smith и Waterman, Advances in Applied Mathematics 2, 1981, cc.482-489, чтобы установить сегмент, имеющий самую высокую идентичность двух последовательностей. При использовании программы Bestfit или другой программы выравнивания последовательностей для определения, может ли определенная последовательность иметь, например, 95% идентичности с референсной последовательностью по настоящему изобретению, параметры предпочтительно так подобраны, что процент идентичности рассчитывают по всей длине референсной последовательности, и что допустимы гомологичные гэпы до 5% от общего числа нуклеотидов в референсной последовательности. При использовании программы Bestfit так называемые необязательные параметры предпочтительно оставляют в их заранее установленных («по умолчанию») величинах. Отклонения, проявляемые при сравнении определенной последовательности с описанными выше последовательностями по настоящему изобретению, могут быть вызваны, например, путем добавления, делеции, замещения, инсерции или рекомбинации. Такое сравнение последовательностей предпочтительно также может выполняться по программе «fasta20u66» (версия 2.0u66, сентябрь 1998, предложена William R. Pearson и Университетом Вирджинии, см. также W.R. Pearson, Methods in Enzymology 183, 1990, cc.63-98, приводимые в настоящем изобретении примеры и сайт http://workbench.sdsc.edu/). Для этой цели могут быть применены установки «параметров по умолчанию».

Антитело по настоящему изобретению может быть иммуноглобином или антителом, о котором известно, что оно имеет каждый из сайтов связывания, который идентичен (при поливалентности), или, в другом варианте, может быть «биспецифичным» или «бифункциональным» антителом.

«Биспецифичное» или «бифункциональное антитело» является искусственным гибридным антителом, имеющим две разные пары тяжелой/легкой цепей и два разных сайта связывания. Биспецифичные антитела могут быть получены различными способами, включая гибридизацию гибридом или связывание фрагментов Fab'. См., например, Songsivilai, Lachmann, Clin. Exp. Immunol. 79, 1990, cc.315-321; Kostelny и др., J. Immunol. 148, 1992, cc.1547-1553.

Понятие «фрагмент» относится к части или порции антитела или цепи антитела, включающей несколько аминокислотных остатков по сравнению с интактным или полным антителом или цепочкой антитела. Фрагменты могут быть получены путем химической и ферментативной обработки интактного полного антитела или цепочки антитела. Фрагменты также могут быть получены методами рекомбинации. К примерам фрагментов относятся фрагменты Fab, Fab', F(ab')2, Fabc и/или Fv. Понятие «антигенсвязывающий фрагмент» относится к фрагменту полипептида иммуноглобулина или антитела, которое связывает антиген или конкурирует с интактным антителом (т.е., с интактным антителом, от которого они происходят) за связывание антигена (т.е., специфическое связывание).

Связывающие фрагменты получают методами рекомбинации ДНК или ферментативным или химическим расщеплением интактных иммуноглобулинов. Связывающие фрагменты включают Fab, Fab', F(ab')2, Fabc, Fv, отдельные цепи и одноцепочечные антитела.

Понятие «фрагмент» также относится к пептиду или полипептиду, включающему аминокислотную последовательность, состоящую по меньшей мере из 5 подряд расположенных аминокислотных остатков, по меньшей мере 10 подряд расположенных аминокислотных остатков, по меньшей мере 15 подряд расположенных аминокислотных остатков, по меньшей мере 20 подряд расположенных аминокислотных остатков, по меньшей мере 25 подряд расположенных аминокислотных остатков, по меньшей мере 40 подряд расположенных аминокислотных остатков, по меньшей мере 50 подряд расположенных аминокислотных остатков, по меньшей мере 60 подряд расположенных аминокислотных остатков, по меньшей мере 70 подряд расположенных аминокислотных остатков, по меньшей мере 80 подряд расположенных аминокислотных остатков, по меньшей мере 90 подряд расположенных аминокислотных остатков, по меньшей мере 100 подряд расположенных аминокислотных остатков, по меньшей мере 125 подряд расположенных аминокислотных остатков, по меньшей мере 150 подряд расположенных аминокислотных остатков, по меньшей мере 175 подряд расположенных аминокислотных остатков, по меньшей мере 200 подряд расположенных аминокислотных остатков, или по меньшей мере 250 подряд расположенных аминокислотных остатков аминокислотной последовательности другого полипептида. В другом варианте осуществления настоящего изобретения фрагмент полипептида сохраняет по меньшей мере одну функцию полипептида.

Понятие «антиген» относится к целому соединению или к его фрагменту, способному связываться с антителом. Иммуноген относится к антигену, который может вызвать в организме иммунный ответ, особенно у животного, более предпочтительно у млекопитающего, включая человека. Понятие «антиген» включает области, известные в качестве антигенных детерминантов или эпитопов, которые относятся к части антигена и контактируют или играют важную роль в поддержании контактного остатка в антигене, ответственном за антигенность, или антигенных детерминантах.

В контексте настоящего изобретения понятие «растворимый» означает частичную или полную растворимость в водном растворе.

Также в контексте настоящего изобретения понятие «иммуногенный» относится к веществам, которые вызывают выработку антитела, Т-клеток и реактивных иммунных клеток, направленных против антигена иммуногена.

Иммунный ответ происходит, когда индивидуум производит достаточное количество антител, Т-клеток и других реактивных иммунных клеток против введенных иммуногенных композиций настоящего изобретения для ослабления или облегчения расстройства, подвергаемого лечению.

Понятие «иммуногенности» в контексте настоящего изобретения относится к измерению способности антигена вызывать иммунный ответ (гуморальный или клеточный) при введении реципиенту. Настоящее изобретение относится к подходам, которые снижают иммуногенность химерных или гуманизированных антител человека у субъекта.

Гуманизированное антитело с пониженной иммуногенностью относится к гуманизированному антителу, проявляющему пониженную иммуногенность относительно родительского антитела, например, антитела мыши.

Гуманизированное антитело, которое в существенной степени сохраняет связывающие свойства родительского антитела, относится к гуманизированному антителу, которое сохраняет способность специфически связывать антиген, распознаваемый исходным антителом, которое используют для получения такого гуманизированного антитела. Предпочтительно гуманизированное антитело может проявлять те же или в существенной степени те же антигенсвязывающее сродство и авидность, что и исходное антитело. В идеале сродство антитела может быть не менее 10% от сродства исходного антитела, более предпочтительно не менее чем примерно 30%, и наиболее предпочтительно сродство не менее 50% исходного антитела. Способы определения антигенсвязывающего сродства известны в данной области и включают определение половины максимального связывания, анализ конкурентного связывания и анализ Scatchard. Соответствующие антигенсвязывающие исследования описаны в настоящей заявке.

Понятие «обратная мутация» означает мутацию, внедренную в нуклеотидную последовательность, которая кодирует гуманизированное антитело, мутация приводит к аминокислоте, соответствующей аминокислоте в исходном антителе (например, антителе-доноре, например, антителе мыши). Определенные остатки из каркасного участка исходного антитела могут быть сохранены во время гуманизирования антитела по настоящему изобретению для существенного сохранения связывающих свойств исходного антитела, но одновременно происходит минимизирование потенциальной иммуногенности получаемого антитела. В одном из вариантов осуществления настоящего изобретения исходное антитело происходит от мыши. Например, обратная мутация изменяет остаток в каркасной области человека на исходный остаток мышиного антитела. К примерам остатков каркасной области мыши, которые могут обратно мутировать, относятся, но ими не ограничиваются, канонические остатки, остатки поверхности раздела, необычные исходные остатки, которые близки к сайту связывания, остатки в «зоне Vernier» (которая формирует платформу, на которой сохраняются области CDR) (Foote, Winter, J. Mol. Biol. 224, 1992, cc.487-499), и те, которые близки к CDR Н3.

В контексте настоящего изобретения понятие «консервативное изменение» относится к изменениям, которые в существенной степени конформационно и антигенно нейтральны, производя минимальные изменения в третичной структуре мутантных полипептидов, или производя минимальные изменения в антигенных детерминантах мутантных полипептидов, соответственно, по сравнению с нативным белком. Применительно к антителам и фрагментам антител по настоящему изобретению консервативное изменение означает аминокислотное замещение, которое не изменяет способности антитела связываться с рецептором субъекта. Специалист в данной области может прогнозировать, какие аминокислотные замещения могут быть получены при поддержании высокой вероятности поддержания конформационной и антигенной нейтральности. Такой подход предусмотрен, например, в публикациях Berzofsky, Science 229, 1985, cc.932-940, и Bowie и др., Science 247, 1990, cc.1306-1310. К факторам, которые рассматривают в качестве влияющих на возможность поддерживать конформационный и антигенный нейтралитет, относятся, но ими не ограничиваются: (а) замещение гидрофобных аминокислот менее вероятно влияет на антигенность, поскольку гидрофобные остатки более вероятно локализованы во внутренней части белка, (б) замещение физически и химически сходно, аминокислоты менее вероятно влияют на конформацию, поскольку замещенные аминокислоты структурно подражают нативным аминокислотам, и (в) изменение эволюционно консервативных последовательностей предположительно отрицательно влияет на конформацию, поскольку такая консервативность означает, что аминокислотные последовательности могут иметь важное значение для проявления функциональности. Специалист в данной области может оценить изменения конформации белка, используя известные методы, например, но ими не ограничиваются, методы фиксации микродобавлений (Wasserman и др., J. Immunol. 87, 1961, cc.290-295, Levine и др., Meth. Enzymol. 11, 1967, cc.928-936) и методы анализа связывания, используя конформационнозависимые моноклональное антитела (Lewis и др., Biochem. 22, 1983, cc.948-954).

Кроме того, понятие «терапевтически эффективное количество» относится к количеству антитела, которое при введении человеку или животному достаточно для получения терапевтического эффекта у указанного человека или животного. Эффективное количество легко определить специалисту в данной области с помощью рутинных процедур.

В контексте настоящего изобретения понятия «лечение» и «предупреждение» относится к предупреждению рецидива или начала проявления одного или нескольких симптомов расстройства у субъекта, возникающего в результате введения профилактического или терапевтического агента.

Конструирование гуманизированных антител

Настоящее изобретение может быть легче понято с помощью ссылки на нижеследующее подробное описание специфических вариантов осуществления настоящего изобретения. Хотя настоящее изобретение было описано со ссылкой на конкретные подробности определенных вариантов его осуществления, их не следует рассматривать в качестве ограничений при рассмотрении настоящего изобретения.

Настоящее изобретение предусматривает новые способы и композиции, включающие высокоспецифичные и высокоэффективные антитела, способные специфически распознавать и связываться со специфическими эпитопами из числа β-амилоидных антигенов. Антитела, которые могут быть получены с помощью способов настоящего изобретения, особенно применимы для лечения амилоидоза - группы заболеваний и расстройств, связанных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), болезнь диффузных поражений телец Леви, синдром Дауна, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), комплекс паркинсонизм-деменция о.Гуам, а также другие заболевания, которые основаны или связаны с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейсфельда-Якоба, наследственное цереброспинальное кровоизлияние с амилоидозом (типа Dutch), болезнь Паркинсона, слабоумие, связанное со СПИД, амиотропный латеральный склероз (amyotropic lateral sclerosis - ALS), диабет взрослых, старческий кардиальный амилоидоз, эндокринные опухоли и другие, включая глазные заболевания, ассоциированные с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированное со связанными с амилоид-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов. Указанные патологические нарушения могут наблюдаться, например, в разных тканях глаза, например, в зрительной зоне коры мозга, что приводит к кортикальной зрительной недостаточности; в передней камере глаза и оптическом нерве, приводящие к глаукоме; в хрусталике, приводящие к катаракте из-за отложения бета-амилоида; в стекловидном теле, приводящие к зрительному амилоидозу; в сетчатке, приводящие к первичной зрительной дегенерации и дегенерации желтого пятна, например, возрастной дегенерации желтого пятна; в зрительном нерве, приводящие к формированию старческих бляшек в зрительном нерве, зрительной невропатии и зрительному невриту; в роговице, приводящие к решетчатой дистрофии роговицы.

Полностью гуманизированная или переформированная вариабельная область по настоящему изобретению может быть создана в рамках охвата настоящего изобретения, во-первых, конструированием вариабельной области аминокислотной последовательности, которая содержит области CDR, полученные не от человека, предпочтительно от грызуна, особенно предпочтительно полученные от антитела мыши ACI-01-Ab7C2 (называемого антителом «mC2» в настоящем изобретении, которое было депонировано 01 декабря 2005 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, в соответствии с Будапештским договором о международном признании депонирования микроорганизмов для целей патентной процедуры, под номером DSM ACC2750), погруженные в последовательности каркасных участков, производных от антитела человека. Области CDR, производные не от человека, особенно от грызуна, которые могут быть получены от антитела по настоящему изобретению, предусматривают требуемую специфичность. Следовательно, остатки являются включенными в конструкцию переформированной вариабельной области в значительной степени неизменными. Какие-либо модификации, таким образом, могут быть сведены к минимуму, и тщательно контролируются изменения в специфичности и сродстве антитела. С другой стороны, теоретически остатки каркасных участков могут быть производными от какой-либо вариабельной области человека.

Для создания переформированного антитела, которое показывает приемлемое и даже повышенное сродство, должны быть выбраны последовательности каркасного участка человека, которые равно применимы для создания переформированной вариабельной области и для сохранения сродства антитела.

Для достижения указанной цели была разработана оптимальная стратегия. Известно, что последовательности каркасного участка призваны поддерживать области CDR в правильной пространственной ориентации для взаимодействия с антигеном, и что остатки каркасного участка могут иногда даже участвовать в связывании антигена, причем эта стратегия направлена на минимизирование изменений, которые могут отрицательно воздействовать на трехмерную структуру антитела, путем изменения последовательности каркасного участка человека, применяемой для переформирования антитела из вариабельной области человека, которая наиболее гомологична или сходна с вариабельной областью, происходящей не от человека, особенно от грызуна. Это также может сделать максимальной вероятность того, что сродство может сохраниться в переформированном антителе.

В самом простом варианте «оптимальная» стратегия включает сравнение V-области грызуна-донора со всеми известными аминокислотными последовательностями V-области человека, и затем отбор наибольшей гомологии для обеспечения акцепторных каркасных участков для проведения гуманизирования. В реальности имеется несколько других факторов, которые следует учитывать, и которые могут влиять на конечный отбор акцепторных каркасных участков. В связи с этим могут быть применены прогнозы молекулярного моделирования в экспериментальной работе в попытке максимизации сродства получаемого переформированного антитела. По существу, цель моделирования заключается в прогнозировании того, какие ключевые остатки (если они есть) большинства гомологичных каркасных участков человека следует оставить, как и у грызуна, для получения наилучшего сродства в переформированном антителе.

В одном из вариантов осуществления настоящего изобретения области CDR получают из мышиного моноклонального антитела, особенно из мышиного моноклонального антитела ACI-01-Ab7C2 (называемого в настоящем изобретении «mC2»), описанного в одновременно подаваемой заявке на патент ЕР 05 02 7092.5, поданной 12.12.2005, описание которой включено в настоящее изобретение в виде ссылки.

Клетки гибридомы FP-12H3-C2, вырабатывающие мышиное моноклональное антитело ACI-01-Ab7C2 (называемое в настоящем изобретении «mC2» и «hC2» для гуманизированного С2 антитела), были депонированы 01 декабря 2005 в связи с находящейся в процессе одновременного рассмотрения заявкой ЕР05027092.5 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, в соответствии с Будапештским договором о международном признании депонирования микроорганизмов для целей патентной процедуры, под номером DSM ACC2750.

Мышиное антитело может сформироваться против надмолекулярной антигенной конструкции, включающей антигенный пептид, соответствующий аминокислотной последовательности β-амилоидного пептида, особенно β-амилоидного пептида Aβ1-15, Аβ1-16 и Аβ1-16(Δ14), модифицированного гидрофобной частью молекулы, например, пальмитиновой кислотой или гидрофильной частью молекулы, например, полиэтиленгликолем (ПЭГ), или комбинацией обоих, причем гидрофобные и гидрофильные части молекулы, соответственно, ковалентно связаны с каждым из концов антигенного пептида через по меньшей мере одну, особенно одну или две аминокислоты, например, лизин, глутаминовую кислоту и цистеин, или какую-либо другую соответствующую аминокислоту или аминокислотный аналог, способные выступить в качестве связующего механизма для соединения гидрофобной и гидрофильной частей с пептидным фрагментом. Если ПЭГ используют в качестве гидрофильной части молекулы, свободный от ПЭГ конец ковалентно связан с фосфатидилэтаноламином или каким-либо другим соединением, способным функционировать в качестве элемента заякоривания, например, для внедрения антигенной конструкции в двойной слой липосомы.

В частности мышиное антитело может сформироваться против надмолекулярной антигенной конструкции, включающей антигенный пептид, соответствующий аминокислотной последовательности β-амилоидного пептида Aβ1-16, модифицированного гидрофильной частью молекулы, например, гидрофильной частью молекулы полиэтиленгликоля (ПЭГ), ковалентно связанного с каждым из концов антигенного пептида через по меньшей мере одну, особенно одну или две аминокислоты, например, лизин, глутаминовую кислоту и цистеин, или какую-либо другую соответствующую аминокислоту или аминокислотный аналог, способные выступить в качестве связующего механизма для соединения гидрофобной и гидрофильной частей с пептидным фрагментом. Если ПЭГ используют в качестве гидрофильной части молекулы, свободный от ПЭГ конец ковалентно связан с фосфатидилэтаноламином или каким-либо другим соединением, способным функционировать в качестве элемента заякоривания, например, для внедрения антигенной конструкции в двойной слой липосомы.

В одном из вариантов осуществления настоящего изобретения предусмотрено химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент, которые включают в вариабельную область по меньшей мере одну область CDR, происходящую не от человека, погруженную в одну или несколько областей каркасного участка, производных от человека или примата, и комбинированную с константной областью, производной от антитела человека или примата, причем указанное химерное антитело или его фрагмент, или гуманизированное антитело или его фрагмент способно специфически распознавать и связывать β-амилоидный мономерный пептид.

Области CDR содержат остатки, которые наиболее вероятно связывают антиген, и которые должны сохраниться в переформированном антителе. Области CDR определены по последовательности, классифицированной по Kabat и др. в кн.: «Sequence of Proteins of Immunological Interest», 1991, 5е изд., Министерство здравоохранения и социального развития, правительство США. Области CDR относятся к каноническим классам (Chothia и др., Nature, 342, 1989, cc.877-883), в которых ключевые остатки определяют по большой протяженности структурной конформации петли CDR. Эти остатки почти всегда сохраняются в переформированном антителе.

В процессе приготовления гуманизированного антитела по настоящему изобретению, аминокислотные последовательности вариабельных областей тяжелой цепи и легкой цепи антитела С2 (VH и VK) сравнивают с последовательностями VH и VK антитела грызуна в базах данных NCBI и Kabat.

Наиболее плотно совпадающим геном зародышевой линии мыши с С2 VK является ген bb1, локус MMU231201 (Schable и др., 1999). Сравнение показывает, что имеются отличия по двум аминокислотам от этой последовательности зародышевой линии, причем обе локализованы в CDRL1. Могут быть обнаружены зрелые антитела мыши со сходной, но не идентичной, последовательностью. Некоторые имеют идентичную последовательность CDRL2 и идентичную последовательность CDRL3, но область CDRL1 антитела С2 представляется уникальной. Сравнение с VK последовательностями зародышевой линии человека показывает, что гены из подгруппы VKII наилучшим образом спариваются с С2 VK (Сох и др., 1994). Таким образом, последовательность С2 VK может быть оценена по последовательности подгруппы MuVKII по Kabat.

DPK15 вместе с областью J антитела HuJK1 может быть выбрана для обеспечения последовательностей акцепторного каркасного участка для гуманизированной области VK.

Остатки на границе вариабельной легкой и тяжелой цепи определены (Chothia и др., J. Mol. Biol., 186, 1985, cc.651-663). Они обычно сохраняются в переформированном антителе. Аминокислота Phe в положении 87 в С2 VK мыши обычно не располагается на границе раздела, где Tyr более обычен в подгруппе VKII, показывая, что этот остаток каркасного участка может быть важным для действия антитела. Остаток Tyr в положении 87 присутствует в зародышевой линии человека и гуманизированной области C2VK.

Последовательности гуманизированной области VK таким образом могут быть сконструированы так, что C2HuVK1 состоит из областей CDR мышиного С2 VK с каркасными участками DPK 15 мыши и JK1 человека. В одном из вариантов осуществления настоящего изобретения остатки мыши могут быть замещены в области каркасного участка человека по положениям 45, и/или 87, и/или 50, и/или 53. Остаток 45 может быть вовлечен в поддержание конформации областей CDR. Остаток 87 локализован по границе доменов VH и VK. Следовательно, эти остатки могут быть принципиально важными для поддержания связывания антитела.

Наиболее совпадающим геном зародышевой линии мыши С2 VH AF является ген VH7183, локус AF120466, (Langdon и др., 2000). Сравнение с последовательностями VH зародышевой линии человека показывает, что гены из подгруппы VHIII наилучшим образом спариваются с С2 VH. С2 VH AF может быть отнесен к подгруппе MuVHIIID по Kabat. Последовательность DP54 вместе с областью J в HuJH6 человека может быть выбрана для получения последовательностей акцепторного каркасного участка для гуманизированной области VH.

Сравнение показывает, что имеется девять аминокислотных отличий между последовательностями С2 VH и акцепторной последовательностью зародышевой линии человека DP54 и JH6 в большинстве случаев локализованы в CDRH2. Обнаружены зрелые антитела мыши с идентичной или сходной (отличие в один остаток) областью CDRH1 или со сходной CDRH2 (отличие в один остаток), но ни одного со всеми тремя областями CDR, идентичными С2 VH AF. Область CDRH3 в антителе С2 обычно короткая, состоящая только из трех остатков. Однако другие антитела обнаружены в базе данных по областям CDRH3 указанной длины. Остаток 47 в С2 VH является скорее Leu, а не более распространенным Trp, и остаток 94 является скорее Ser, а не в норме Arg, показывая, что эти остатки каркасного участка могут быть важны для действия антитела.

Могут быть сконструированы различные гуманизированные последовательности VH. C2HuVH1 состоит из С2 VH AF CDR с каркасными участками из DP54 и HuJH6. В одном из вариантов осуществления настоящего изобретения остатки мыши могут быть замещены в каркасном участке человека по положениям 47, или 94, или по обоим. Остаток 47 в каркасном участке 2 осуществляет контакт и с областями CDR, и с доменом VK. Остаток 94 может быть вовлечен в поддержку конформации областей CDR. Следовательно, эти остатки могут быть критическими для поддержания связывания антитела.

Могут быть сконструированы различные области HCVR и LCVR, которые включают области CDR не от человека, получаемые от антитела-донора, например, антитела мыши, погруженные в нативную или модифицированную область каркасного участка, производного от человека или примата. Модификация может особенно касаться замены одного или нескольких аминокислотных остатков в каркасном участке на остатки, полученные не от человека, особенно на остатки мыши, более часто обнаруживаемые в положении в соответствующих подгруппах, или на остатки, которые обладают сходными свойствами с остатками, чаще обнаруживаемыми в этом положении в соответствующих подгруппах.

Модификация последовательностей каркасного участка области каркасного участка призвана поддержать области CDR в их правильной пространственной ориентации для взаимодействия с антигеном, причем остатки каркасного участка могут иногда даже участвовать в связывании антигена. В одном из вариантов осуществления настоящего изобретения проводят измерения по дальнейшей адаптации выбранных последовательностей каркасных участков человека, чтобы сделать их наиболее схожими с последовательностями каркасных участков грызунов для максимизации вероятности того, что сродство может быть сохранено в восстановленном антителе.

Таким образом, остатки грызунов в области каркасного участка человека могут быть замещены. В частности, остатки грызунов могут быть замещены в каркасном участке вариабельной области тяжелой цепи человека (Heavy Chain Variable region - HCVR) в положениях 47, или 94, или в обоих положениях, а также в каркасном участке вариабельной области легкой цепи человека (Light Chain Variable region - LCVR) в положениях 45, и/или 87, и/или 50, и/или 53, соответственно.

Остатки, выявленные в указанных выше положениях в каркасном участке человека, могут быть заменены на остатки мыши, наиболее часто выявляемые в указанных положениях в соответствующих подгруппах. В частности, аминокислота Trp в положении 47 по Kabat в каркасном участке вариабельной области тяжелой цепи, производном от человека или примата, показанном в SEQ ID NO:15, может быть замещена на Leu или на аминокислотный остаток, который имеет сходные признаки и замещение которого приведет к изменениям, которые в существенной степени конформационно или антигенно нейтральны, получая минимальные изменения в третичной структуре мутантных полипептидов, или получая изменения в антигенных детерминантах. В частности, аминокислота Trp в положении 47 по Kabat в каркасном участке вариабельной области тяжелой цепи, производном от человека или примата, показанном в SEQ ID NO:15, может быть дополнительно замещена аминокислотой, выбранной из группы, состоящей из норлейцина, Ile, Val, Met, Ala, и Phe, особенно Ile. Могут быть рассмотрены другие консервативные замещения, которые конформационно и антигенно нейтральны.

Аминокислота Arg в положении 94 по Kabat в каркасном участке вариабельной области тяжелой цепи, производном от человека или примата, показанном в SEQ ID NO:15, может быть замещена на Ser или на аминокислотный остаток со сходными свойствами, замещение которого приводит к изменениям, которые в существенной степени конформационно или антигенно нейтральны, получая минимальные изменения в третичной структуре мутантных полипептидов, или вырабатывая минимальные изменения в антигенных детерминантах. В частности, Arg в положении 94 по Kabat в каркасном участке вариабельной области тяжелой цепи, производном от человека или примата, показанном в SEQ ID NO:15, может быть в другом варианте замещена на Thr.

В другом варианте осуществления настоящего изобретения оба остатка могут быть замещены в гуманизированном антителе.

Аминокислота Gln в положении 45 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть замещена на Lys или на аминокислотный остаток со сходными свойствами, замещение которого приводит к изменениям, которые в существенной степени конформационно или антигенно нейтральны, получая минимальные изменения в третичной структуре мутантных полипептидов, или получая минимальные изменения в антигенных детерминантах. В частности, аминокислота Gln в положении 45 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть в другом варианте замещена на аминокислоту, выбранную из группы, состоящей из Arg, Gln и Asn, особенно Arg.

Аминокислота Leu в положении 50 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть замещена на Lys или на аминокислотный остаток со сходными свойствами, замещение которого приводит к изменениям, которые в существенной степени конформационно или антигенно нейтральны, получая минимальные изменения в третичной структуре мутантных полипептидов или получая минимальные изменения в антигенных детерминантах. В частности, аминокислота Leu в положении 50 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть замещена на аминокислоту, выбранную из группы, состоящей из Arg, Gln и Asn, особенно Arg.

Аминокислота Asn в положении 53 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть замещена на His и Gln или на аминокислотный остаток со сходными свойствами, замещение которого приводит к изменениям, которые в существенной степени конформационно или антигенно нейтральны, получая минимальные изменения в третичной структуре мутантных полипептидов или получая минимальные изменения в антигенных детерминантах. В частности, аминокислота Asn в положении 53 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть замещена на аминокислоту, выбранную из группы, состоящей из Gln, His, Lys и Arg.

Аминокислота Thr в положении 87 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть замещена на Phe или на аминокислотный остаток со сходными свойствами, замещение которого приводит к изменениям, которые в существенной степени конформационно или антигенно нейтральны, получая минимальные изменения в третичной структуре мутантных полипептидов, или получая минимальные изменения в антигенных детерминантах. В частности, аминокислота Tyr в положении 87 по Kabat в каркасном участке вариабельной области легкой цепи, производном от человека или примата, показанном в SEQ ID NO:12, может быть замещена на аминокислоту, выбранную из группы, состоящей из Leu, Val, Ile и Ala, особенно Leu.

Полученная таким образом вариабельная область, включающая по меньшей мере одну область CDR, происходящую не от человека, которая погружена в один или несколько каркасных участков, производных от человека или примата, затем может быть скомбинирована с константной областью, производной от антитела человека или примата, особенно с константными областями IgG4 или к человека, соответственно. Константная область IgG4 может быть модифицирована, например, заменяя серии в положении 228 в шарнирной области на пролин (HuIgG4 Ser-Pro). Такая мутация стабилизирует межцепочечную дисульфидную связь и предупреждает формирование половинок молекул, что возможно в препаратах нативного IgG4 человека. Константная область IgG4 может быть дополнительно модифицирована делецией концевого Lys в положении 439, показанном в SEQ ID NO:16.

Модифицированные вариабельные области могут быть сконструированы методом, известным в данной области, например перекрывающейся ПЦР рекомбинацией. Экспрессирующие кассеты для химерного антитела, С2 ChVH AF и С2 ChVK, могут быть применены в качестве матриц для мутагенеза каркасных участков в требуемые последовательности. Наборы пар мутагенных праймеров синтезируют, включая области, подвергаемые изменению. Полученные гуманизированные VH и VK экспрессирующие кассеты могут быть клонированы в соответствующих векторах клонирования, известных в данной области, например, pUC19. После подтверждения, что целая последовательность ДНК соответствует VH и VK, модифицированные гены V-области тяжелой и легкой цепи могут быть исключены из вектора клонирования в качестве кассет экспрессии и переносят на соответствующие векторы экспрессии.

Мутирование области Fc

Настоящее изобретение предусматривает методы получения варианта полипептида, особенно антитела, включающего вариантную область. Такое антитело включает, например, вариант области Fc, и может применяться для лечения заболевания или расстройства, например, амилоидоза.

«Исходный», «стартовый» или «безвариантный» полипептид получают, используя методы, применяемые в данной области для получения полипептидов, включающих, например, область Fc. В предпочтительном варианте осуществления настоящего изобретения исходный полипептид является антителом, а примеры методов получения антитела более подробно описаны в последующих разделах. Исходный полипептид, однако, может быть каким-либо другим полипептидом, включающим область Fc region, например, иммуноадгезином. Способы получения иммуноадгезинов более подробно рассмотрены ниже.

В другом варианте осуществления настоящего изобретения вариант области Fc может быть выработан способами, описанными в настоящем изобретении, и такой «вариант области Fc» может быть гибридизирован с гетерологичным полипептидом выбора, например, вариабельным доменом антитела или связывающим доменом рецептора, или лигандом.

Исходный полипептид включает область Fc. Обычно область Fc исходного полипептида может включать нативную последовательность области Fc, и предпочтительно нативную последовательность области Fc человека. Однако область Fc исходного полипептида может иметь одно или несколько изменений или модификаций в имеющейся аминокислотной последовательности из области Fc нативной последовательности. Например, способность области Fc связывать C1q может быть ранее изменена (другие типы модификаций области Fc подробнее описаны ниже). В другом варианте осуществления настоящего изобретения область Fc исходного полипептида является «умозрительной» и, хотя она физически не существует, специалист по конструированию антител может принять решение по желаемой аминокислотной последовательности варианта области Fc и получить полипептид, включающий эту последовательность или ДНК, кодирующую требуемый вариант аминокислотной последовательности области Fc.

Однако в предпочтительном варианте осуществления настоящего изобретения нуклеиновая кислота, кодирующая область Fc исходного полипептида, доступна, и такая последовательность нуклеиновой кислоты изменена для получения варианта последовательности нуклеиновой кислоты, кодирующей вариант D265A области Fc.

ДНК, кодирующую вариант аминокислотной последовательности стартового полипептида, получают разными методами, известными в данной области. К этим методам относятся, но ими не ограничиваются, получение сайт-направленным мутагенезом (или ологонуклеотид-опосредованным), ПЦР-мутагенезом и кассетным мутагенезом ранее полученной ДНК, кодирующей полипептид.

Сайт-направленный мутагенез - предпочтительный способ для получения замещенных вариантов. Этот способ известен в данной области (см., например, Carter и др., Nucleic Acids Res. 13, 1985, cc.4431-4443, и Kunkel и др., Proc. Natl. Acad. Sci. USA 82, 1987, с.488). Вкратце, при выполнении сайт-направленного мутагенеза ДНК стартовую ДНК изменяют первым гибридизированием олигонуклеотида, кодирующего требуемую мутацию, с одной цепью такой стартовой ДНК. После гибридизации ДНК-полимеразу используют для синтеза целой второй цепи, используя гибридизированный олигонуклеотид в качестве праймера, и используя одну цепь стартовой ДНК в качестве матрицы. Таким образом, олигонуклеотид, кодирующий требуемую мутацию, внедряют в получаемую двухнитевую ДНК.

ПЦР-мутагенез также применим для получения вариантов аминокислотной последовательности стартового полипептида. См. Higuchi в кн.: «PCR Protocols», 1990, изд. Academic Press, cc. 177-183, и Vallette и др., Nuc. Acids Res. 17, 1989, cc.723-733. Вкратце, если используют малые количества матричной ДНК в качестве стартового материала в ПЦР, праймеры, мало отличающиеся по последовательности от соответствующей области в матричной ДНК, могут применяться для получения относительно больших количеств специфического фрагмента ДНК, который отличается от последовательности матрицы только по положениям, в которых праймеры отличаются от матрицы.

Другой способ получения вариантов - кассетный мутагенез, основан на методе, описанном Wells и др., Gene 34, 1985, cc.315-323. Стартовым материалом является плазмида (или другой вектор), включающая ДНК стартового полипептида, подвергаемого мутированию. Кодон (кодоны) в стартовой ДНК, подвергаемые мутированию, идентифицированы. Должен быть уникальный сайт для эндонуклеазы рестрикции на каждой стороне идентифицированного сайта (сайтов) мутирования. Если сайтов рестрикции нет, они могут быть получены с помощью указанного выше метода олигонуклеотид-опосредованного мутагенеза для их внедрения по определенным местам в ДНК стартового полипептида. Плазмидную ДНК разрезают по сайтам для линеаризации. Двухнитевую кодирующую олигонуклеотид последовательность ДНК между сайтами рестрикции, включающую требуемые мутации (мутацию) синтезируют, используя стандартные процедуры, причем две нити олигонуклеотида синтезируют отдельно и затем гибридизируют вместе, используя стандартные методики. Двухнитевой олигонуклеотид называется кассетой. Такая кассета конструируется для получения концов 5' и 3', которые совместимы с концами линеаризованной плазмиды таким образом, что могут быть прямо лигированы в плазмиду. В результате такая плазмида содержит последовательность мутантной ДНК.

В другом варианте или дополнительно требуемая последовательность аминокислот, кодирующая полипептидный вариант, может быть определена, а нуклеотидная последовательность, кодирующая такой вариант аминокислотной последовательности, может быть получена синтетически.

Аминокислотная последовательность исходного полипептида модифицируется для получения варианта области Fc с измененным связывающим сродством или действием рецептора Fc in vitro, и/или in vivo, и/или измененным действием антителозависимой клеточно-опосредованной цитотоксичности (ADCC) in vitro, и/или in vivo, и/или с измененным действием клеточно опосредованной цитотоксичности (CDC) in vitro и/или in vivo.

Обычно модификация вызывает одно или несколько аминокислотных замещений. Замещение может быть, например, «консервативным замещением». Существенные модификации биологических свойств области Fc могут быть дополнены выбором замещений, которые существенно отличаются по их воздействию на поддержание (а) структуры каркаса полипептида в области замещения, например, в виде конформации плоскости или спирали, (б) заряда или гидрофобности молекулы по сайту-мишени, или (в) объема боковой цепи. Природные остатки поделены на группы, основанные на общих свойствах боковых цепей:

(1) гидрофобные: норлейцин, met, ala, val, leu, ile,

(2) нейтральные гидрофильные: cys, ser, thr,

(3) кислотные: asp, glu,

(4) основные: asn, gln, his, lys, arg,

(5) остатки, которые влияют на ориентацию цепи: gly, pro, и

(6) ароматические: trp, tyr, phe.

Помимо аминокислотных замещений настоящее изобретение рассматривает другие модификации аминокислотной последовательности исходной области для получения, например, варианта области Fc с измененной эффекторной функцией.

Например, можно делегировать один или несколько аминокислотных остатков области Fc для снижения связывания с рецептором FcR. Обычно можно делегировать один или несколько остатков области Fc, идентифицированных в настоящем изобретении в качестве влияющих на связывание FcR, для того, чтобы получить такой вариант области Fc. Обычно можно делегировать не более примерно 1-10 остатков в таком варианте осуществления настоящего изобретения. Область Fc в настоящем изобретении, включающая одну или несколько аминокислотных делеций, предпочтительно сохраняет по меньшей мере примерно 80%, предпочтительно по меньшей мере примерно 90%, и наиболее предпочтительно по меньшей мере примерно 95%, исходной области Fc или нативной области последовательности Fc человека.

Путем внедрения модификаций соответствующей аминокислотной последовательности в исходную область Fc, например, можно получить вариант области Fc, который (а) опосредует антителозависимую клеточно-опосредованную цитотоксичность (antibody-dependent cell-mediated cytotoxicity - ADCC) в присутствии эффекторных клеток человека более или менее эффективно, и/или (б) связывает рецептор Fc гамма (Fc.gamma.R) с большим или меньшим сродством по сравнению с исходным полипептидом. Такие варианты области Fc могут обычно включать по меньшей мере одну модификацию аминокислоты в области Fc. Комбинирование аминокислотных модификаций предположительно особенно желательно. Например, вариант области Fc может включать две, три, четыре, пять и более замещений, например, в определенных положениях области Fc, выявленных в настоящем изобретении.

Например, в составе IgG1 может быть получен вариант области Fc с уменьшенным связыванием Fc.gamma.R за счет внедрения аминокислотной модификации по какому-нибудь одному или нескольким положениям аминокислот 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439 области Fc. См., например, US 6737056.

Варианты IgG1, которые проявляют пониженное связывание с Fc.gamma.RI, включают те аминокислотные модификации, включающие область Fc, по какому-нибудь одному или нескольким положениям аминокислот 238, 265, 269, 270, 327 или 329. См., например, US 6737056.

К вариантам IgG1, которые проявляют пониженное связывание с Fc.gamma.RII, относится аминокислотная модификация области Fc по какому-нибудь одному или нескольким положениям аминокислот 238, 265, 269, 270, 292, 294, 295, 298, 303, 324, 327, 329, 333, 335, 338, 373, 376, 414, 416, 419, 435, 438 или 439. См., например, US 6737056.

К вариантам IgG1, которые проявляют пониженное связывание с Fc.gamma.RIII, относятся аминокислотные модификации области Fc по какому-нибудь одному или нескольким положениям аминокислот 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 293, 294, 295, 296, 301, 303, 322, 327, 329, 338, 340, 373, 376, 382, 388, 389, 416, 434, 435 или 437. См., например, US 6737056.

Специалистам в данной области следует учитывать, что сходные эффекты могут быть получены путем варьирования специфических остатков в других областях Ig Fc, хотя нумерация остатков может быть разной См., например, US 6737056.

Может быть сконструирована область Fc с измененной эффекторной функцией, например, путем модифицирования связывания C1q и/или связывания FcR и за счет этого изменения действия CDC и/или действия ADCC. Например, можно получить вариант области Fc с улучшенным связыванием C1q и улучшенным связыванием Fc.gamma.RIII, например, имеющий и улучшенное действие ADCC, и улучшенное действие CDC. В другом варианте, если требуется, чтобы эффекторная функция была снижена или ликвидирована, может быть сконструирован вариант области Fc с пониженным действием CDC, и/или пониженным действием ADCC. В других вариантах осуществления настоящего изобретения можно повысить только одно из указанных действий, а также необязательно понизить другие действия, например, получить вариант области Fc с улучшенным действием ADCC, но пониженным действием CDC, и наоборот. См., например, US 6737056.

Дальнейшие изменения аминокислотной последовательности могут заключаться в том, что какой-либо остаток цистеина, который не участвует в поддержании должной конформации варианта полипептида, также может быть замещен, обычно на серин, для улучшения окислительной стабильности молекулы и предупреждения неправильного поперечного сшивания. См., например, US 6737056.

Другой тип аминокислотного замещения призван изменять шаблон гликозилирования полипептида. Такое изменение может быть достигнуто делецией одной или нескольких углеводных частей, обнаруженных в полипептиде, и/или добавлением одного или нескольких сайтов гликозилирования, которые не содержатся в полипептиде. Гликозилирование полипептидов обычно N-связанное или O-связанное. N-связанное относится к присоединению углеводной части молекулы к боковой цепи остатка аспарагина. Трипептидные последовательности аспарагин-Х-серин и аспарагин-Х-треонин, в которых Х обозначает какую-либо аминокислоту за исключением пролина, являются последовательностями распознавания для ферментативного присоединения углеводной части молекулы к боковой цепи аспарагина. Таким образом, наличие одной из этих трипептидных последовательностей в полипептиде создает сайт потенциального гликозилирования. O-связанное гликозилирование относится к присоединению одного из Сахаров, N-ацетилгалактозамина, галактозы или ксилозы, к гидроксиаминокислоте, в большинстве случаев к серину или треонину, хотя также может быть и к 5-гидроксипролину или 5-гидроксилизину. Добавление сайтов гликозилирования к полипептиду обычно сопровождается изменением аминокислотной последовательности, например, таким образом, что она содержит одну или несколько указанных выше трипептидных последовательностей (для N-связанных сайтов гликозилирования). Изменение также может быть получено добавлением или замещением одного или нескольких остатков серина или треонина к последовательности исходного полипептида (для O-связанных сайтов гликозилирования). Пример варианта гликозилирования имеет аминокислотное замещение остатка Asn 297 в тяжелой цепи. См., например, US 6737056.

Кроме того, класс, подкласс или аллотип области Fc при желании может быть изменен замещением одной или нескольких аминокислот для получения области Fc с аминокислотной последовательностью, более гомологичной по отношению к другому классу, подклассу или аллотипу. Например, область Fc мыши может быть изменена для получения аминокислотной последовательности, которая более гомологична к области Fc человека; область Fc не-А аллотипа IgG1 человека может быть модифицирована для получения области Fc А аллотипа IgG1 человека, и т.д. В одном из вариантов осуществления настоящего изобретения амино-модификации (модификацию) в контексте настоящего изобретения с измененным FcR связыванием и/или ADCC действием получают в домене СН2 области Fc, а домен СН3 делегируют или замещают другим доменом димеризации. Предпочтительно домен СНЗ сохраняют (независимо от аминокислотных модификаций, которые изменяют эффекторную функцию, согласно описанию настоящего изобретения). См., например, US 6737056.

Исследование связывания

Способность варианта полипептида связывать FcR может быть оценена. Если FcR является рецептором Fc высокой степени сродства, например, Fc.gamma.RI, FcRn или Fc.gamma.RIIIA-V 158, связывание может быть измерено путем титрования варианта мономерного полипептида и измерения связанного варианта полипептида, используя антитело, которое специфически связывается с вариантом полипептида в методе ELISA стандартного формата. См., например, US 6737056. Исследования связывания FcR для рецепторов FcR, обладающих низким сродством, известны в данной области и описаны, inter alia, например, в US 6737056.

Для оценки действия ADCC варианта полипептида может быть проведен анализ ADCC in vitro, используя варьирующие соотношения эффектор:мишень. Применимыми «эффекторными клетками» для такого исследования могут быть мононуклеарные клетки периферической крови (МКПК) и природные клетки-киллеры (NK). В другом варианте, или дополнительно, действие варианта полипептида может быть оценено in vivo, например, в модели животного, например, описанной Clynes и др., PNAS (USA) 95, 1998, cc.652-656.

Векторы экспрессии

Какой-либо соответствующий вектор экспрессии может применяться в практике настоящего изобретения. Например, специалист в данной области мог бы экспрессировать IgG1, например, в pSVgpt. Вектор экспрессии pSVgpt основан на pSV2gpt (Mulligan и Berg, 1980) и включает ген устойчивости к ампициллину для отбора бактериальных клеток, ген gpt для отбора в клетках млекопитающих, энхансерную область тяжелой цепи иммуноглобулина мыши, геномную последовательность, кодирующую ген константной области, и SV40 поли-А последовательности. Вариабельную область тяжелой цепи для экспрессии внедряют в виде фрагмента от сайта HindIII до сайта BamHI.

Вектор экспрессии pSVhyg включает ген устойчивости к ампициллину для отбора в бактериальных клетках, ген hyg для отбора в клетках млекопитающих, энхансерную область тяжелой цепи иммуноглобулина мыши, геномную последовательность, кодирующую ген константной области каппа, и последовательности энхансера каппа и SV40 поли-А. Вариабельная область легкой цепи для экспрессии инсертирована в виде фрагмента от сайта HindIII до сайта BamHI.

Правильность последовательности ДНК затем может быть подтверждена в векторах экспрессии для гуманизированных VH и VK.

Для выработки антитела векторы экспрессии гуманизированной тяжелой и легкой цепи могут быть интродуцированы в соответствующие продуцирующие клеточные линии, известные в данной области, например, в клетки NS0. Внедрение векторов экспрессии может достигаться совместной трансфекцией через электропорацию или какой-либо соответствующей технологией трансформации, известной в данной области. Линии клеток, вырабатывающих антитело, затем могут отбирать и очищать гуманизированные антитела. Очищенные антитела затем могут анализироваться стандартными методами, например, SDS-PAGE.

Антитела с улучшенным сродством, специфичностью, стабильностью

Последовательность CDRL2 («KVSNRFS») антитела мыши С2 может быть несколько модифицирована без вреда для связывающего действия антитела. Консервативные замещения могут быть получены путем обмена R на K в положении 50 и S на N в положении 53. Двумя другими последовательностями CDRL2 являются «RVSNRFS» и «KVSSRFS», соответственно. Они включены в последовательность V« мыши без других изменений в виде С2 VK-R и С2 VK-S, соответственно.

Сродство, специфичность и стабильность антитела по настоящему изобретению, согласно описанному выше, или его фрагмента могут быть модифицированы изменением их профиля или шаблона гликозилирования или при улучшенных терапевтических значениях.

Для достижения такого изменения в шаблоне гликозилирования клетки-хозяева могут быть сконструированы таким образом, что они способны экспрессировать предпочтительный диапазон действия гликопротеин-модифицирующей гликозилтрансферазы, которая повышает сложные N-связанные олигосахариды, несущие бисекторные GIcNAc. Кроме того, могут быть получены модифицированные гликоформы, например, антитела, включая целые молекулы антител, фрагменты антител или гибридные белки, которые включают область, эквивалентную области Fc иммуноглобулина, обладающие повышенной Fc-опосредованной клеточной цитотоксичностью.

Способы получения антител с модифицированными свойствами гликозилирования известны специалистам в данной области и описаны, например, в ЕР1071700, US2005272128, Ferrara и др., J Biol Chem 281(8), 2006, cc.5032-5036, Ferrara и др., Biotechnology и Bioengineering 93(5), 2006, cc.851-861.

Фармацевтические препараты и введение

Антитела по настоящему изобретению, особенно моноклональные антитела по настоящему изобретению, могут быть приготовлены в физиологически приемлемом составе и могут включать фармацевтически приемлемый носитель, разбавитель и/или эксципиент, используя известные методы. Например, антитело по настоящему изобретению, описанное в настоящем изобретении, включая какое-либо функционально эквивалентное антитело или его функциональные части, в частности моноклональное антитело, включая какое-либо функционально эквивалентное антитело или его функциональные части, комбинируют с фармацевтически приемлемым носителем, растворителем и/или эксципиентом для формирования терапевтической композиции. Соответствующие фармацевтические носители, растворители и/или эксципиенты известны в данной области и включают, например, фосфатно-солевые буферные растворы, воду, эмульсии, например, эмульсии по типу масло/вода, различные типы увлажняющих агентов, стерилизующих растворов и др.

Состав фармацевтической композиции по настоящему изобретению может быть завершен стандартным методом, известным специалистам в данной области.

Композиции настоящего изобретения могут быть введены субъекту в твердой, жидкой или аэрозольной форме в соответствующей фармацевтически эффективной дозе. К примерам твердых композиций относятся таблетки, мази и имплантированные дозированные единицы. Таблетки могут быть введены перорально. Терапевтические мази могут применяться местно. Имплантированные дозированные единицы могут быть введены местно, например, по месту опухоли, или могут быть имплантированы для системного высвобождения терапевтической композиции, например, подкожно. К примерам жидких композиций относятся составы, адаптированные для внутримышечной, подкожной, внутривенной, внутриартериальной инъекции, и составы для местного и внутриглазного введения. Примерами аэрозольных составов являются ингаляционные составы для введения в легкие.

Композиции могут вводиться стандартными способами. Обычно композиции вводят местно, перорально, ректально, назально, внутрикожно, внутрибрюшинно или парентерально (например, внутривенно, подкожно или внутримышечно). Кроме того, композиция может быть внедрена в матрицы устойчивого высвобождения, например, биодеградируемые полимеры, полимеры, имплантированные поблизости от места, где требуется высвобождение, например, около места опухоли. Способ включает введение одной дозы, введение повторяющихся доз с заранее определенными интервалами, и устойчивое введение на протяжении заранее установленного периода.

Матрица устойчивого высвобождения, используемая в настоящем изобретении, является матрицей, которая сделана из материалов, обычно из полимеров, и разрушается ферментами или кислотным/щелочным гидролизом или растворением. При внедрении в организм на матрицу воздействуют ферменты и тканевые жидкости. Матрицу устойчивого высвобождения желательно выбирать из биосовместимых материалов, например, используемых для липосом: полилактидов (полимолочная кислота), полигликолида (полимера гликолевой кислоты), сополимера гликолида и полилактида (сополимер молочной кислоты и гликолевой кислоты), полиангидридов, полиортоэфиров, полипептидов, гиалуроновой кислоты, коллагена, хондроитина сульфата, карбоновых кислот, жирных кислот, фосфолипидов, полисахаридов, нуклеиновых кислот, полиаминокислот, аминокислот, например, фенилаланина, тирозина, изолейцина, полинуклеотидов, поливинилпропилена, поливинилпирролидона и силикона. Предпочтительной биоразрушаемой матрицей является полилактид, полигликолид, или сополимер гликолида и полилактида (сополимер молочной кислоты и гликолевой кислоты).

Специалистам в данной области известно, что доза композиции зависит от разных факторов, например, условий обработки, определенной используемой композиции и других клинических факторов, например, массы, размера, пола и общего состояния здоровья пациента, площади поверхности тела, определенного вводимого соединения или композиции, других лекарственных средств, вводимых одновременно, а также от способа введения.

Композиция может вводиться в комбинации с другими композициями, включающими биологически активное вещество или соединение, по меньшей мере одно соединение, выбранное из группы, включающей: соединения против окислительного стресса, противоапоптические соединения, хелаторы металлов, ингибиторы репарации ДНК, например, пирензепин и метаболиты, 3-амино-1-пропансульфоновую кислоту, 1,3-пропандисульфонат, активаторы α-секретазы, ингибиторы β- и γ-секретазы, тау белки, нейротрансмиттер, разрушители β-слоев, аттрактанты для амилоид-бета очищающих/истощающих клеточных компонентов, ингибиторов N-концевого усеченного амилоида-бета, включая амилоид-бета 3-42 в форме пироглутамата, противовоспалительные молекулы, «атипичное антипсихотическое средство», например, клозапин, ципразидон, рисперидон, арипипразол или оланзапин, или ингибиторы холинэстеразы (ChEIs), например, такрин, ривастигмин, донепезил и/или галантамин, агонисты M1 и другие лекарственные средства, включающие какое-либо амилоидное или тау-модифицированное лекарственное средство и пищевые добавки, например, витамин В12, цистеин, предшественник ацетилхолина, лецитин, холин, гингко билоба, ацетил-L-карнитин, идебенон, пропентофиллин или производное ксантина, вместе с антителом по настоящему изобретению и необязательно фармацевтически приемлемый носитель, и/или растворитель, и/или эксципиент и инструкции для лечения заболеваний.

Белковый материал фармацевтического действия может быть в количестве от 1 нг до 10 мг на дозу. Обычно режим введения должен быть в диапазоне от 0,1 мкг до 10 мг антитела по настоящему изобретению, особенно в диапазоне от 1,0 мкг до 1,0 мг, и более предпочтительно в диапазоне от 1,0 мкг до 100 мкг, причем число отдельных попаданий в такие диапазоны также является частью настоящего изобретения. Если вводят непрерывной инфузией, более точно дозировка может составлять от 0,01 мкг до 10 мг единиц на кг массы тела в час, причем число отдельных попаданий в такие диапазоны также является частью настоящего изобретения.

Введение обычно может быть парентеральным, например, внутривенным. Препараты для парентерального введения включают стерильные водные или неводные растворы, суспензии и эмульсии. К неводным растворителям относятся, но ими не ограничиваются, пропиленгликоль, полиэтиленгликоль, растительное масло и инъекционные органические эфиры, например, этилолеат. Водные растворители могут быть выбраны из группы, состоящей из воды, спиртовых/водных растворов, эмульсий или суспензий, включая солевые и буферные среды. К парентеральным растворителям относятся раствор хлорида натрия, раствор декстрозы Рингера, декстрозы и натрия хлорида, раствор лактата Рингера и нелетучие масла. Внутривенные растворители включают жидкие и пищевые наполнители, электролитные наполнители (например, основанные на растворе декстрозы Рингера) и другие. Консерванты также могут быть, например, антимикробными, антиоксидантными, хелатирующими агентами, инертными газами и др.

Фармацевтическая композиция может дополнительно включать белковые носители, например, сывороточный альбумин или иммуноглобулин, особенно от человека. Другие биологически действующие агенты могут содержаться в фармацевтической композиции настоящего изобретения в зависимости от их назначения.

Если связывающая мишень расположена в мозге, некоторые варианты осуществления настоящего изобретения предусматривают перенос антитела или его действующего фрагмента через гематоэнцефалитный барьер. Некоторые нейродегенеративные заболевания связаны с повышением проницаемости гематоэнцефалитного барьера таким образом, что антитело или его действующий фрагмент могут быть легко внедрены в мозг. Если гематоэнцефалитный барьер остается интактным, имеется несколько известных в данной области подходов по транспортировке молекул через него, включая, но ими не ограничиваясь, физические методы, методы, основанные на липидах, и методы, основанные на рецепторе и канале.

К физическим методам транспортировки антитела или его действующего фрагмента через гематоэнцефалитный барьер относятся, но ими не ограничиваются, обход гематоэнцефалитного барьера, или создание проходов в гематоэнцефалитном барьере. К методам обхода относятся, но ими не ограничиваются, прямая инъекция в мозг (см., например, Papanastassiou и др., Gene Therapy 9, 2002, cc.398-406) и имплантация устройства по доставке в мозг (см., например. Gill и др., Nature Med. 9, 2003, cc.589-595, и Gliadel Wafers™, фирма Guildford Pharmaceutical). Методы по созданию проходов в барьере включают, но ими не ограничиваются, ультразвук (см., например, US 2002/0038086), осмотическое давление (например, введение гипертонического маннита (Neuwelt E.А. в кн.: «Implication of the Blood-Brain Barrier и its Manipulation», 1989, тт.1 и 2, изд. Plenum Press, Нью-Йорк)), обеспечение проницаемости, например, брадикинином или агентом обеспечения проницаемости А-7 (см., например, US 5112596, 5268164, 5506206 и 5686416), и трансфекцией нейронов, которые проходят гематоэнцефалитный барьер векторами, содержащими гены, которые кодируют антитело или антигенсвязывающий фрагмент (см., например, US 2003/0083299).

Основанные на липидах способы транспортировки антитела или его действующего фрагмента через гематоэнцефалитный барьер включают, но ими не ограничиваются, инкапсулирование антитела или его действующего фрагмента в липосомы, которые соединены с его действующими фрагментами, которые связываются с рецепторами на эндотелии сосудов гематоэнцефалитного барьера (см., например, US 20020025313), и покрытие антителом или его действующим фрагментом частиц липопротеина низкой плотности (см., например, US 20040204354) или аполипопротеина Е (см., например, US 20040131692).

Методы транспортировки антитела или его действующего фрагмента через гематоэнцефалитный барьер, основанные на рецепторе и канале, включают, но ими не ограничиваются, применение глюкокортикоидных блокаторов для повышения проницаемости через гематоэнцефалитный барьер (см., например, US 2002/0065259, 2003/0162695 и 2005/0124533), активирование калиевых каналов (см., например, US 2005/0089473), ингибирование переносчиков ABC лекарственных средств (см., например, US 2003/0073713), нанесение антител с трансферином и модулирующим действием одного или нескольких рецепторов трансферина (см., например, US 2003/0129186), и катионизации антител (см., например, US 5004697).

Обнаружение/диагностика

В другом варианте осуществления настоящего изобретения предусмотрены способы и наборы для выявления и диагностики заболеваний или состояний. Эти способы включают известные иммунологические способы, обычно используемые для выявления или количественной оценки веществ в биологических образцах или в условиях in situ.

Диагностика связанного с амилоидом заболевания или состояния у пациента может быть осуществлена путем выявления иммуноспецифического связывания моноклонального антитела по настоящему изобретению или его действующего фрагмента с эпитопом амилоидного белка в образце или in situ, которое включает приведение образца, или специфической части тела, или области тела субъекта, которые предположительно содержат амилоидный белок, в контакт с антителом, которое связывает эпитоп амилоидного белка, позволяя антителу связать амилоидный белок для формирования иммунологического комплекса, выявление формирования иммунологического комплекса и корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоидного белка в образце, или специфической части тела, или области тела.

Биологическими образцами, которые могут быть применены для диагностики связанного с амилоидом заболевания или состояния, являются, например, жидкости, например, сыворотка, плазма, слюна, желудочный секрет, слизь, спинномозговая жидкость, лимфатическая жидкость, внутриглазная жидкость и другие, или образцы тканей или клеток, полученные из организма, например, нервной ткани, мозга, сердца или сосудов. Для определения наличия или отсутствия амилоидного белка в образце может быть применен какой-либо иммуноанализ, известный специалистам в данной области. Например, могут применяться анализы, в которых используют непрямые способы выявления, используя вторичные реагенты для выявления, ELISA и методы иммунопреципитации и агглютинации (см., например, кн. Harlow и Lane «Antibodies: A Laboratory Manual», изд. Cold Spring Harbor Laboratory, 1988, Нью-Йорк, cc.555-612). Подробное описание таких анализов приводят, например, в WO96/13590 и WO96/29605.

Для диагностики in situ антитело или какая-либо его действующая и функциональная часть могут вводиться в диагностируемый организм способами, известными в данной области, например, внутривенно, интраназально, внутрибрюшинно, подоболочечно, внутриартериально таким образом, что может произойти специфическое связывание антитела по настоящему изобретению с областью эпитопа амилоидного белка. Комплекс антитело/антиген может быть определен с помощью метки, присоединенной к антителу или его функциональному фрагменту.

Иммуноисследования, применяемые для диагностики, обычно основаны на меченых антигенах, антителах или на вторичных реагентах для выявления. На такие белки или реагенты может быть нанесена метка в виде соединений, обычно известных специалистам в данной области, включая ферменты, радиоизотопы и флуоресцентные, люминесцентные и хромогенные вещества, включая окрашенные частицы, например, коллоидное золото и гранулы латекса. Из таких соединений радиоактивная метка может применяться почти для всех типов анализов с большинством вариаций. Метки в виде конъюгированного фермента особенно применимы, если радиоактивности следует избежать или если нужно быстро получить результаты. Флюорохромы, хотя для их использования требуется дорогое оборудование, представляют очень чувствительный метод выявления. Антитела, применимые в таких анализах, включают моноклональные антитела, поликлональные антитела и поликлональные антитела аффинной очистки.

В другом варианте, антитело может быть мечено косвенно путем реакции с мечеными веществами, проявляющими сродство с иммуноглобулином, например, белком А или G, или вторыми антителами. Антитело может быть объединено со вторым веществом и выявлено с меченым третьим веществом, имеющим сродство со вторым веществом, объединенным с антителом. Например, антитело может быть объединено с биотином и конъюгат антитело-биотин выявляют, используя меченый авидин или стрептавидин. Сходным образом антитело может быть конъюгировано с гаптеном, и конъюгат антитело-гаптен выявляют, используя меченое анти-гаптеновое антитело.

Специалистам в данной области известны указанные и другие соответствующие метки, которые могут применяться в соответствии с настоящим изобретением. Связывание таких меток с антителами или их фрагментами может быть выполнено, используя стандартные методики, обычно известные специалистам в данной области. Типичные методики описаны Kennedy J.Н. и др., Clin. Chim. Acta 70, 1976, cc.1-31, и Schurs A.H.W.M. и др., Clin. Chim Acta 81, 1977, cc.1-40. Методики соединения, указанные в приведенных ссылках, представляют метод с применением глутаральдегида, метод с применением периодата, метод с применением дималеимида и другие, каждый из которых включен в настоящее изобретение в виде ссылки.

В современных иммуноисследованиях используют метод двойных антител для обнаружения наличия определенного соединения, причем антитело метят косвенным образом путем взаимодействия со вторым антителом, на которое была нанесена выявляемая метка. Второе антитело предпочтительно является таким антителом, которое связывается с антителами животного, из которого моноклональное антитело получено. Иначе говоря, если моноклональное антитело является антителом мыши, тогда второе антитело с нанесенной меткой является антителом против антитела мыши. Для моноклонального антитела, используемого в описанном ниже анализе, такая метка предпочтительно представляет гранулы, покрытые антителом, особенно магнитные гранулы. Для поликлонального антитела, применяемого в описанном в настоящем изобретении иммуноанализе, предпочтительно меткой является выявляемая молекула, например, радиоактивное, флуоресцентное или электрохемилюминесцентное вещество.

Другая система двойного антитела, которую часто относят к формату систем быстрого действия, поскольку они адаптированы для быстрого определения наличия определяемого вещества, также может быть применена в рамках охвата настоящего изобретения. Система требует высокого сродства между антителом и определяемым веществом. По одному из вариантов осуществления настоящего изобретения определяют наличие амилоидного белка, используя пару антител, каждое специфичное для амилоидного белка. Одно из указанных пар антител в настоящем изобретении обозначают «идентифицирующим антителом», а второе из пары антител в настоящем изобретении обозначают «иммобилизованным антителом». Моноклональное антитело по настоящему изобретению может применяться или в качестве иммобилизованного антитела, или в качестве идентифицирующего антитела. Моноклональное антитело по настоящему изобретению также может применяться и в качестве идентифицирующего, и в качестве иммобилизованного антитела в одном исследовании. В одном из варианте осуществления настоящего изобретения, таким образом, используют метод сэндвича двойного антитела для выявления амилоидного белка в образце биологической жидкости. В этом методе исследуемое вещество (амилоидный белок) оказывается «в сэндвиче» - между иммобилизованным и идентифицирующим антителами, иммобилизованное антитело становится обратимо иммобилизованным на твердой основе. Идентифицирующее антитело может содержать выявляемую метку для идентификации наличия выявляемого сэндвича антитела-выявляемого вещества, и, таким образом, наличия выявляемого вещества.

Примерами твердых веществ являются, но ими не ограничиваются, планшеты для микротитрований, пробирки из полистерола, магнитные, пластиковые или стеклянные гранулы и пластины, известные специалистам в области радиоиммуноанализа и ферментного иммуноанализа. Способы соединения антител с твердой фазой хорошо известны специалистам в данной области. Ранее ряд пористых материалов, например, нейлона, нитроцеллюлозы, ацетата целлюлозы, стеклянных волокон и других пористых полимеров использовали в качестве твердых основ.

Настоящее изобретение также относится к диагностическому набору для выявления амилоидного белка в биологическом образце, который включает описанную выше композицию. Кроме того, настоящее изобретение относится к указанному диагностическому набору, который помимо указанной выше композиции также включает описанный выше реагент для выявления. Понятие «диагностический набор» относится в целом к какому-либо диагностическому набору, известному в данной области. Более конкретно это понятие относится к диагностическому набору, описанному Zrein и др. (1998).

В еще одном объекте настоящего изобретения предусмотрены новые иммунозонды и наборы для исследования и диагностики связанных с амилоидом заболеваний и состояний, включающие антитела по настоящему изобретению. Для иммунозондов антитела непосредственно или опосредованно присоединяют к соответствующей репортерной молекуле, например, к ферменту или радионуклиду. Набор для исследования включает контейнер, содержащий одно или несколько антител по настоящему изобретению и инструкции для применения антител для связывания амилоидного белка для формирования иммунологического комплекса и выявления формирования иммунологического комплекса, например, наличие или отсутствие иммунологического комплекса коррелирует с наличием или отсутствием амилоидного белка.

Примеры

Материалы

Создание и наработка мышиного моноклонального антитела ACI-01-Ab7C2 (называемого в настоящем изобретении «mC2»; гуманизированное антитело С2 обозначается «hC2») описаны в одновременно рассматриваемой патентной заявке ЕР 05 02 7092.5, поданной 12.12.2005, описание которой включено в настоящее изобретение в виде ссылки.

Клетки гибридомы FP-12H3-C2, вырабатывающие моноклональное антитело мыши ACI-01-Ab7C2 (называемое в настоящем изобретении «mC2»; гуманизированное антитело С2 обозначается «hC2»), депонированы 01 декабря 2005 года в связи с одновременно рассматриваемой патентной заявкой ЕР05027092.5 в коллекции Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ) в Брауншвейге по адресу: Mascheroder Weg 1 В, 38124 Braunschweig, согласно Будапештскому договору о международном признании депонирования микроорганизмов под номером DSM ACC2750.

Клетки гибридомы культивируют в среде Игла в модификации Дульбекко (Dulbecco's modified Eagle Medium - DMEM), обогащенной 10% фетальной сыворотки теленка и антибиотиками (пенициллином/стрептомицином). Изотип полученного антитела проверяют и подтверждают, что согласно ожиданию это мышиное антитело IgG2b/каппа.

Анализ

Метод ELISA для определения связывания амилоида-бета обеспечивает надежное измерение эффективности антитела С2. Положительным контролем антитела является мышиное антитело FP-12H3-C2 (фирма Genovac, номер в каталоге AK379/01) и стандартное антитело 1560 фирмы Chemicon (номер в каталоге 0508008791).

Выбор константных областей человека

Поскольку для клинического антитела-кандидата восстановление иммунной системы не является желательным, выбранной константной областью человека для тяжелой цепи является IgG4 человека с модификацией в виде замены серина в положении 228 в шарнирной области на пролин (HuIgG4 Ser-Pro). Эта мутация стабилизирует межцепочечную дисульфидную связь и предупреждает формирование половинных молекул, которые могут быть в препаратах нативного IgG4 человека. У антитела, экспрессируемого вырабатываемыми клеточными линиями, может также быть удален концевой лизин. Последовательности константных областей человека HuIgG4 Ser-Pro и каппа человека представлены в виде SEQ ID NO:17 и 14, соответственно.

Пример 1. Клонирование и секвенирование вариабельных областей антитела

Суммарную РНК получают из 3×106 клеток гибридомы (одной колбы Т 175), используя мини-набор Qiagen RNeasy mini kit (номер в каталога 74104). РНК элюируют в 50 мкл воды и наносят в 1,2% агарозный гель. Кондиционную среду от клеток сохраняют, и образцы используют для тестирования в анализе действия антитела.

VH и VK кДНК получают, используя обратную транскриптазу с праймерами мышиного IgG и константной области κ. Первую цепь кДНК амплифицируют методом ПЦП, используя большой набор праймеров сигнальных последовательностей. Амплифицированные ДНК очищают в геле и клонируют в векторе pGem® Т Easy (фирма Promega). Полученные клоны VH и VK подвергают скринингу на инсерты ожидаемого размера методом ПЦР, и последовательность ДНК выбранных клонов определяют автоматическим секвенированием ДНК. Расположения комплементарно детерминируемых областей (complementarity determining regions - CDR) в последовательностях определяют относительно последовательностей других антител (Kabat EA и др., 1991). В настоящей заявке используют нумерацию Kabat для вариабельных областей антитела, следовательно, номера остатков могут отличаться от прямой линейной нумерации.

Последовательность ДНК и логически установленная аминокислотная последовательность mC2 VK представлены в виде SEQ ID NO:29 и 27, соответственно. Четыре клона вырабатывают указанную идентичную продуктивную последовательность. Непродуктивную отклоняющуюся последовательность VK, которая образуется от партнера гибридомы по слиянию, также обнаруживают у ряда клонов.

Для mC2 VH, выделяют две разные продуктивные последовательности. Последовательность mC2 VH AF (см. SEQ ID NO:30) обнаруживают в общей сложности у 29 клонов, с 14 заменами единичных оснований в отдельных клонах. Последовательность mC2 VH В обнаруживают в общей сложности у 8 клонов. Пять из них представляют последовательность большинства, последовательности трех других клонов представляют ее вариации. Возможно, что эти сходные последовательности VH В возникают в качестве артефакта ПЦР амплификации. Непродуктивную нарушенную последовательность VH также получают из гибридомы С2 и приписывают дефектному сочленению V-D-J.

Для того чтобы определить правильную действующую последовательность mC2 VH, получают два химерных антитела с двумя разными последовательностями VH, AF и В, комбинированными с mC2 VK, проверяемых на правильное действие антитела.

Пример 2. Конструирование генов химерного антитела

Химерное антитело человека в наиболее общей форме состоит из константных областей человека, связанных с мышиными (или другими, но не принадлежащими человеку) вариабельными областями. Химерное антитело представляет весьма полезный инструмент, во-первых, для подтверждения, что были идентифицированы корректные вариабельные области, во-вторых, для применения в качестве контрольного антитела в антигенсвязывающих исследованиях с теми же эффекторными функциями, используя те же реагенты вторичного обнаружения, что и гуманизированное или сконструированное антитело, и также могут применяться для исследования фармакокинетики и других свойств константных областей человека относительно определенной мишени для антитела.

Конструируют два вектора экспрессии химерной тяжелой цепи, состоящие из mC2 VH AF или mC2 VH В вариабельных областей, связанных с константной областью HuIgG4 (Ser-Pro) в векторе экспрессии pSVgpt (фиг.1). Основой является плазмида pSV2gpt (Mulligan и Berg, 1980), которая включает ген устойчивости к ампициллину для отбора в бактериальных клетках, ген gpt для отбора в клетках млекопитающих, энхансерную область тяжелой цепи иммуноглобулина мыши, геномную последовательность, кодирующую ген константной области и SV40 поли-А последовательности. Вариабельную область тяжелой цепи для экспрессии инсертируют в качестве фрагмента HindIII - BamHI.

Вектор химерной легкой цепи конструируют, совмещая С2 VK, связанный с константной областью С каппа человека в векторе экспрессии pSVhyg (фиг.2). Плазмида pSVhyg включает ген устойчивости к ампициллину для отбора в бактериальных клетках, ген hyg для отбора в клетках млекопитающих, энхансерную область тяжелой цепи иммуноглобулина мыши, геномную последовательность, кодирующую ген константной области каппа и включающую энхансер каппа и SV40 поли-А последовательности. Вариабельная область легкой цепи для экспрессии инсертируют в виде фрагмента HindIII - BamHI.

Кассеты экспрессии для последовательностей мыши С2 VH и VK конструируют путем добавления 5' фланкирующей последовательности, включающей лидерный сигнальный пептид, лидерный интрон и промотор иммуноглобулина мыши, а также 3' фланкирующей последовательности, включающей сайт сплайсирования и интронную последовательность, используя векторы VH-PCR1 и VK-PCR1 в качестве матриц (Riechmann и др., 1988). Корректность последовательности ДНК подтверждают для VH и VK в химерных векторах экспрессии. Последовательности ДНК и аминокислот VH и VK генов в кассетах экспрессии показаны на фиг.3 и 4.

Пример 3. Экспрессия химерных антител

3.1 Экспрессия в стабильных линиях клеток

Для экспрессии антитела используют линию клеток NS0 миеломы мыши, не продуцирующих иммуноглобулин, полученную из Европейской коллекции культур клеток животных, Нортон, Великобритания (European Collection of Animal Cell Cultures - ЕСАСС, номер в каталоге 85110503). Векторы экспрессии тяжелой и легкой цепи совместно трансфецируют в клетки NS0 путем электропорации. Колонии, экспрессирующие ген gpt, отбирают в среде Игла в модификации Дульбекко (Dulbecco's Modified Eagle's Medium - DMEM), обогащенной 10% фетальной сыворотки теленка (ФСТ), 0,8 мкг/мл микофеноловой кислоты и 250 мкг/мл ксантина. Проводят скрининг трансфецированных клонов на выработку антитела человека методом ELISA на IgG человека. Линии клеток, секретирующих антитело, нарабатывают, и наиболее продуктивные клоны отбирают и замораживают в жидком азоте. Наиболее продуктивные линии клеток для каждого антитела нарабатывают в среде, согласно указанному выше, но только с 5% ФСТ. Химерные антитела очищают, используя Prosep®-A (фирма Bioprocessing Ltd). Концентрацию определяют методом ELISA для IgGx антитела человека. Антитела также анализируют методом SDS-PAGE.

3.2. Кратковременная экспрессия химерных антител

Для ускорения тестирования разных химерных антител используют кратковременную экспрессию для быстрой выработки малых количеств супернатантов клеток, содержащих рекомбинантное антитело для тестирования. Кассеты экспрессии mC2 VH и VK переносят на векторы, основанные на pcDNA3.1 (фирма Invitrogen) для временной экспрессии. Вектор тяжелой цепи включает константную область IgG человека. Вектор легкой цепи включает константную область каппа человека. И mC2 VH AF, и mC2 VH В трансфецируют с mC2 VK в эмбриональные клетки почки человека (HEK 298) с реагентом Lipofectamine 2000 (фирма Invitrogen, номер в каталоге 11668) по протоколу производителя. Кондиционированную среду от клеток собирают через 3 суток после трансфекции. Количество вырабатываемого антитела определяют методом ELISA для IgGK антитела человека.

Пример 4. Действие химерных С2 антител

4.1. Действие химерных С2 антител, вырабатываемых путем временной трансфекции

Образцы кондиционированной среды после временной трансфекции тестируют на два разных химерных антитела методом ELISA по связыванию амилоида-бета. Результаты четко показывают, что С2 VH AF является корректной последовательностью. Химерное антитело С2 VH AF/C2 VK связывается хорошо в данном анализе, но С2 VH B/C2 VK не проявляет какого-либо связывания. Контрольное антитело мыши Chemicon 1560 показывает хорошее связывание, но связывание предоставленным очищенным мышиным антителом С2 было низким. Следует отметить, что другое вторичное антитело применяют для мышиных антител с мышиными константными областями по сравнению с химерными антителами с константными областями человека, поэтому результаты непосредственно нельзя сопоставить. Позднее было установлено, что кондиционированная среда от гибридомы С2 в настоящем анализе показывает хороший результат.

4.2. Действие очищенных химерных С2 антител

Два разных С2 химерных антитела очищают от стабильных линий клеток NSO согласно описанию и тестируют методом ELISA, используя амилоид-бета. Полученные результаты находятся в соответствии с результатами, полученными с временно экспрессированным антителом. Антитело С2 ChVH AF/ChVK связывается хорошо в методе ELISA, а антитело С2 ChVH B/ChVK не связывается совсем.

Пример 5. Конструкция генов гуманизированного С2 антитела

Аминокислотные последовательности mC2 VH и VK сравнивают с последовательностями VH и VK антитела грызуна по базам данных NCBI и Kabat.

5.1. Вариабельная область легкой цепи

Наиболее близким геном зародышевой линии мыши к mC2 VK является ген bb1, локус MMU231201, (Schable и др., 1999). Только две аминокислоты отличаются от указанной последовательности зародышевой линии, которые обе расположены в CDRL1. Установлены зрелые антитела мыши с близкой, но не идентичной последовательностью. Некоторые идентичны CDRL2 и идентичны CDRL3, но последовательность CDRL1 в антителе mC2 представляется уникальной. mC2 VK может быть по классификации Kabat отнесена к подгруппе MuVKII. Положение 87 в mC2 VK скорее означает F, чем Y, что более свойственно в данной подгруппе, показывая, что этот остаток каркасного участка может быть важен для действия антитела. Сравнение с последовательностями VK зародышевой линии человека показывает, что гены из подгруппы VKII наилучшим образом совпадают с mC2 VK (Сох и др., 1994). Последовательность DPK15 вместе с областью J HuJK1 человека выбирают для обеспечения акцепторный последовательности каркасного участка для гуманизированной последовательности VK.

Конструируют четыре гуманизированные последовательности VK. C2HuVK1 состоит из mC2 VK областей CDR с каркасными участками от DPK 15 и JK1 человека. В версиях 2, 3 и 4 остатки мыши замещены в каркасном участке по положениям 45, или 87, или по обоим. Остаток 45 может быть вовлечен в поддержку конформации областей CDR. Остаток 87 локализован на границе раздела доменов VH и VK. Следовательно, эти остатки могут быть критическими для поддержания связывания антитела.

Положения и изменения, которые были произведены в областях каркасных участков легкой цепи, представлены в табл.1. Сравнение гуманизированных последовательностей с последовательностью mC2 VK, а также с DPK15 и JK1 человека.

5.2. Вариабельная область тяжелой цепи

Наиболее близким геном зародышевой линии мыши к mC2 VH AF является ген VH7183, локус AF120466, (Langdon и др., 2000). Сравнение показано на фиг.5. Девять аминокислот отличаются от этой последовательности зародышевой линии, большинство расположено в CDR2. Обнаружены зрелые антитела мыши с идентичной или близкой (отличие в одном остатке) областью CDR1 или с близкой областью CDR2 (отличие в одном остатке), но не обнаружено ни одного со всеми тремя CDR, идентичными mC2 VH AF. Область CDR3 антитела mC2 необычно короткая, состоящая только из трех остатков. Однако другие антитела обнаружены в базе данных с CDR3 данной длины. Последовательность mC2 VH AF может быть отнесена по системе Kabat к подгруппе MuVHIIID. Остаток 47 в mC2 VH означает скорее L, чем более распространенный W, а остаток 94 означает скорее S, чем в норме R, свидетельствуя, что такие остатки в каркасном участке могут быть важны для действия антитела. Сравнение с последовательностями VH зародышевой линии человека показывает, что гены из подгруппы VHIII наилучшим образом сочетаются с mC2 VH. Последовательность DP54 вместе с областью J HuJH6 человека отбирают для обеспечения акцепторных последовательностей каркасного участка для гуманизированной VH.

Конструируют четыре гуманизированные последовательности VH. C2HuVH1 состоит из областей CDR mC2 VH AF с каркасными участками от DP54 и HuJH6. В версиях 2, 3 и 4 мышиные остатки были замещены в каркасном участке по положениям 47 или 94, или по обоим. Остаток 47 в каркасном участке 2 создает контакт и с областями CDR, и с доменом VK. Остаток 94 может участвовать в поддержке конформации областей CDR. Следовательно, эти остатки могут быть критическими для поддержания связывания антитела.

Положения и изменения, произведенные в областях каркасного участка тяжелой цепи, показаны в табл.2.

Пример 6. Конструирование генов гуманизированного антитела

Модифицированные вариабельные области конструируют методом перекрывающейся ПЦР рекомбинации. Кассеты экспрессии для химерного антитела, С2 ChVH AF и С2 ChVK используют в качестве матриц для мутагенеза областей каркасного участка для требуемых последовательностей. Синтезируют наборы пар мутагенных праймеров, которые охватывают области, подвергаемые изменению. Полученные кассеты экспрессии гуманизированных VH и VK клонируют в pUC19 и подтверждают, что целая последовательность ДНК корректна и для VH, и для VK. Модифицированные гены V-области тяжелой и легкой цепи удаляют из pUC19 в виде кассет экспрессии HindIII - BamHI. Их трансферируют на векторы экспрессии pSVgpt и pSVhyg, которые включают Ser-pro или к константные области IgG4 человека, соответственно, как и для векторов химерного антитела. Подтверждают, что последовательность ДНК корректна для гуманизированных VH и VK в векторах экспрессии.

Пример 7. Экспрессия гуманизированных антител

7.1. Экспрессия в стабильных клеточных линиях

Векторы экспрессии гуманизированных тяжелой и легкой цепей совместно трансфецируют в клетки NS0 путем электропорации, как и для экспрессии химерных антител. Линии клеток, вырабатывающие антитела, отбирают и размножают, гуманизированные антитела очищают, точно так же, как химерное антитело. Очищенные антитела анализируют методом SDS-PAGE.

7.2. Краткосрочная экспрессия гуманизированных антител

Для ускорения тестирования разных гуманизированных конструкций VH и VK, экспрессирующие кассеты гуманизированных VH и VK антитела С2 также переносят на векторы для краткосрочной экспрессии, описанной в разделе 7.2. Четыре конструкции VK гуманизированного антитела С2 совместно трансфецируют с конструкцией VH химерного антитела С2 в клетки HEK293. Подобным образом четыре конструкции VH гуманизированного антитела С2 совместно трансфецируют с конструкцией VK химерного антитела С2 в клетки HEK293. Кондиционированную среду от клеток собирают через трое суток после трансфекции. Количество вырабатываемого антитела определяют методом ELISA для антитела IgGκ человека.

Пример 8. Действие гуманизированных антител С2

8.1. Действие гуманизированных антител С2, выработанных путем краткосрочной трансфекции

Образцы кондиционированной среды при краткосрочной трансфекции тестируют методом амилоид-бета ELISA. Полученные результаты четко показывают, что конструкции гуманизированной VH С2 HuVH AF версий 2 и 4 являются функциональными при комбинации с каппа цепью химерного антитела С2, и сопоставимы с химерным С2 антителом в настоящем исследовании. Напротив, у антител, содержащих С2 HuVH AF версии 1 и 3, объединенные с цепью химерного антитела С2 каппа, в данном анализе показывают полное отсутствие связывания. Это означает, что замещение остатка мыши по положению 94 важно для действия антитела. Антитела, содержащие тяжелую цепь химерного антитела С2, комбинированные с четырьмя цепями гуманизированного антитела С2 каппа, все показывают хорошее связывание, сопоставимое со связыванием химерного антитела при использовании метода ELISA.

8.2. Действие очищенного гуманизированного антитела С2

Восемь разных гуманизированных С2 антител, включающих все комбинации двух гуманизированных тяжелых цепей и четырех гуманизированных легких цепей, очищают от стабильной линии клеток NS0 согласно описанному, и тестируют, используя метод амилоид-бета ELISA (фиг.6).

Полученные результаты четко указывают, что С2 HuVH4 антитела действуют лучше в анализе, чем С2 HuVH2 антитела. Из антител С2 HuVH2 антитело С2 HuVH2/HuVK3 показывает наилучшее связывание, но оно примерно в 2 раза ниже по сравнению с химерным контрольным антителом С2 ChVHAF/ChVK. Действие С2 HuVH2/HuVK2 в четыре-пять раз ниже по сравнению с контролем. Действие антител, включающих C2HuVH4 с четырьмя разными гуманизированными легкими цепями, сходно. Наибольшее действие устанавливают у C2HuVH4/HuVK1, и все четыре антитела близки к контрольному химерному антителу в данном анализе.

Пример 9. Модификации области CDRL2

9.1. Конструирование легкой цепи с модифицированной областью CDR 2

Выше указано, что многие антитела имеют ту же последовательность CDRL2 («KVSNRFS»), что и антитело С2. Было решено исследовать, может ли область CDRL2 быть немного модифицирована без неблагоприятного воздействия на действие антитела. Были выбраны две консервативные замены: R для K в положении 50 и S для N в положении 53. Две разные последовательности CDRL2 следовательно представляют «RVSNRFS» и «KVSSRFS». Они были включены в последовательность VK мыши без других изменений в виде mC2 VK-R и mC2 VK-S, соответственно.

9.2. Краткосрочная экспрессия модифицированного антитела CDRL2

Две конструкции легкой цепи антитела С2 с модифицированной областью CDRL2, описанной в разделе 11.2.1, клонируют в вектор легкой цепи для кратковременной экспрессии. Каждую конструкцию совместно трансфецируют с вектором VH химерного антитела С2 в клетки HEK293. Кондиционированную среду от клеток собирают через трое суток после трансфекции. Количество вырабатываемого антитела определяют методом ELISA для IgGκ антитела человека.

9.3 Действие антитела С2 с модифицированной областью CDRL2

Образцы кондиционированной среды при краткосрочной трансфекции mC2 VK с модифицированной областью CDRL2, комбинированной с VH антитела mC2, тестируют методом амилоид-бета ELISA (фиг.7). Оба, и VK-R, и VK-S антитела, сравнимы с химерным антителом С2, указывая, что индивидуальные выбранные модификации CDRL2 существенно не влияют на действие антитела в этом анализе.

Пример 10. Определение сродства

Для оценки связывающей специфичности и сродства мышиного (ACI-01-Ab-7-С2) химерного (AF) и гуманизированного антитела (H4K1, H4K4), проводят анализ BIACORE.RTM., используя амилоид-бета 1-42 мономеры и волокна в качестве антигена, иммобилизованного на чипе СМ5. Технология BIACORE.RTM. использует изменения в показателе преломления на поверхностном слое при связывании антитела с антигеном, иммобилизованным на слое. Связывание определяют с помощью поверхностного плазменного резонанса (surface plasmon resonance - SPR) света лазера, отраженного от поверхности. Анализ кинетики падающего и отраженного сигнала позволяет различать неспецифическое и специфическое взаимодействие. Применяют концентрацию антитела в диапазоне от 0,05 мкМ до 1,0 мкМ.

Таблица 1.
Связывающая специфичность и сродство мышиных (ACI-01-Ab-7-С2) химерных (AF) и гуманизированных антител (H4K1; H4K4) в отношении амилоид-бета мономеров и фибрилл.
Мономеры Волокна
ka (1/мсек) kd (1/сек) KD (М) ka (1/мсек) kd (1/сек) KD (М)
Мышиное ACI-01-Ab-7-С2 1,8Е+04 2,7Е-03 1,5Е-07 2,4Е+04 9,9Е-04 4,1Е-08
химерное AF 4,7Е+04 9,5Е-04 2Е-08 5,1Е+04 3,3Е-04 6,5Е-09
гуманизированное H4K1 5,0Е+04 9,5Е-04 1,9Е-08 4,9Е+04 2,3Е-04 4,7Е-09
гуманизированное H4K4 2,5Е+04 4,4Е-04 1,8Е-08 1,3Е+05 3,0Е-04 2,3Е-09

Пример 11. Иммуногистохимический анализ связывания

11.1. Срезы мозга человека

Мозг здоровых людей, больных на стадии, предшествующей БА без проявления слабоумия, и больных БА получают из Университетской клиники в Бонне после соблюдения этических норм. Мозг фиксируют в формальдегиде и область гиппокампа обезвоживают, погружая в парафин, затем с помощью микротома нарезают срезы толщиной 5 мкм. Парафиновые срезы хранят при комнатной температуре до применения. В случае свежего материала нарезают криосрезы толщиной 5 мкм криостатом и срезы хранят при -80°С до использования.

11.2. Иммуногистохимия

Из парафиновых срезов удаляют парафин и проводят обводнение путем погружения срезов в ксилен, затем в 100% этанол, 90% этанол и 70% этанол. Фон понижают путем 30 мин инкубирования в 10% Н2О2, 10% метаноле в воде. Восстановление антигена производят путем инкубирования срезов в 100% муравьиной кислоте в течение 3 мин. После 3 промываний в трисе в буферном солевом растворе (TBS, рН 7,5), неспецифическую метку блокируют 2-часовым инкубированием срезов в 10% БСА, 0,25% Triton Х-100 в TBS. После промывки (3 промывки в TBS) блокируют эндогенные антитела путем добавления немеченого антитела против IgG человека (фирма Biomeda) и инкубирования срезов во влажных камерах в течение ночи при комнатной температуре. Еще через 3 промывания первичное анти-амилоидное антитело человека добавляют к среде и инкубируют еще 24 ч при комнатной температуре. После промывания меченое щелочной фосфатазой вторичное антитело против IgG человека (фирма Sigma) добавляют к срезам и инкубируют в течение 2 ч при комнатной температуре. После промывания срезы обрабатывают красителем Liquid permanent Red (фирма Dakocytomation), промывают водой и высушивают на воздухе до закрепления с постоянной поддерживающей средой (корбитбальзамом).

Криосрезы фиксируют в метаноле в течение 30 мин при -80°С и снижают фон добавлением Н2О2 к холодному метанолу до конечной концентрации 10% и инкубированием в течение 30 мин при комнатной температуре. После трех промываний в трис-солевом буфере (TBS, рН 7,5), неспецифическую метку блокируют путем 2-часового инкубирования срезов в 10% БСА, 0,25% Triton X 100 в TBS согласно указанному выше и проводят окрашивание методом, описанным выше.

Срезы исследуют с помощью микроскопа Leica DMLB и фотографируют, используя камеру Leica DC500 и программное обеспечение Leica FireCam 1.2.0.

Оба антитела человека А и С метят бляшки в мозге больных БА (фиг.8). Мечеными являются и диффузные, и коровые бляшки. Кроме того, диффузные бляшки у пациентов без слабоумия, находящихся на стадии, предшествующей проявлению БА, также могут быть выявлены с помощью антител А и С. Амилоид при церебральной амилоидной ангиопатии (cerebral амилоидного angiopathy - САА) несет метку обоих антител, и некоторое окрашивание нейронов, которое может соответствовать внутриклеточному амилоиду, также было обнаружено. Метку не выявляют в контрольных образцах мозга от здоровых пациентов. Бляшки могут быть обнаружены на парафиновых срезах, предварительно обработанных муравьиной кислотой, но не было меченых бляшек на парафиновых срезах без предварительной обработки муравьиной кислотой и на криосрезах, фиксированных в метаноле. Антитело В человека не выявляет бляшек на парафиновых срезах, и мышиное антитело не окрашивает ни парафиновые, ни криосрезы мозга человека. Аббревиатуры:

А = связывающее химерное антитело AF (IgG4)

В = несвязывающее химерное антитело В (IgG4)

С = связывающее гуманизированное антитело H4K1 (IgG4)

Мышь = ACI-01-Ab-С2 мышиное антитело (IgG2b)

Пример 12. Функциональность антитела mC2 на амилоидных волокнах

12.1. Модификация конформации волокон Аβ1-42 и инициация дезагрегирования после связывания антитела mC2

Для оценки механизма, с помощью которого антитело может дезагрегировать заранее сформированные бета-амилоидные (Аβ1-42) волокна, проводят в непосредственном противопоставлении сравнение тиофлавин-Т (Th-Т) флуоресцентного анализа, измеряя дезагрегирование, и твердотельного ядерно-магнитного резонанса (ЯМР) U-13С тирозин 10 и валин 12-меченого Aβ1-42 пептида, анализируя вторичную конформацию (фиг.9А). Антитело mC2 растворяет 35,4% заранее сформированные Аβ1-42 волокна и одновременно индуцирует сдвиг вторичной конформации от бета-слоя к произвольной спирали. Снижение в популяции конформации бета-листов в сторону произвольной спирали составляет примерно 35% и следовательно хорошо согласуется с измерением, используя флуоресцентный Th-T анализ (фиг.9Б). Эти данные показывают, что связывание антитела mC2 инициирует переход вторичной структуры, в результате которого возможно происходит дестабилизация параллельной межмолекулярной сборки бета-листов, вызывающая разрушение удлиненных волокон и образование более коротких фрагментов.

12.2. Конформационно-зависимое связывающее сродство антитела mC2

Поскольку из научной литературы известно, что пропорция связывающей энергии антитела-антигена может быть использована для зависящей от энергии модификации конформации антигена (Blond и Goldberg, 1987), проводят сравнительный эксперимент по связывающему сродству С2 антитела с целым Aβ1-42 белком и с меньшим, длиной в девять аминокислот, пептидом, включающим эпитоп (фиг.10). Для такого сравнения сродство гуманизированного антитела С2 анализируют методом ELISA, используя биотинилированные пептиды, покрывая полную аминокислотную последовательность эпитопа С2 (от фирмы Mimotopes, продажа фирмой ANAWA Trading SA), и биотинилированный полный Aβ1-42 пептид (фирма Bachem). Анализ проводят по инструкциям производителя (фирма Mimotopes). Из фиг.10 следует, что антитело связывается со связывающим сродством, которое на 36,0% выше сродства с пептидом, включающим его специфический эпитоп (аминокислоты 13-21 последовательности Аβ1-42), по сравнению с целым белком Aβ1-42. Из этого следует, что различие в энергии связывающего сродства используют для переноса поглощающей энергии вторичной конформации амилоидного белка для презентации антигена в более приемлемом положении для взаимодействия с антителом. Это объясняет, почему сродство антитела ниже к нативному белку (целому амилоидному белку), а не к выделенной субъединице.

Пример 13. Воздействие антиамилоидного антитела hC2 на агрегирование амилоид-бета 1-42 пептида

Для оценки способности гуманизированного моноклонального антитела hC2 против амилоида-бета человека опосредовать антиагрегирующее и дезагрегирующее воздействие на амилоид-бета (Аβ) проводят тиофлавин Т спектрофлуоресцентный анализ.

13.1. Исследование подавления агрегирования

Лиофилизированный порошок Aβ1-42 восстанавливают в гексафторизопропаноле (hexafluoroisopropanol - HFIP) до концентрации 1 мМ. Пептидный раствор обрабатывают ультразвуком в течение 15 мин при комнатной температуре, перемешивают в течение ночи и аликвоты помещают в микроцентрифужный пробирки (без силикона). Затем HFIP выпаривают под струей аргона. Получаемую пептидную пленку высушивают под вакуумом в течение 10 мин и хранят при -80°С до использования.

Для исследования опосредованного антителом подавления агрегирования Aβ1-42 антитело hC2 предварительно разводят в ФСБ, и раствор для исследования, содержащий приведенные ниже компоненты, получают в пробирках без силикона: 3,3 или 0,33 ммоля предварительно разведенного антитела, 10 ммолей тиофлавина Т, 33 ммоля Aβ1-42 и 8,2% ДМСО. Следовательно, итоговые мольные соотношения антитела к Аβ1-42 составляют 1:10 и 1:100. Также получают соответствующие контрольные растворы. Растворы затем инкубируют в течение 24 ч при 37°С и спектральную флуоресценцию (в относительных единицах флуоресценции - ОЕФ) считывают в шести повторах в черных 384-луночных планшетах (фирма Perkin-Elmer) на спектрофлуорометре Perkin-Elmer FluoroCount. Спектральную флуоресценцию затем измеряют, и процент дезагрегирования подсчитывают методом, описанным ниже.

13.2. Исследование дезагрегирования

Для анализа опосредованной антителом дезагрегации предварительно агрегированного Аβ1-42, низкомолекулярный Aβ1-42, приготовленный согласно описанному выше, готовят в виде 110 мМ раствора в 27% ДМСО и 1х ФСБ. Этот раствор затем подвергают агрегированию при 37°С в течение 24 ч, после чего добавляют: 3,3 или 0,33 мМ предварительно разведенного антитела и 10 мМ тиофлавина Т. Это приводит к мольному соотношению 1:10 и 1:100 антитела к Аβ1-42. Этот раствор затем инкубируют дополнительно в течение 24 ч при 37°С. Спектральную флуоресценцию затем измеряют, и процент дезагрегирования подсчитывают методом, описанным ниже.

13.3. Расчеты

Подавление агрегирования или дезагрегирования выражают в виде среднего процента подавления или дезагрегирования, соответственно, ± стандартная ошибка средней величины (СО) по следующему уравнению:

П р о ц е н т п о д а в л е н и я = ( О Е Ф   п о л о ж и т е л ь н о г о  контроля-ОЕФ отрицательного контроля)- (ОЕФ образца подавления с A β 1-42-ОЕФ образца без A β 1-42) (ОЕФ положительного контроля -ОЕФ отрицательного контроля) × 100 %

13.4. Результаты

13.4.1. Подавление агрегирования Аβ1-42

13.4.1. Подавление агрегирования Aβ1-42

Подавление агрегирования Aβ1-42, используя антитело hC2, показано в табл.2 и на фиг.18. При мольном соотношении антитела к Aβ1-42 1:100 наблюдают подавление в среднем на 30% (2 независимых эксперимента), причем при мольном соотношении 1:10 подавление составляет 80% (2 независимых эксперимента, см. табл.2).

Таблица 2.
Опосредованное антителом hC2 подавление агрегирования Аβ1-42 при мольных соотношениях 1:100 и 1:10 антитела к Аβ1-42.
Антитело Мольное соотношение (антитела к Аβ1-42)
1:100 1:10
hC2 30,0±4,1% 80,4±6,9%

13.4.2. Дезагрегирование предварительно агрегированного Аβ1-42

Дезагрегирование предварительно агрегированного Аβ1-42, используя hC2 антитело, показано в табл.3 и на фиг.19. При мольном соотношении антитела к Аβ1-42 1:100 дезагрегирование в среднем составляет 24%, а при мольном соотношении 1:10 Дезагрегирование составляет 32% (3 независимых эксперимента, см. табл.3).

Таблица 3.
Опосредованное антителом hC2 Дезагрегирование предварительно агрегированного Аβ1-42 при мольных соотношениях 1:100 и 1:10 антитела к Аβ1-42.
Антитело Мольное соотношение (антитела к Aβ1-42)
1:100 1:10
hC2 23,9±4,4% 31,9±3,5%

При исследовании с тиофлавином Т могут быть показаны бифункциональные свойства анти-Аβ гуманизированного антитела hC2, а именно, подавление агрегирования Аβ1-42 в патогенную протофибриллярную конформацию и кроме того Дезагрегирование предварительно сформированных Аβ1-42 протофибрилл. Антитело hC2 ингибирует Аβ1-42 агрегирование на 80% при мольном соотношении антитела к Aβ1-42 1:10. Установлено, что способность hC2 дезагрегировать предварительно агрегированные протофибриллы Аβ1-42 в мольном соотношении 1:10 составляет 32%.

Пример 14. Конформационно-специфическое связывание mC2 с разными классами амилоидных белков

Для оценки специфичности mC2 в отношении разных стадий полимеризованного амилоидного белка, мономерного, полимерного растворимого и фибрильного амилоида, получают планшеты для метода ELISA, с нанесенным полимерным амилоидом на разных стадиях бета-амилоида (фиг.11). Мономеры получают опубликованным модифицированным способом Klein (2002), растворимый полимерный амилоид-бета получают способом Barghorn и др. (2005), а волокна получают путем инкубирования амилоида (фирма Bachem, Швейцария) с конечной концентрацией 1 мкг/мкл в Tris/HCl pH 7,4 при 37°С в течение 5 суток с последующей стадией центрифугирования (10000 об./мин в течение 5 мин). Затем амилоидные полимеры наносят на планшеты для ELISA до конечной концентрации 55 мкг/мл и проводят связывающее сродство методом ELISA с применением моноклонального антитела против мышиного IgG (фирма Jackson), меченое щелочной фосфатазой. На фиг.11 показано, что антитело mC2 связывается с повышенным сродством с растворимым полимерным амилоидом-бета по сравнению с волокнами и наименьшим образом с мономерами. Эти данные показывают, что на связывание антитела влияет амилоидный эпитоп и конформация разных амилоидных агрегатов.

Пример 15. Картирование эпитопа АС иммунного моноклонального антитела hC2

Картирование эпитопа гуманизированного моноклонального антитела hC2 проводят методом ELISA, используя три разные пептидные библиотеки. Одна библиотека включает в общей сложности 33 биотинилированных пептида, полностью перекрывающих аминокислотную (аа) последовательность Aβ1-42 (от фирмы Mimotopes, продажа фирмой ANAWA Trading SA), вторая библиотека включает биотинилированные пептиды, включая пептид 12 (аа12-20 из Аβ) из первой пептидной библиотеки, и замещение каждой аа в последовательности на аланин (см. табл.3 ниже), а третья библиотека содержит биотинилированные пептиды 13, 14 или 15 (аа 13-21, 14-22 и 15-23 из Аβ) и замещение в каждом случае последних аминокислот на аланин или на глицин для аа 21, которые уже представляют аланин (см. табл.4 ниже). Полностью биотинилированный пептид Аβ1-42 используют в качестве положительного контроля (фирма Bachem). Картирование эпитопа проводят по инструкциям производителя (фирма Mimotopes). Вкратце, планшеты с покрытием из стрептавидина (NUNC) блокируют с помощью 0,1% БСА В ФСБ в течение ночи при 4°С. После промывки ФСБ-0,05% твин 20 планшеты покрывают в течение 1 ч при комнатной температуре разными пептидами из библиотеки, разведенными в 0,1% БСА, 0,1% азиде натрия в ФСБ до конечной концентрации 10 мкМ. После промывки планшеты инкубируют в течение 1 ч при комнатной температуре с антителом hC2 или несвязывающим Аβ химерным IgG4 антителом, разбавленным до 200 нг/мл в 2% БСА, 0,1% азиде натрия в ФСБ. Планшеты промывают еще раз и инкубируют со щелочной фосфатазой, конъюгированной с козьим антителом против IgG человека в течение 1 ч при комнатной температуре. После последнего промывания планшеты инкубируют с фосфатазным субстратом (pNPP) и снимают показания при 405 нм, используя ридер для планшетов ELISA.

Было установлено, что гуманизированное моноклональное антитело hC2 связывается специфически с пептидами 12, 13, 14, 15 и 16 из первой пептидной библиотеки (фиг.17А). Эти пептиды представляют аа 12-20, 13-21, 14-22, 15-23 и 16-24 соответственно из Аβ1-42, следовательно, эпитом расположен в области 12-24 в последовательности Аβ. Вторую библиотеку с замещениями аланина используют для определения принципиально важных аминокислот (аа) для связывания с Аβ12-20 (VHHQKLVFF). Связывание антитела hC2 полностью утрачивается, если аминокислоты 16, 17, 19 или 20 замещены на аланин, свидетельствуя о том, что эти аминокислоты принципиально важны для связывания антитела с Аβ. Связывание антитела hC2 частично утрачивается, если аминокислоты 15 и 18 замещены.

Связывание также почти полностью утрачивается, если аминокислота 14 замещена на аланин, свидетельствуя о том, что аминокислота 14 также крайне важна для связывания (фиг.17Б).

В заключении используют третью библиотеку для определения, важны ли аминокислоты 21, 22 или 23 для связывания с эпитопом. Связывание антитела с аминокислотами 15-23 снижается, если аминокислота 23 замещена на аланин, следовательно, аминокислота 23 также важна для связывания. Связывание частично утрачивается, если аминокислота 21 замещается на глицин и незначительно уменьшается, если аминокислота 22 замещена на аланин (фиг.17В).

Пример 16. Нейропротекция антителом hC2

Способность антитела hC2 защищать нейроны от Абета олигомер-индуцированной дегенерации оценивают анализом in vitro. Нейроны коры эмбрионов мышей в возрасте 16,5-17,5 суток выделяют, разобщают и культивируют in vitro в среде N3-F12. Клетки выращивают в общей сложности в течение 9 суток и вносят питание на 3 сутки и в день/когда добавляют олигомер Абета, или олигомер Абета плюс анти-Абета антитело hC2. На пятые сутки («4 суток Абета») или шестые сутки («3 суток Абета») определенные лунки с клетками обрабатывают либо 2 мкмолями только одного олигомера Абета, либо комбинацией 2 мкмолей олигомера Абета и 50 мкг/мл анти-Абета антитела hC2.

Олигомер Абета получают растворением Абета 1-42 (rPeptide) в HFIP, из раствора Абета пептиды разливают аликвотами по 10 мкл при концентрации 1 мг/мл и затем выпаривают в пароуловителе в течение 30 мин и пептидные пленки хранят при -80°С до использования. При использовании пептидную пленку растворяют в 10 мкл ДМСО, затем 78,6 мкл HAMS F12 и Abeta пептидного раствора инкубируют при 4°С в течение 24-48 ч (конечная концентрация Абета составляет 25 мкМ).

Для контрольных клеток добавляют только ДМСО-F12 в том же объеме, что и Абета-ДМСО на 5 сутки, и клетки культивируют в течение дополнительных 4 суток без дополнительной обработки. На 9 сутки нейроны из всех условий культивирования фиксируют и окрашивают Tuj1 (анти-бета-тубулиновое антитело), затем окрашивают вторичными антителами, мечеными FITC, для визуализации микротрубочек и, таким образом, нейрональный процесс в целом. Результаты представлены на фиг.20.

Необработанные эмбриональные нейроны коры мыши показывают нормальные морфологические признаки через девять суток в культуре (фиг.20, крайняя левая панель). Лечение клеток олигомером Абета в течение трех суток индуцирует дегенерацию аксона и вызывает снижение общего числа аксонов (фиг.20, нижняя центральная панель), и этот эффект еще более выражен на четвертые сутки лечения (фиг.20, верхняя центральная панель). Напротив, клетки, обработанные комбинацией Абета олигомера и анти-Абета антитела hC2, выглядят сходно с контрольными клетками (фиг.20, верхняя и нижняя правые панели). Эти результаты показывают, что анти-Абета антитело hC2 способно защитить эмбриональные нейроны коры мыши от Абета-олигомер-индуцированной дегенерации.

Таблица 4.
Положения и изменения, произведенные в каркасных участках легкой цепи гуманизированного антитела С2.
Положение легкой цепи 45 87 50 53
Мышиное C2VK K F K N
Гуманизированное C2HuVK1 Q Y K N
Гуманизированное C2HuVK2 Q F K N
Гуманизированное C2HuVK3 K Y K N
Гуманизированное C2HuVK4 K F K N
Зародышевой линии человека dpk15 Q Y L N
Мышиное C2VK-R R
Мышиное C2VK-S S
Таблица 5.
Положения и изменения, произведенные в каркасных участках тяжелой цепи гуманизированного антитела С2.
Положение тяжелой цепи 47 94
Мышиное C2VHAF L S
Гуманизированное C2HuVHAF1 W R
Гуманизированное C2HHVHAF2 W S
Гуманизированное C2HuVHAF3 L R
Гуманизированное C2HHVHAF4 L S
Зародышевой линии человека DP-54 W R

В общей сложности 8 разных антител было сконструировано с легкими цепями гуманизированных антител C2HuVK1, C2HuVK2, C2HuVK3, C2HuVK4 и тяжелыми цепями C2HuVHAF4 и C2HuVHAF2.

Таблица 6.
Совокупность пептидов, используемых во второй библиотеке. Аминокислоты, важные для связывания, обозначены курсивом и подчеркнуты, а аминокислоты, безусловно важные для связывания, обозначены курсивом и жирным шрифтом.
р12-20 V H H Q K L V F F
А12 А H H Q K L V F F
А13 V А H Q K L V F F
А14 V H А Q K L V F F
А15 V H H А K L V F F
А16 V H H Q А L V F F
А17 V H H Q K А V F F
А18 V H H Q K L А F F
А19 V H H Q K L V А F
А20 V H H Q K L V F А
Номера аминокислот 12 13 14 75 16 17 18 19 20
Таблица 7.
Совокупность пептидов, используемых в третьей библиотеке. Аминокислоты, важные для связывания, обозначены курсивом и подчеркнуты, а аминокислоты, безусловно важные для связывания, обозначены курсивом и жирным шрифтом.
р13-21 Н Н Q K L V F F A
р13-21 G21 Н Н Q K L V F F G
р14-22 Н Q K L V F F A E
р14-22 А22 Н Q K L V F F A A
р15-23 Q K L V F F A E D
р15-23 А23 Q K L V F F A E A
Номера аминокислот 13 14 15 76 77 18 19 20 21 22 23

Пример 17. Влияние антитела hC2 на апоптоз культивируемых ганглиозных клеток сетчатки (ГКС)

Для оценки in vitro способности антитела hC2 снижать гибель ганглиозных клеток сетчатки (ГКС), связанную с глазными заболеваниями, ассоциированными с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированными со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, используют культивируемые ГКС крыс и мышей.

Для выделения клеток при умерщвлении животных анестезируют, глаза удаляют и сетчатку препарируют и инкубируют в растворе папаина 2 мг/мл в течение 25 мин при 37°С для разрушения внеклеточного матрикса. К концу обработки клетки трижды промывают средой RCG в присутствии ингибитора для остановки действия папаина. Затем ткань измельчают путем быстрого многократного пропускания через пастеровскую пипетку до диспергирования клеток. Коммерчески доступный счетчик Coulter используют для определения плотности суспензии клеток до культивирования клеток в атмосфере 95% воздуха/5% СО2 при 37°С.

Чтобы имитировать повреждение от глазных заболеваний, ассоциированных с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированных со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, от деградации нейронов, и оценить превентивный эффект антитела hC2, клетки инкубируют с L-глутамином в течение трех суток в присутствии или отсутствии антитела hC2. Клетки, которые культивируют только в буфере, сохраняют в виде контроля.

Для определения выживания ГКС в конце инкубационного периода клетки фиксируют 3,7% формальдегидом в фосфатно-солевом буфере (ФСБ) при комнатной температуре в течение 30 мин, промывают трижды в ФСБ и инкубируют в течение 1 ч в ФСБ, содержащем специфические для ГКС маркеры Thy 1.1 или NF-L антитела. Затем антитело удаляют путем промывания и клетки инкубируют в течение 30 мин с флуоресцентно мечеными вторичными антителами козьими против IgG, козьими против IgG кролика или кроличьими против IgG козы. В конце инкубирования клетки промывают, окрашивают 5 мин в растворе DAPI и промывают. Выжившие ГКС подсчитывают с помощью флуоресцентной микроскопии, и число клеток, имеющихся после инкубирования с антителом hC2, сравнивают с контролем.

Пример 18. Влияние антитела hC2 на апоптоз ганглиозных клеток сетчатки (ГКС) in vivo

Для оценки in vivo способности антитела hC2 снижать гибель ганглиозных клеток сетчатки (ГКС) у индивидуумов с глазными заболеваниями, ассоциированными с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированными со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, используют крыс и мышей для исследования индуцированного внутриглазного давления (ВГД) длительностью 2-16 недель. Гибель ганглиозных клеток сетчатки (ГКС) определяют к концу исследования путем и визуализации in vivo, и заключительного гистологического анализа.

Чтобы имитировать повышение внутриглазного давления, ассоциированного с определенными глазными заболеваниями, ассоциированными с патологическими нарушениями/изменениями в тканях зрительной системы, особенно ассоциированными со связанными с амилоидом-бета патологическими нарушениями/изменениями в тканях зрительной системы, например, с деградацией нейронов, в частности с глаукомой, животных сначала анестезируют внутрибрюшинно кетамином (75 мг/кг) и ксилазином (5 мг/кг), а также местно глазными каплями 1% пропаракаина. Затем используют два других метода для искусственной оценки ВГД в одном глазу (односторонне) у крыс и мышей. В первом методе анестезированные животные получают инъекцию туши в переднюю камеру глаза с последующей индуцированной лазером фотокоагуляцией красителя в трабекулярной сети 532-нм диодным лазером со щелевой лампой перпендикулярно трабекулам и параллельно радужной оболочке. Животные получают первоначальную обработку из 40-50 крапинок размером 50 мкм, 0,4 Вт и длительностью 0,6 сек. Во втором методе для искусственного повышения ВГД анестезированным животным вводят инъекцией 50 мкл гипертонического солевого раствора в эписклеральные вены одного глаза, используя микроиглу, с силой, как раз достаточной для обесцвечивания вены.

Для измерения ВГД используют коммерчески доступный портативный тонометр (фирма TonoLab). Проводят измерения, причем обычно у анестезированных животных производят в среднем 12 замеров непосредственно перед обработкой лазером, на 1, 4 и 7 сутки после обработки и затем еженедельно на протяжении всего эксперимента. Если с интервалом 1 неделя разница ВГД между двумя глазами животного менее 6 мм Hg, животных в дальнейшее исследование не включают.

Для оценки превентивного воздействия антитела hC2 на апоптоз ГКС половина животных, получающих ВГД-индуцирующую обработку, получает инъекцией в стекловидное тело или внутривенно антитело hC2 ко времени повышения ВГД. Другая половина животных служит контролем. Функциональные ГКС по всей сетчатки глаз с оценкой ВГД отображают и подсчитывают, а затем сравнивают с количеством, имеющимся в другом глазу того же животного. Разница в количестве ГКС по двум глазам представляет клетки, которые были утрачены в результате повышения ВГД в прооперированном глазу. Анализ изменений дифференцирующейся величины помогает в идентификации защитных действий, вызванных антителом hC2.

Количество ГКС измеряют путем гистологического анализа по конечным точкам через 2, 4, 8 и 16 недель после индуцированного повышения ВГД. Сетчатку, полученную от животных, фиксируют в 4% параформальдегиде, и окрашивают срезы или тотальный препарат, используя специфический для ГКС маркер Brn3b. Многочисленные исследования показывают, что утрата окрашивания Brn3b коррелирует с утратой функции у ГКС. Для подтверждения точности нанесения гистологической ГКС метки, может быть применен указанный метод в соединении с обратным нанесением метки глазного нерва из ЦНС с DiASP или Fluorogold в подгруппе животных для идентификации ГКС, которые поддерживают интактный функциональный аксон, не утративший соединения с мишенями в мозге.

В качестве второго заключительного исследования также измеряют апоптоз ГКС в подгруппе глаз. Флуоресцентно меченый аннексии V используют для нанесения метки на апоптозные клетки путем инъекции в глазное тело белка за один час до умерщвления животного. Сетчатки обрабатывают согласно указанному выше, и визуализацию аннексина V осуществляют в сочетании с визуализацией при заключительном гистологическом исследовании.

Литература

1. Barghorn S., Nimmrich V., Striebinger A., Krantz C., Keller P., Janson В., Bahr M., Schmidt M., Bitner R.S., Harlan J., Barlow E., Ebert U., Hillen H. Globular amyloid beta-peptid oligomer - a homogenous and stable neuropathological protein in Alzheimer's disease. J Neurochem 95, 2005, cc.834-847.

2. Blond, Goldberg, PNAS, 84(5), 1987, cc.1147-1151.

3. Сох J.P.L., Tomlinson I.M., Winter G. A directory of human germ-line Vk segments reveals a strong bias in their usage. Eur. J. Immunol. 24, 1994, cc.827-836.

4. Kabat E.A., Wu T.T., Perry H.M., Gottesman K.S., Foeller C. Suquences of proteins od immunological Interest, US Department of Health and Human Services, 1991.

5. Klein W.L., Abeta toxicity in Alzheimer's disease: globular soluble polymeric amyloid beta (ADDLs) as new vaccine and drug targets. Neurochem Int 41(5), 2002, cc.345-352.

6. Langdon S.D., Inakioki M., Kelsoe G., Tedder T.F. Germline sequences of V(H)7183 gene family members in C57BL/6 mice demonstrate natural selection of particular sequences during recent evolution. Immunogenetics, 51, 2000, cc.241-245.

7. Milligan R.C., Berg P. Expression of bacterial gene in mammalian cells. Science, 209, 1980, cc.1422-1427.

8. Reichmann L., Clark M., Waldmann H., Winter G., Reshaping human antibodies for therapy. Nature 332, 1988, cc.323-327.

9. Schable K.F., Thiebe R., Bensch A., Brensing-Kueppers J., Heim V., Kirschebaum Т., Lamm R., Ohnrich M., Pourrajabi S., Roschentaller F., Schwendinger J., Wichelhaus D., Zocher I., Zachau H.G. Characteristics of immunoglobulin V kappa genes, pseudogenes, relics and orphans in the mouse genome. Eur. J. Immunol., 29, 1999, cc.2082-2086.

10. Tomlinson I.M., Walter G., Marks J.D., Llewelyn M.B. and Winter G. The repertoire of human germline VH sequences reveals about 50 groups of VH segments with different hypervariable loops. J. Mol. Biol., 227, 1992, cc.776-798.

1. Способ диагностики глазного заболевания, ассоциированного со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, выбранными из группы, состоящей из кортикальной зрительной недостаточности, глаукомы, зрительного неврита, зрительного амилоидоза или решетчатой дистрофии роговицы у млекопитающего, где способ включает стадии:
а) приведения образца, или специфической части тела, или области тела млекопитающего, предположительно содержащей амилоид-бета, в контакт с гуманизированным антителом или его антигенсвязывающим фрагментом, который связывает эпитоп амилоида-бета;
(б) предоставления возможности для гуманизированного антитела или его антигенсвязывающего фрагмента связать амилоид-бета с формированием иммунологического комплекса;
(в) выявления формирования иммунологического комплекса, особенно такого, что наличие или отсутствие иммунологического комплекса коррелирует с наличием или отсутствием амилоида-бета, и
(г) корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоида-бета в образце или определенной части или области тела млекопитающего
и где гуманизированное антитело или его антигенсвязывающий фрагмент включает участок, определяющий комплементарность тяжелой цепи (CDR) 1, содержащий аминокислотную последовательность SEQ ID NO:1; CDR2 тяжелой цепи, содержащий аминокислотную последовательность SEQ ID NO:2; CDR3 тяжелой цепи, содержащий аминокислотную последовательность SEQ ID NO:3; CDR1 легкой цепи, содержащий аминокислотную последовательность SEQ ID NO:4; CDR2 легкой цепи, содержащий аминокислотную последовательность SEQ ID NO:5 с одной аминокислотной заменой; и CDR3 легкой цепи, содержащий аминокислотную последовательность SEQ ID NO:6.

2. Способ по п. 1, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариант Fc области и где указанный вариант Fc области включает по меньшей мере одну модификацию аминокислоты по отношению к Fc области дикого типа.

3. Способ по п. 2, где вариант Fc области является вариантом Fc области IgGl.

4. Способ по п. 2 или 3, где Fc область включает модификацию аминокислот по меньшей мере в одном аминокислотном положении 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439.

5. Способ по п. 3, где гуманизированное антитело или его антигенсвязывающий фрагмент включает мутацию D265A в Fc области.

6. Способ по п. 1, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12.

7. Способ по п. 1, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:15.

8. Способ по п. 1, где гуманизированное антитело или его антигенсвязывающий фрагмент включает
(а) вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12; и
(б) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO: 15.

9. Способ по п. 5, где гуманизированное антитело или его антигенсвязывающий фрагмент включает
(а) вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12; и/или
(б) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:15.

10. Способ по п. 1, где гуманизированное антитело или его антигенсвязывающий фрагмент включает легкую цепь, содержащую аминокислотную последовательность SEQ ID NO:13.

11. Способ по п. 1, где гуманизированное антитело или его антигенсвязывающий фрагмент включает тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO:16.

12. Способ по п. 1, где глазное заболевание, ассоциированное со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, представляет собой глаукому.

13. Способ по п. 12, где глаукому выбирают из группы, состоящей из хронической открытоугольной глаукомы (COAG), острой закрытоугольной глаукомы (AACG), смешанной глаукомы или глаукомы комбинированного механизма, глаукомы с нормальным давлением, врожденной глаукомы, вторичной глаукомы, пигментной глаукомы или эксфолиативной глаукомы.

14. Способ по п. 1, в котором млекопитающим является человек.

15. Способ диагностики или определения предрасположенности к глазному заболеванию, ассоциированному со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, такими как, например, дегенерация нейронов у млекопитающего, где указанный способ включает стадии:
(а) приведения образца, или специфической части тела, или области тела млекопитающего, предположительно содержащей амилоид-бета, в контакт с гуманизированным антителом или его антигенсвязывающим фрагментом, который связывает конформационный эпитоп амилоида-бета;
(б) предоставления возможности для гуманизированного антитела или его антигенсвязывающего фрагмента связать амилоид-бета в образце с формированием иммунологического комплекса;
(в) выявления формирования иммунологического комплекса;
(г) корреляции наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоида-бета в образце или определенной части или области тела млекопитающего и
(д) корреляции количества указанного иммунологического комплекса с нормальной контрольной величиной, в котором повышение количества указанного комплекса по сравнению с нормальной контрольной величиной показывает, что указанное млекопитающее больно или подвержено риску развития глазного заболевания, ассоциированного с патологическими нарушениями или изменениями в тканях зрительной системы, особенно ассоциированного со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, и где гуманизированное антитело или его антигенсвязывающий фрагмент включает CDR1 тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO:1; CDR2 тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO:2; CDR3 тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO:3; CDR1 легкой цепи, содержащую аминокислотную последовательность SEQ ID NO:4; CDR2 легкой цепи, содержащую аминокислотную последовательность SEQ ID NO:5 с одной аминокислотной заменой; и CDR3 легкой цепи, содержащую аминокислотную последовательность SEQ ID NO:6.

16. Способ по п. 15, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариант Fc области, где указанный вариант Fc области включает по меньшей мере одну модификацию аминокислоты по отношению к Fc области дикого типа.

17. Способ по п. 16, где вариант Fc области является вариантом Fc области IgGl.

18. Способ по п. 16 или 17, где Fc область включает модификацию аминокислот по меньшей мере в одном аминокислотном положении 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439.

19. Способ по п. 18, где гуманизированное антитело или его антигенсвязывающий фрагмент включает мутацию D265A в Fc области.

20. Способ по п. 15, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO: 12.

21. Способ по п. 15, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:15.

22. Способ по п. 15, где гуманизированное антитело или его антигенсвязывающий фрагмент включает
(а) вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12; и
(б) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:15.

23. Способ по п. 19, где гуманизированное антитело или его антигенсвязывающий фрагмент включает
(а) вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12; и/или
(б) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:15

24. Способ по п. 15, где гуманизированное антитело или его антигенсвязывающий фрагмент включает легкую цепь, содержащую аминокислотную последовательность SEQ ID NO:13.

25. Способ по п. 15, где гуманизированное антитело или его антигенсвязывающий фрагмент включает тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO:16.

26. Способ по п. 15, где глазное заболевание, ассоциированное со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, выбирается из группы, состоящей из кортикальной зрительной недостаточности, глаукомы, зрительного неврита и решетчатой дистрофии роговицы.

27. Способ по п. 15, где глазное заболевание, ассоциированное со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, представляет собой глаукому.

28. Способ по п. 27, где глаукому выбирают из группы, состоящей из хронической открытоугольной глаукомы (COAG), острой закрытоугольной глаукомы (AACG), смешанной глаукомы или глаукомы комбинированного механизма, глаукомы с нормальным давлением, врожденной глаукомы, вторичной глаукомы, пигментной глаукомы или эксфолиативной глаукомы.

29. Способ по п. 15, в котором млекопитающим является человек.

30. Способ мониторинга минимального остаточного глазного заболевания, ассоциированного со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, такими как, например, дегенерация нейронов у млекопитающего,
причем указанный способ включает:
(а) приведение образца из млекопитающего, или специфической части тела, или области тела млекопитающего, предположительно содержащей амилоид-бета, в контакт с гуманизированным антителом или его антигенсвязывающим фрагментом;
(б) предоставление возможности для гуманизированного антитела или его антигенсвязывающего фрагмента связать амилоид-бета в образце с формированием иммунологического комплекса;
(в) выявление формирования иммунологического комплекса;
(г) корреляцию наличия или отсутствия иммунологического комплекса с наличием или отсутствием амилоида-бета в образце или определенной части или области организма и
(д) сравнение количества указанного иммунологического комплекса с нормальной контрольной величиной, в котором повышение количества указанного комплекса по сравнению с нормальной контрольной величиной показывает, что указанное млекопитающее все еще больно минимальным остаточным глазным заболеванием, ассоциированным со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, и где гуманизированное антитело или его антигенсвязывающий фрагмент включает CDR1 тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO:1; CDR2 тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO:2; CDR3 тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO:3; CDR1 легкой цепи, содержащую аминокислотную последовательность SEQ ID NO:4; CDR2 легкой цепи, содержащую аминокислотную последовательность SEQ ID NO:5 с одной аминокислотной заменой; и CDR3 легкой цепи, содержащую аминокислотную последовательность SEQ ID NO:6.

31. Способ по п. 30, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариант Fc области, где указанный вариант Fc области включает по меньшей мере одну модификацию аминокислоты по отношению к Fc области дикого типа.

32. Способ по п. 31, где вариант Fc области является вариантом Fc области IgGl.

33. Способ по п. 31 или 32, где Fc область включает модификацию аминокислот по меньшей мере в одном аминокислотном положении 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439.

34. Способ по п. 32, где гуманизированное антитело или его антигенсвязывающий фрагмент включает мутацию D265A в Fc области.

35. Способ по п. 30, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12.

36. Способ по п. 30, где гуманизированное антитело или его антигенсвязывающий фрагмент включает вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:15.

37. Способ по п. 30, где гуманизированное антитело или его антигенсвязывающий фрагмент включает
(а) вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12; и
(б) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO: 15.

38. Способ по п. 34, где гуманизированное антитело или его антигенсвязывающий фрагмент включает
(а) вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:12; и
(б) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 98% идентичную SEQ ID NO:15.

39. Способ по п. 30, где гуманизированное антитело или его антигенсвязывающий фрагмент включает легкую цепь, содержащую аминокислотную последовательность SEQ ID NO:13.

40. Способ по п. 30, где гуманизированное антитело или его антигенсвязывающий фрагмент включает тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO:16.

41. Способ по п. 30, где глазное заболевание, ассоциированное со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, выбирается из группы, состоящей из кортикальной зрительной недостаточности, глаукомы, зрительного неврита, зрительного амилоидоза или решетчатой дистрофии роговицы.

42. Способ по п. 30, где глазное заболевание, ассоциированное со связанными с амилоидом-бета патологическими нарушениями или изменениями в тканях зрительной системы, представляет собой глаукому.

43. Способ по п. 42, где глаукому выбирают из группы, состоящей из хронической открытоугольной глаукомы (COAG), острой закрытоугольной глаукомы (AACG), смешанной глаукомы или глаукомы комбинированного механизма, глаукомы с нормальным давлением, врожденной глаукомы, вторичной глаукомы, пигментной глаукомы или эксфолиативной глаукомы.

44. Способ по п. 30, в котором млекопитающим является человек.



 

Похожие патенты:

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены варианты антитела или его эпитоп-связывающего фрагмента, специфичных в отношении бета-амилоидного пептида 1-40.

Изобретение относится к биохимии. Описаны способы определения: пептида Aβ(1-17) в образце; имеется ли у субъекта умеренная форма болезни Альцгеймера; имеется ли у субъекта умеренное когнитивное нарушение с продромальной формой болезни Альцгеймера и мониторинга болезни Альцгеймера.

Настоящее изобретение относится к области медицины и биотехнологии. Предложен способ ингибирования метастазирования G-CSF секретирующей первичной опухоли in vivo.

Изобретение относится к области биохимии, в частности к лекарственному средству для лечения или профилактики рака, содержащему антитело в качестве активного ингредиента, которое обладает иммунологической реактивностью по отношению к белку CAPRIN-1.

Настоящее изобретение относится к области биотехнологии. Предложено гуманизированное антитело и его фрагмент, способные специфически связывать бета-амилоид, охарактеризованные фрагментами последовательностей на основе антитела мыши 8F5, и Fc-областью человеческого IgG1, содержащей аминокислотную замену D265A; а также кодирующая нуклеиновая кислота, вектор экспрессии, продуцирующие антитело или его фрагмент клетки, способ продуцирования антитела или его фрагмента; композиция, применение антитела и его фрагмента для изготовления лекарственного средства, способ предупреждения, лечения или облегчения эффектов амилоидоза; способ диагностики амилоид-ассоциированных заболеваний или состояний, способ определения степени нагрузки амилоидогенных бляшек и тест-набор для выявления и диагностики амилоид-ассоциированных бляшек.

Изобретение относится к биохимии. Описаны способы определения наличия или метастазов опухоли, скрининга наличия опухоли среди популяции высокого риска, прогноза для пациента, имеющего опухоль, определения эффективности хирургического вмешательства, радиационной терапии или химиотерапии.

Изобретение относится к биохимии. Описано моноклональное антитело или его антигенсвязывающий фрагмент с очень высокой иммуносупрессивной активностью, которое связывается с пептидом, содержащим аминокислотную последовательность SSVLYGGPPSAA, или с конъюгатом данного пептида с фармацевтически приемлемым носителем, где моноклональное антитело или его антигенсвязывающий фрагмент имеет более высокую аффинность связывания с коровым гистоном, чем с гистоном H1.

Настоящее изобретение относится к биотехнологии. Предложены варианты антител против Bv8 человека или макака, каждое из которых характеризуется тем, что содержит 6 CDR.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к способу получения иммуноглобулинов подкласса IG1 и IG4 из супернатантов культивированных клеток. За счет подведения значения рН в кислую сторону и последующего инкубирования закисленного раствора нуклеиновые кислоты и белки клетки хозяина могут преципитировать, но искомый полипептид остается в растворе.

Изобретение относится к области биохимии, в частности к способам получения гликозилированного конъюгата молекулы с повторяющимся мотивом для связывания с антителом, включающим стадии: 1) получение клеток; 2) культивирование клеток; 3) выделение гликозилированного конъюгата молекулы с повторяющимся мотивом из клеток; 4) необязательную очистку выделенного гликозилированного конъюгата молекулы с повторяющимся мотивом. Изобретение позволяет снижать содержание побочных продуктов при получении гликозилированного конъюгата молекулы с повторяющимся мотивом. 2 н. и 3 з.п. ф-лы, 19 ил., 7 пр.

Изобретение относится к иммунологии. Предложено гуманизированное антитело против Аβ-олигомера, которое не связывается с Аβ-мономерами, характеризующееся наличием вариабельной области тяжелой цепи и вариабельной области легкой цепи. Описаны: средство против когнитивной дисфункции, лекарственный препарат для лечения болезни Альцгеймера, средство для подавления образования сенильных бляшек и ингибитор образования β-амилоидных волокон, содержащие гуманизированное антитело в качестве активного ингредиента. Предложены также: способ профилактики и/или лечения болезни Альцгеймера и способ подавления прогрессирования болезни Альцгеймера, включающие стадию введения гуманизированного антитела. Описан способ получения антитела с помощью рекомбинантного вектора с ДНК, кодирующей гуманизированное антитело, путем культивирования трансформанта с образованием и накоплением гуманизированного антитела в культуре. Использование изобретения обеспечивает новое гуманизированное антитело против Аβ-олигомера, которое не связывается с Аβ-мономерами, что может найти применение в медицине. 9 н.п. ф.-лы, 3 ил., 1 табл., 3 пр.

Предложенное изобретение относится к иммунологии. Предложено антитело, которое специфически связывается с альфа-синуклеином человека, содержащее зрелые вариабельные области тяжелой и легкой цепей с соответствующими аминокислотными последовательностями. Раскрыта фармацевтическая композиция для лечения или профилактики заболевания с тельцами Леви, содержащая эффективное количество антитела. Использование изобретения обеспечивает новое антитело, которое специфично связывается с человеческим альфа-синуклеином и может быть использовано для иммунотерапии заболевания с тельцами Леви. 2 н. и 3 з.п. ф-лы, 6 ил., 4 табл., 4 пр.

Изобретение относится к биохимии. Представлены гуманизированные антитела анти-IL-4 и анти-IL-13 и их фрагменты, которые специфическим образом связываются с IL-4 и IL-13. Изобретение также включает использование антител для лечения или профилактики заболеваний или нарушений, опосредованных IL-4 и (или) IL-13, в том числе аллергической астмы и дерматита. 22 н. и 10 з.п. ф-лы, 2 ил., 8 табл., 8 пр.

Изобретение относится к области иммунологии. Предложено моноклональное антитело, способное специфически связываться с молекулой С3 комплемента человека с экспонированной тиоэфирной связью, и штамм гибридомы мыши РККК(П)764Д. Антитело по настоящему изобретению блокирует альтернативный путь активации комплемента и может найти дальнейшее применение в создании антител, пригодных для клинического применения. 2 н. и 2 з.п. ф-лы, 5 ил., 1 табл., 3 пр.

Настоящее изобретение относится к области иммунологии и биотехнологии. Предложены антитела к А2 домену тенасцина-С (TNC A2), а также выделенный полинуклеотид, вектор экспрессии, клетка-хозяин и способы получения антитела по изобретению. Кроме того, рассмотрена фармацевтическая композиция и применение антитела по изобретению для изготовления или производства лекарственного средства, в том числе применяемого для лечения заболевания, характеризующегося экспрессией TNC А2 или для индукции цитолиза опухолевой клетки или стромальной опухолевой клетки. Данное изобретение может найти дальнейшее применение в терапии и диагностике различных заболеваний, связанных с TNC А2. 11 н. и 25 з.п. ф-лы, 8 ил., 8 табл., 11пр.

Изобретение относится к области биотехнологии, генной и белковой инженерии. Предложены рекомбинантный полипептид, имеющий специфические иммуногенные свойства изоформ Oct-1, содержащий N-концевой участок Oct-1A человека, линкер и 6 остатков гистидина; а также способ получения поликлональных антител против изоформ Oct-1 с использованием такого полипептида. Полилипептид имеет последовательность MADGGAASQDESSAAAAAAADSRMNNPSETSKPSMESGDGNTGTQTNGLDFQK QPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPS QPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQ HSASQQHGAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQAFH ННННН. Данное изобретение позволяет получить антитела, связывающие изоформы Oct-1A, Oct-1L и Oct-1B человека, и, кроме того, могут быть использованы для получения антител, обладающих высокой аффинностью и специфичностью с другими изоформами Oct-1. 2 н.п. ф-лы, 6 ил.
Наверх