Биомаркер



Биомаркер
Биомаркер
Биомаркер
Биомаркер
Биомаркер
Биомаркер
Биомаркер
Биомаркер

 


Владельцы патента RU 2573925:

ДЗЕ ЮНИВЕРСИТИ ОФ СУРРЕЙ (GB)

Изобретение относится к области биотехнологии, конкретно к маркерам рака, и может быть использовано в медицине. Выявление белка Engrailed-2 (EN2) или кодирующей его нуклеиновой кислоты в образце тканей мочевого пузыря или мочи от пациента может быть использовано в диагностике рака мочевого пузыря или для идентификации пациента, имеющего риск развития рака мочевого пузыря, а также для мониторинга прогрессирования рака мочевого пузыря у пациента или мониторинга эффективности лечения рака мочевого пузыря. Изобретение позволяет использовать EN2 в диагностике рака мочевого пузыря. 4 н. и 6 з.п. ф-лы, 5 ил., 3 пр.

 

Данное изобретение относится к биомаркерам, в частности к биомаркерам рака мочевого пузыря и рака легкого.

Рак мочевого пузыря занимает четвертое место среди наиболее распространенных злокачественных новообразований у мужчин и десятое место среди наиболее распространенных злокачественных новообразований у женщин; каждый год регистрируется 10000 новых случаев в Соединенном Королевстве и 63000 в США. В настоящее время диагноз ставят на основании исследования клеток в моче, которые отсоединились от стенки мочевого пузыря (цитология), или путем взятия ткани из мочевого пузыря для биопсии. Цитология является высокоспецифичной, но обладает малой чувствительностью, и обе методики являются дорогими и трудоемкими. Надежный биохимический маркер рака мочевого пузыря был бы очень полезным для пациентов.

Что касается типов рака мочевого пузыря, то 90% случаев представляют собой переходно-клеточные карциномы (ТСС), которые возникают из внутренней выстилки мочевого пузыря, уротелия. Остальные 10% типов рака мочевого пузыря приходятся на плоскоклеточный рак, аденокарциному, саркому и мелкоклеточный рак.

Рак легкого является наиболее распространенным раком во всем мире; ежегодно регистрируется 1,35 миллиона новых случаев, 38000 из которых приходятся на Соединенное Королевство. Не существует надежных биохимических способов диагностики рака легкого; в настоящее время диагноз ставят на основании рентгенологического исследования с последующей бронхоскопией и/или с использованием компьютерной томографии (КТ). Надежный биохимический тест на основе одного маркера в сыворотке или мокроте был бы очень полезным для пациентов, поскольку ускорял бы диагностику. Кроме того, такой тест, по всей вероятности, будет гораздо дешевле существующих методов.

Существуют различные типы рака легкого. Немелкоклеточные раки легкого (NSCLC) относят к одной группе, поскольку их прогноз и лечение являются сходными. Они состоят из плоскоклеточного рака легкого, аденокарциномы и крупноклеточного рака легкого. NSCLC является наиболее распространенной формой рака легкого, составляющей до 80,4% всех случаев. Мелкоклеточный рак легкого (SCLC) составляет 16,8% случаев. SCLC часто имеет эндокринную функцию, которая является важным компонентом заболевания. Карциноиды и саркомы составляют 0,8% и 0,1% случаев, соответственно; случаи неопределенного типа составляют 1,9%.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Согласно одному аспекту настоящее изобретение относится к специфичному биомаркеру рака мочевого пузыря или к специфичному биомаркеру рака легкого, который содержит:

(i) последовательность нуклеиновой кислоты, содержащую SEQ ID NO:1, или ее фрагмент или вариант, или молекулу нуклеиновой кислоты, которая содержит указанную последовательность нуклеиновой кислоты; или

(ii) аминокислотную последовательность, содержащую SEQ ID NO:2, или ее фрагмент или вариант, или молекулу аминокислоты, которая содержит указанную аминокислотную последовательность.

В этом отношении SEQ ID NO:1 соответствует последовательности нуклеиновой кислоты гена Engrailed-2 (EN2) (регистрационный номер в GenBank NM_001427), а SEQ ID NO:2 соответствует белку EN2, который ею кодируется (номер доступа в NCBI Р19622, gi21903415).

Неожиданно было установлено, что ген EN2 подвергается значительной повышающей регуляции в случае рака мочевого пузыря и рака легкого.

Ген EN2 кодирует содержащий гомеодомен транскрипционный фактор, который имеет ряд важных функций в раннем развитии, включая направление роста аксонов и формирование границ (обзор в публикации Morgan R., (2006). Engrailed: Complexity and economy of multifunctional transcription factor. FEBS letters 580, 2531-2533, которая полностью включена в описание путем ссылки). В NCBI/GenBank ему присвоен регистрационный номер NM_001427. Ранее сообщалось, что он действует как онкоген при раке молочной железы, хотя ему не приписывали никакой диагностической значимости (публикация Martin, N.L., Saba-El-Leil, M.K., Sadekova, S., Meloche, S. and Sauvageau, G. (2005) EN-2 is candidate oncogene in human breast cancer. Oncogene 24, 6890-6901, которая полностью включена в описание путем ссылки). Продуктом гена EN2 является белок 33 кДа (EN2).

Предпочтительно, его фрагменты или варианты содержат:

(i) последовательность нуклеиновой кислоты, которая имеет по меньшей мере приблизительно 50% или по меньшей мере приблизительно 60%, или по меньшей мере приблизительно 70%, или по меньшей мере приблизительно 75%, или по меньшей мере приблизительно 80%, или по меньшей мере приблизительно 85%, или по меньшей мере приблизительно 90%, или по меньшей мере приблизительно 95%, или по меньшей мере приблизительно 96%, или по меньшей мере приблизительно 97%, или по меньшей мере приблизительно 98%, или по меньшей мере приблизительно 99% идентичности с последовательностью нуклеиновой кислоты SEQ ID NO:1, последовательность нуклеиновой кислоты, которая способна гибридизоваться с ней в строгих условиях, и/или последовательность нуклеиновой кислоты, которая ей комплементарна;

(ii) аминокислотную последовательность, которая имеет по меньшей мере приблизительно 50% или по меньшей мере приблизительно 60%, или по меньшей мере приблизительно 70%, или по меньшей мере приблизительно 75%, или по меньшей мере приблизительно 80%, или по меньшей мере приблизительно 85%, или по меньшей мере приблизительно 90%, или по меньшей мере приблизительно 95%, или по меньшей мере приблизительно 96%, или по меньшей мере приблизительно 97%, или по меньшей мере приблизительно 98%, или по меньшей мере приблизительно 99% идентичности с аминокислотной последовательностью SEQ ID NO:2, или

(iii) аминокислотную последовательность, кодируемую последовательностью нуклеиновой кислоты (i).

Предполагая иной путь, в соответствии с частью (iii) выше, предпочтительно, чтобы ее варианты или фрагменты содержали:

(A) аминокислотную последовательность, кодируемую последовательностью нуклеиновой кислоты, где указанная последовательность нуклеиновой кислоты имеет по меньшей мере приблизительно 50% или по меньшей мере приблизительно 60%, или по меньшей мере приблизительно 70%, или по меньшей мере приблизительно 75%, или по меньшей мере приблизительно 80%, или по меньшей мере приблизительно 85%, или по меньшей мере приблизительно 90%, или по меньшей мере приблизительно 95%, или по меньшей мере приблизительно 96%, или по меньшей мере приблизительно 97%, или по меньшей мере приблизительно 98%, или по меньшей мере приблизительно 99% идентичности с последовательностью нуклеиновой кислоты SEQ ID NO:1;

(B) аминокислотную последовательность, кодируемую последовательностью нуклеиновой кислоты, где указанная последовательность нуклеиновой кислоты способна гибридизоваться в строгих условиях с последовательностью нуклеиновой кислоты, которая имеет по меньшей мере приблизительно 50% или по меньшей мере приблизительно 60%, или по меньшей мере приблизительно 70%, или по меньшей мере приблизительно 75%, или по меньшей мере приблизительно 80%, или по меньшей мере приблизительно 85%, или по меньшей мере приблизительно 90%, или по меньшей мере приблизительно 95%, или по меньшей мере приблизительно 96%, или по меньшей мере приблизительно 97%, или по меньшей мере приблизительно 98%, или по меньшей мере приблизительно 99% идентичности с последовательностью нуклеиновой кислоты SEQ ID NO:1; или

(C) аминокислотную последовательность, кодируемую последовательностью нуклеиновой кислоты, где указанная последовательность нуклеиновой кислоты комплементарна последовательности нуклеиновой кислоты, которая имеет по меньшей мере приблизительно 50% или по меньшей мере приблизительно 60%, или по меньшей мере приблизительно 70%, или по меньшей мере приблизительно 75%, или по меньшей мере приблизительно 80%, или по меньшей мере приблизительно 85%, или по меньшей мере приблизительно 90%, или по меньшей мере приблизительно 95%, или по меньшей мере приблизительно 96%, или по меньшей мере приблизительно 97%, или по меньшей мере приблизительно 98%, или по меньшей мере приблизительно 99% идентичности с последовательностью нуклеиновой кислоты SEQ ID NO:1.

Предпочтительно, их фрагменты содержат (i) по меньшей мере четыре, предпочтительно по меньшей мере пять, предпочтительно по меньшей мере шесть, предпочтительно по меньшей мере семь, предпочтительно по меньшей мере восемь последовательных аминокислот из SEQ ID NO:2 или (ii) фрагмент последовательности нуклеиновой кислоты SEQ ID NO:1, который кодирует по меньшей мере четыре, предпочтительно по меньшей мере пять, предпочтительно по меньшей мере шесть, предпочтительно по меньшей мере семь, предпочтительно по меньшей мере восемь последовательных аминокислот SEQ ID NO:2. Более длинные фрагменты также являются предпочтительными, например, по меньшей мере приблизительно 10, 15, 20, 25, 30, 50, 75, 100, 150, 200, 225 и по меньшей мере до 250 аминокислот SEQ ID NO:2 или соответствующие кодирующие фрагменты SEQ ID NO:1. Фрагменты также могут включать усеченные пептиды, которые имеют х аминокислот, удаленных из N-конца и/или С-конца. В таких усечениях может быть 1 или более (т.е. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100 или более), но предпочтительно менее 150 аминокислот SEQ ID NO:2 или соответствующих кодирующих фрагментов SEQ ID NO:1.

Предпочтительно, их фрагменты или варианты представляют собой их функциональные фрагменты или варианты.

Согласно другому аспекту настоящее изобретение относится к способу диагностики рака мочевого пузыря или рака легкого у пациента или идентификации пациента, имеющего риск развития рака мочевого пузыря или рака легкого, где указанный способ включает:

(a) определение количества специфичного для рака биомаркера в образце, полученном от пациента;

(b) сравнение в образце, полученном от пациента, количества определенного специфичного для рака биомаркера с количеством специфичного для рака биомаркера в нормальном контроле;

где разница между количеством специфичного для рака биомаркера в образце, полученном от пациента, и количеством специфичного для рака биомаркера в нормальном контроле связана с наличием рака мочевого пузыря или рака легкого или связана с риском развития рака мочевого пузыря или рака легкого.

Согласно другому аспекту настоящее изобретение относится к способу мониторинга прогрессирования рака мочевого пузыря или рака легкого у пациента, где указанный способ включает:

(a) определение количества специфичного для рака биомаркера в образце, полученном от пациента;

(b) сравнение в образце, полученном от пациента, количества определенного специфичного для рака биомаркера с количеством специфичного для рака биомаркера в нормальном контроле; и

(с) повторение этапов (a) и (b) через два или более интервалов времени,

где увеличение с течением времени количества специфичного для рака биомаркера в образце, полученном от пациента, связано с увеличением прогрессирования рака мочевого пузыря или рака легкого, а уменьшение с течением времени количества специфичного для рака биомаркера в образце, полученном от пациента, связано с уменьшением прогрессирования рака мочевого пузыря или рака легкого.

Соответственно, способы по настоящему изобретению можно использовать для выявления возникновения, прогрессирования, стабилизации, улучшения и/или ремиссии рака мочевого пузыря или рака легкого.

Предпочтительно, контроль можно получать от того же самого пациента из предыдущего образца для мониторинга, таким образом, возникновения или прогрессирования. Однако также предпочтительно стандартизировать контроль для популяции, особенно здоровой или нормальной популяции, в которой отсутствует рак мочевого пузыря или рак легкого. Иными словами, контроль может состоять из уровня биомаркера, обнаруженного в нормальном контрольном образце от нормального субъекта.

Соответственно, в одном примере настоящего изобретения описан способ диагностики или мониторинга прогрессирования рака мочевого пузыря или рака легкого, включающий выявление и/или количественную оценку специфичного для рака биомаркера в биологической жидкости, полученной от пациента.

Как обсуждалось выше, предпочтительно проводить по меньшей мере два этапа выявления и/или количественной оценки, разделенные во времени.

Предпочтительно, этапы разделены интервалом времени в несколько дней, недель, лет или месяцев для того, чтобы определить, изменились ли уровни специфичного для рака биомаркера, что указывает на наличие изменения в прогрессировании рака, делая возможным осуществление сравнения уровней биомаркера в образцах, взятых в двух или более случаях, поскольку увеличение уровня биомаркера с течением времени является показателем возникновения или прогрессирования рака, в то время как уменьшение уровня биомаркера может указывать на улучшение и/или ремиссию рака.

Предпочтительно, разница в уровнях биомаркера является статистически значимой, определенной с использованием «t-критерия», обеспечивающего доверительные интервалы предпочтительно по меньшей мере приблизительно 80%, предпочтительно по меньшей мере приблизительно 85%, предпочтительно по меньшей мере приблизительно 90%, предпочтительно по меньшей мере приблизительно 95%, предпочтительно по меньшей мере приблизительно 99%, предпочтительно по меньшей мере приблизительно 99,5%, предпочтительно по меньшей мере приблизительно 99,95%, предпочтительно по меньшей мере приблизительно 99,99%.

Биомаркеры и способы по настоящему изобретению являются особенно подходящими для выявления рака на ранней стадии и являются более чувствительными, чем известные способы выявления рака мочевого пузыря или рака легкого на ранней стадии. Таким образом, биомаркеры и способы по настоящему изобретению являются особенно подходящими для подтверждения рака, когда результаты анализов пациента с использованием обычных способов являются отрицательными.

Прогноз и выбор лечения зависят от стадии рака и общего состояния здоровья пациента.

Что касается рака мочевого пузыря, то его стадии определяются в зависимости от того, присутствует ли рак только в выстилке мочевого пузыря или распространяется на другие области. Для планирования лечения желательно знать стадию заболевания. Следовательно, после того как был поставлен диагноз рака мочевого пузыря, обычно проводят другие исследования для определения стадии рака.

Стадия 0 представляет собой рак на очень ранней стадии. На этой стадии рак обнаруживают только во внутренней выстилке мочевого пузыря. После удаления рака при внутреннем исследовании не будут обнаруживаться набухания или вздутия. На стадии I раковые клетки распространены немного глубже во внутренней выстилке мочевого пузыря, но не распространяются на мышечную стенку мочевого пузыря. На стадии II раковые клетки распространяются на внутреннюю выстилку из мышц, выстилающих мочевой пузырь. На стадии III раковые клетки распространяются по мышечной стенке мочевого пузыря, на слой ткани, окружающей мочевой пузырь, и/или на соседние репродуктивные органы. На указанной стадии все еще могут наблюдаться набухания или вздутия, даже если опухолевая ткань удалена хирургическим путем. На стадии IV раковые клетки распространяются на брюшную стенку или таз, или на близлежащие лимфатические узлы. Лимфатические узлы представляют собой небольшие, имеющие бобовидную форму структуры, которые имеются во всем теле; они вырабатывают и хранят в себе клетки, которые борются с инфекцией. Рак также может распространяться на лимфатические узлы и другие части тела на удалении от мочевого пузыря.

Что касается рака легкого, то определение стадий различается у немелкоклеточных и мелкоклеточных раков легкого.

Немелкоклеточный рак легкого разделяют на четыре стадии. Стадия I представляет собой очень локализованный рак, без поражения лимфатических узлов. На стадии II рак распространяется на лимфатические узлы верхушки пораженного легкого. На стадии III рак распространяется на область, близкую к той, где он начал развиваться. Это может быть грудная стенка, оболочка легкого (плевра), срединная часть грудной клетки (средостение) или другие лимфатические узлы. Рак IV стадии распространяется на другую часть тела.

Мелкоклеточный рак легкого разделяют на две группы. Это происходит потому, что мелкоклеточный рак легкого часто распространяется достаточно рано. Даже если распространение еще не видно на сканограммах, существует вероятность, что некоторое количество раковых клеток отсоединятся и разнесутся через кровеносные сосуды или лимфатическую систему. Соответственно, часто является предпочтительным лечить мелкоклеточные раки легкого таким образом, как если бы они уже распространились, независимо от того, наблюдается ли вторичный рак или нет. Две стадии мелкоклеточных раков легкого представляют собой ограниченное заболевание, т.е. рак, который можно видеть лишь в одном легком и в близлежащих лимфатических узлах, и распространившееся заболевание, т.е. рак, который распространился за пределы легкого в грудную клетку или в другие части тела.

Следует понимать, что термин «ранняя стадия», используемый в настоящем документе, относится к стадии 0, стадии I и/или стадии II рака мочевого пузыря или стадии I и/или стадии II немелкоклеточного рака легкого, или стадии ограниченного заболевания мелкоклеточных раков легкого, как обсуждалось выше.

Что касается термина «поздняя стадия», используемого в настоящем документе, следует понимать, что данный термин относится к стадии III и/или стадии IV рака мочевого пузыря или немелкоклеточного рака легкого, или к стадии распространившегося заболевания мелкоклеточного рака легкого, как обсуждалось выше.

Следует понимать, что оценка болезненного состояния как рака «ранней стадии» и «поздней стадии» находится в компетенции врача. Также предусматривается, что они могут быть связаны с неметастатическими и метастатическими состояниями, соответственно.

В одном аспекте настоящее изобретение относится к способам выявления рака на ранней стадии, где увеличение между контрольным образцом и образцом, полученным от пациента, указывает на раннюю стадию рака. Предпочтительно, увеличение составляет по меньшей мере приблизительно 100%, предпочтительно по меньшей мере приблизительно 125%, предпочтительно по меньшей мере приблизительно 150%, предпочтительно по меньшей мере приблизительно 200%, предпочтительно по меньшей мере приблизительно 250%, предпочтительно по меньшей мере приблизительно 300%, предпочтительно по меньшей мере приблизительно 500%.

Также настоящее изобретение относится к способам выявления рака на поздней стадии, где увеличение между контрольным образцом и образцом, полученным от пациента, указывает на позднюю стадию рака. Предпочтительно, увеличение составляет по меньшей мере приблизительно 100%, предпочтительно по меньшей мере приблизительно 125%, предпочтительно по меньшей мере приблизительно 150%, предпочтительно по меньшей мере приблизительно 200%, предпочтительно по меньшей мере приблизительно 250%, предпочтительно по меньшей мере приблизительно 300%, предпочтительно по меньшей мере приблизительно 500%, предпочтительно по меньшей мере приблизительно 750%, предпочтительно по меньшей мере приблизительно 1000%, предпочтительно по меньшей мере приблизительно 1500%.

Также настоящее изобретение относится к способам мониторинга изменения стадии рака, где увеличение, относительно образца более ранней стадии или контроля, указывает на прогрессирование рака с более ранней стадии до более поздней стадии заболевания, например, со стадии 0 до стадии I, со стадии I до стадии II, со стадии II до стадии III, со стадии III до стадии IV, с ранней стадии до поздней стадии или со стадии ограниченного заболевания до стадии распространившегося заболевания. Предпочтительно, увеличение составляет по меньшей мере приблизительно 100%, предпочтительно по меньшей мере приблизительно 125%, предпочтительно по меньшей мере приблизительно 150%, предпочтительно по меньшей мере приблизительно 200%, предпочтительно по меньшей мере приблизительно 250%, предпочтительно по меньшей мере приблизительно 300%, предпочтительно по меньшей мере приблизительно 500%, предпочтительно по меньшей мере приблизительно 750%, предпочтительно по меньшей мере приблизительно 1000%, предпочтительно по меньшей мере приблизительно 1500%.

В способах, относящихся к раку мочевого пузыря, предпочтительно, чтобы специфичный биомаркер рака мочевого пузыря являлся показателем наличия рака мочевого пузыря или риска развития рака мочевого пузыря, когда он присутствует на уровне, который выше по меньшей мере приблизительно в 2 раза, предпочтительно по меньшей мере приблизительно в 5 раз, предпочтительно по меньшей мере приблизительно в 10 раз, предпочтительно по меньшей мере приблизительно в 20 раз, предпочтительно по меньшей мере приблизительно в 50 раз, предпочтительно по меньшей мере приблизительно в 100 раз, предпочтительно по меньшей мере приблизительно в 200 раз, предпочтительно по меньшей мере приблизительно в 500 раз, предпочтительно по меньшей мере приблизительно в 750 раз, предпочтительно по меньшей мере приблизительно в 1000 раз, чем уровень нормального контроля.

В способах, относящихся к раку легкого, предпочтительно, чтобы специфичный биомаркер рака легкого являлся показателем наличия рака легкого или риска развития рака легкого, когда он присутствует на уровне, который выше по меньшей мере приблизительно в 2 раза, предпочтительно по меньшей мере приблизительно в 5 раз, предпочтительно по меньшей мере приблизительно в 10 раз, предпочтительно по меньшей мере приблизительно в 15 раз, предпочтительно по меньшей мере приблизительно в 20 раз, предпочтительно по меньшей мере приблизительно в 25 раз, предпочтительно по меньшей мере приблизительно в 30 раз, чем уровень нормального контроля.

Также настоящее изобретение относится к способу мониторинга эффективности лечения рака мочевого пузыря или рака легкого, включающему выявление и/или количественную оценку наличия специфичного для рака биомаркера в биологическом образце, полученном от пациента.

Предпочтительно, в способах по настоящему изобретению выявление и/или количественную оценку специфичного для меланомы биомаркера осуществляют с использованием одной или более аналитических систем MALDI-TOF, SELDI, посредством взаимодействия с лигандом или лигандами, 1-D или 2-D аналитических систем на основе геля, жидкостной хроматографии, комбинированной методики жидкостной хроматографии и масс-спектрометрии, включая ICAT(R) или iTRAQ(R), тонкослойной хроматографии, ЯМР-спектроскопии, иммунологических анализов методом «сандвича», твердофазных иммуноферментных анализов (ELISA), радиоиммуноанализов (RAI), ферментных иммуноанализов (EIA), латеральных проточных анализов/иммунохроматографических тест-полосок, вестерн-блоттинга, иммунопреципитации, иммуноанализов на основе частиц, включая золотые, серебряные или латексные частицы, магнитные частицы или Q-точки, и иммуногистохимических анализов на срезах тканей.

Предпочтительно, выявление и/или количественную оценку специфичного для рака биомаркера осуществляют с использованием микротитрационного планшета, полосок, матриц или на чипе.

Предпочтительно, выявление и/или количественную оценку специфичного для рака биомаркера осуществляют методом ELISA, включающего антитела, специфичные в отношении специфичного для рака биомаркера, предпочтительно связанные с репортером.

Предпочтительно, выявление и/или количественную оценку специфичного для рака биомаркера осуществляют с использованием биосенсора.

Предпочтительно, образец включает биологическую жидкость или ткань, полученные от пациента. Предпочтительно, биологическая жидкость или ткань содержит клеточную жидкость, цереброспинальную жидкость (CSF), семенную жидкость, мочу, кровь, мокроту или слюну. В предпочтительных вариантах осуществления изобретения, относящихся к раку мочевого пузыря, образец представляет собой мочу, полученную от пациента. В предпочтительных вариантах осуществления изобретения, относящихся к раку легкого, образец представляет собой мокроту, полученную от пациента.

Предпочтительно, биомаркер поддается обнаружению на поверхности клеток.

Также предпочтительно, чтобы биологическая жидкость в значительной степени или полностью не содержала целых/интактных клеток. Предпочтительно, биологическая жидкость не содержит тромбоцитов и клеточного дебриса (такого как дебрис, возникающий в результате лизиса клеток). Предпочтительно, биологическая жидкость не содержит как прокариотических, так и эукариотических клеток.

Указанные образцы могут быть получены любыми средствами, известными в данной области, такими, которые будут очевидны для специалистов. Например, образцы мочи и мокроты можно легко получить, в то время как образцы крови или сыворотки можно получить парентерально с использованием, например, иглы и шприца. Образцы, не содержащие или по существу не содержащие клетки, можно получить обработкой образца с использованием различных методик, известных специалистам в данной области, которые включают, без ограничения, центрифугирование и фильтрование.

Несмотря на то, что предпочтительно, как правило, не использовать инвазивные методики для получения образца, все же может быть предпочтительным получение таких образцов, как тканевые гомогенаты, тканевые срезы и образцы биопсии (биоптаты).

Другой аспект настоящего изобретения относится к способу лечения пациента, страдающего раком мочевого пузыря или раком легкого, где способ включает введение пациенту терапевтически эффективного количества (i) биомаркера по настоящему изобретению, или (ii) антитела или его фрагмента, которые специфически связываются с биомаркером по настоящему изобретению.

Другой аспект настоящего изобретения относится к способу визуализации рака мочевого пузыря или рака легкого у пациента, где способ включает введение пациенту антитела или его фрагмента, которые специфически связываются с биомаркером по настоящему изобретению.

Предпочтительно, антитело конъюгировано с поддающимся обнаружению маркером, например, с флуоресцентным маркером или меткой. Предпочтительно, антитело представляет собой моноклональное антитело. Предпочтительно, антитело конъюгировано с агентом, ингибирующим рост. Предпочтительно, антитело конъюгировано с цитотоксическим агентом, например, токсином, антибиотиком, литическим ферментом или радиоактивным изотопом.

Другой аспект настоящего изобретения относится к композиции, содержащей биомаркер по настоящему изобретению, или антитело или его фрагмент, которые связываются с биомаркером по настоящему изобретению.

Предпочтительно, композиция представляет собой фармацевтическую композицию.

Также настоящее изобретение относится к вакцине, содержащей биомаркер по настоящему изобретению, или антитело или его фрагмент, которые связываются с биомаркером по настоящему изобретению.

Другой аспект настоящего изобретения относится к применению специфичного для рака биомаркера, поддающегося обнаружению в биологической жидкости, в качестве биомаркера рака мочевого пузыря или рака легкого.

Предпочтительно, указанное применение представляет собой способ, выбранный из группы, состоящей из клинического скрининга, способов оценки прогноза, мониторинга результатов терапии, способа идентификации пациентов, которые с наибольшей вероятностью отреагируют на конкретное терапевтическое лечение, и скрининга и разработки лекарственных средств.

Другой аспект настоящего изобретения относится к применению (i) биомаркера по настоящему изобретению или (ii) антитела или его фрагмента, которые специфически связываются с биомаркером по настоящему изобретению, для получения лекарственного средства для лечения рака мочевого пузыря или рака легкого.

Также настоящее изобретение относится к композиции, содержащей (i) биомаркер по настоящему изобретению, или (ii) антитело или его фрагмент, которые специфически связываются с биомаркером по настоящему изобретению, где указанная композиция предназначена для использования при лечении рака мочевого пузыря или рака легкого.

Другой аспект настоящего изобретения относится к антителу или его фрагменту, которые специфически связываются с биомаркером по настоящему изобретению, для использования в способе визуализации рака мочевого пузыря или рака легкого у пациента.

В предпочтительных вариантах осуществления способы и композиции по настоящему изобретению предназначены для лечения или диагностики заболевания на ранней стадии, например, до возникновения симптомов заболевания.

В некоторых вариантах осуществления способы и композиции по настоящему изобретению предназначены для лечения или диагностики заболевания на клинической стадии.

Согласно другому аспекту настоящее изобретение относится к набору для использования в способах или областях применения, описанных выше, где указанный набор включает лиганд, способный связываться или специфически распознавать специфичный для рака биомаркер, поддающийся выявлению в биологической жидкости, а также репортерные средства.

Предпочтительно, набор представляет собой матрицу или чип.

Предпочтительно, набор включает микротитрационный планшет, тест-полоску, матрицу или чип.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Типичные варианты осуществления настоящего изобретения далее будут описаны со ссылкой на прилагаемые фигуры.

Фигура 1 показывает анализ белка EN2 в моче пациентов, проходящих цитоскопическое исследование по поводу подозреваемого рака мочевого пузыря;

Фигура 2 показывает экспрессию EN2 при раке легкого;

Фигура 3 показывает, что EN2 присутствует на поверхности клеток рака мочевого пузыря;

Фигура 4 показывает последовательность нуклеиновой кислоты EN2 (SEQ ID NO:1); и

Фигура 5 показывает аминокислотную последовательность EN2 (SEQ ID NO:2).

Изобретение относится к биомаркерам, специфичным для рака мочевого пузыря, и к биомаркерам, специфичным для рака легкого.

В настоящем описании термины «включает» и «включающий» интерпретируются как означающие «включает, помимо всего прочего». Указанные термины не предназначены для того, чтобы их истолковывали как «состоит только из».

В настоящем описании термин «приблизительно» означает плюс или минус 20%, более предпочтительно плюс или минус 10%, еще более предпочтительно плюс или минус 5%, наиболее предпочтительно плюс или минус 2%.

Используемый в настоящем документе термин «терапевтически эффективное количество» означает количество композиции, которое требуется для уменьшения тяжести и/или улучшения по меньшей мере одного состояния или симптома, которые являются результатом рассматриваемого заболевания.

В настоящем описании варианты осуществления настоящего изобретения описаны способом, который позволяет сделать описание четким и лаконичным, однако должно быть понятно и очевидно, что варианты осуществления настоящего изобретения могут быть различным образом скомбинированы или разделены без отступления от настоящего изобретения.

Для клинического применения соединение по настоящему изобретению или его пролекарство получают в форме фармацевтической композиции, которая составлена так, чтобы быть совместимой с предназначенным для нее путем введения, например, пероральным, ректальным, парентеральным или другими способами введения. Фармацевтические композиции обычно получают смешиванием активной субстанции со стандартным фармацевтически приемлемым разбавителем или носителем. Используемое в настоящем документе выражение «фармацевтически приемлемый носитель» включает любой и все растворители, дисперсионные среды, покрытия, антибактериальные и противогрибковые агенты, изотонические и задерживающие всасывание агенты и т.п., совместимые с фармацевтическим введением. Примерами фармацевтически приемлемых разбавителей или носителей являются вода, желатин, аравийская камедь, лактоза, микрокристаллическая целлюлоза, крахмал, натриевая соль гликолята крахмала, гидрофосфат кальция, стеарат магния, тальк, коллоидный диоксид кремния и т.п. Применение таких сред и агентов для фармацевтически активных субстанций хорошо известно в данной области. За исключением тех случаев, когда любые обычные среды или агенты являются несовместимыми с активным соединением, их применение в композициях предусматривается.

Указанные композиции также могут содержать другие фармакологически активные агенты и обычные добавки, такие как стабилизаторы, увлажняющие агенты, эмульгаторы, корригенты, буферы и т.п.

Композиции могут быть, кроме того, получены известными способами, такими как гранулирование, прессование, микроинкапсуляция, напыление покрытия и т.п. Композиции можно получать обычными способами в лекарственной форме в виде таблеток, капсул, гранул, порошков, сиропов, суспензий, суппозиториев или препаратов для инъекций. Жидкие композиции могут быть получены растворением или суспендированием активной субстанции в воде или других подходящих средах. На таблетки можно наносить покрытие стандартными способами.

Растворы или суспензии, используемые для парентерального, внутрикожного или подкожного введения, могут включать следующие компоненты: стерильный разбавитель, такой как вода для инъекций, солевой раствор, нелетучие масла, полиэтиленгликоли, глицерин, пропиленгликоль или другие синтетические растворители; антибактериальные агенты, такие как бензиловый спирт или метилпарабены; антиоксиданты, такие как аскорбиновая кислота или бисульфит натрия; хелатирующие агенты, такие как этилендиаминтетрауксусная кислота; буферы, такие как ацетаты, цитраты или фосфаты, и агенты для коррекции тоничности, такие как хлорид натрия или декстроза. Величину рН можно регулировать кислотами или основаниями, такими как хлористоводородная кислота или гидроксид натрия. Парентеральный препарат может быть заключен в ампулы, одноразовые шприцы или флаконы, содержащие множество доз, изготовленные из стекла или пластика.

Фармацевтические композиции, подходящие для введения инъекцией, включают стерильные водные растворы (в случае растворимости в воде) или дисперсии и стерильные порошки для приготовления стерильных растворов или дисперсий для инъекций непосредственно перед введением. Подходящие носители для внутривенного введения включают физиологический раствор, бактериостатическую воду, Cremophor ELTM (BASF, Parsippany, NJ) или забуференный фосфатом физиологический раствор (PBS). Во всех случаях композиция должна быть стерильной и представлять собой жидкость до той степени, которая позволяет использовать шприц. Она должная быть стабильной в условиях производства и хранения и должна быть защищена от заражающего действия микроорганизмов, таких как бактерии и грибы. Носителем может быть растворитель или дисперсионная среда, содержащая, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль и т.п.) и их подходящие смеси. Должную текучесть можно поддерживать, например, использованием покрытия, такого как лецитин, поддержанием требуемого размера частиц в случае дисперсии и использованием поверхностно-активных веществ. Предотвращение действия микроорганизмов может быть достигнуто различными антибактериальными и противогрибковыми агентами, например, парабенами, хлорбутанолом, фенолом, аскорбиновой кислотой, тимеросалом и т.п. Во многих случаях будет предпочтительно включать в композицию изотонические агенты, например, сахара, полиспирты, такие как маннит, сорбит, хлорид натрия. Пролонгированное всасывание композиций для инъекций может обеспечить включение в композицию агента, который замедляет всасывание, например, моностеарат алюминия и желатин.

Стерильные растворы для инъекций могут быть получены путем инкорпорирования активного соединения (например, соединения по одному из вариантов осуществления настоящего изобретения) в требуемом количестве в подходящий растворитель с одним или с комбинацией ингредиентов, названных выше, при необходимости, с последующей стерилизацией фильтрованием. Как правило, дисперсии получают путем инкорпорирования активного соединения в стерильный носитель, который содержит основную дисперсионную среду и необходимые другие ингредиенты из тех, которые были названы выше. В случае стерильных порошков для приготовления стерильных инъецируемых растворов, предпочтительными способами получения являются вакуумная сушка и лиофилизация, в результате которых получают порошок активного ингредиента плюс любой дополнительный желательный ингредиент из его ранее стерилизованного фильтрованием раствора.

Пероральные композиции обычно содержат инертный разбавитель или съедобный носитель. Их можно помещать в желатиновые капсулы или прессовать в таблетки. Для целей перорального терапевтического введения активное соединение может быть инкорпорировано с эксципиентами и использовано в форме таблеток, пастилок или капсул. Пероральные композиции также могут быть получены с использованием жидкого носителя для применения в качестве жидкости для полоскания рта, где соединение в жидком носителе применяют орально, полощут и выплевывают или проглатывают. Фармацевтически совместимые связующие агенты и/или адъювантные вещества можно включать в качестве части композиции. Таблетки, пилюли, капсулы, пастилки и тому подобное могут содержать любой из следующих ингредиентов или соединений сходной природы: связующий агент, такой как микрокристаллическая целлюлоза, трагакантовая камедь или желатин; эксципиент, такой как крахмал или лактоза, разрыхляющий агент, такой как альгиновая кислота, Primogel или кукурузный крахмал; смазывающий агент, такой как стеарат магния или Sterotes; агент, обеспечивающий скольжение, такой как коллоидный диоксид кремния; подсластитель, такой как сахароза или сахарин; или корригент, такой как мята перечная, метилсалицилат или апельсиновый корригент.

Для введения путем ингаляции соединения доставляются в форме аэрозольного спрея из контейнера или дозатора под давлением, который содержит подходящий пропеллент, например, газ, такой как диоксид углерода, или из небулайзера.

Системное введение можно также осуществлять чресслизистыми или чрескожными средствами. Для чресслизистого или чрескожного введения в композиции используют пенетранты, подходящие для того барьера, через который необходимо проникнуть. Указанные пенетранты обычно известны специалистам и включают, например, для чресслизистого введения, детергенты, желчные соли и производные фусидовой кислоты. Чресслизистое введение можно осуществлять посредством использования назальных спреев или суппозиториев. Для чрескожного введения активные соединения составляют в виде мазей, гелей или кремов, как обычно известно специалистам.

Соединения также можно получать в форме суппозиториев (например, с обычными основами для суппозиториев, такими как масло какао и другие глицериды) или удерживающих клизм для ректальной доставки.

В одном варианте осуществления настоящего изобретения активные соединения получают с носителями, которые будут защищать соединение от быстрого выведения из организма, например, в форме композиции с контролируемым высвобождением, включая имплантаты и микроинкапсулированные системы доставки. Можно использовать биоразлагаемые, биосовместимые полимеры, такие как этиленвинилацетат, полиангидриды, полигликолевая кислота, коллаген, полиортоэфиры и полимолочная кислота. Способы получения таких композиций будут очевидны для специалистов в данной области. Материалы также можно приобрести коммерческим путем от Alza Corporation и Nova Pharmaceuticals, Inc. Липосомальные суспензии (включая липосомы, нацеленные на инфицированные клетки с помощью моноклональных антител к вирусным антигенам) также можно использовать в качестве фармацевтически приемлемых носителей. Последние могут быть получены в соответствии со способами, известными специалистам.

Особенно выгодно составлять пероральные или парентеральные композиции в виде дозированных лекарственных форм для простоты введения и однородности доз. Термин «дозированная лекарственная форма», используемый в настоящем документе, относится к физически дискретным единицам, подходящим в качестве единичных доз для субъекта, которому назначено лечение; каждая единица содержит заранее определенное количество активного соединения, рассчитанное таким образом, чтобы произвести желаемое терапевтическое действие, в сочетании с требуемым фармацевтическим носителем. Спецификация для дозированных лекарственных форм по настоящему изобретению диктуется и напрямую зависит от уникальных характеристик активного соединения и конкретного терапевтического эффекта, которого необходимо добиться, а также от ограничений, имеющих место в области составления композиций, таких как активное соединение для лечения отдельных лиц.

Токсичность и терапевтическую эффективность указанных соединений можно определить с использованием стандартных фармацевтических методик на клеточных культурах или экспериментальных животных, например, для определения LD50 (дозы, летальной для 50% популяции) и ED50 (дозы, терапевтически эффективной для 50% популяции). Соотношение доз между токсическим и терапевтическим эффектом представляет собой терапевтический индекс, и его можно выразить как соотношение LD50/ED50. Соединения, которые имеют большие терапевтические индексы, являются предпочтительными. Несмотря на то, что соединения, которые имеют токсические побочные эффекты, можно использовать, следует обратить внимание на конструкцию системы доставки, которая нацеливает указанные соединения в область пораженной ткани, с целью минимизировать возможное повреждение неинфицированных клеток и, таким образом, уменьшить побочные эффекты.

Данные, полученные по результатом исследований на клеточных культурах и экспериментальных животных, можно использовать для разработки пределов доз для людей. Доза указанных соединений находится предпочтительно в пределах циркулирующих концентраций, которые включают ED50 с малой токсичностью или без токсичности. Доза может варьировать в указанных пределах в зависимости от используемой лекарственной формы и пути введения. Для любого соединения, используемого в способе по настоящему изобретению, терапевтически эффективную дозу можно установить сначала по результатам исследования на клеточных культурах. Дозу можно определить на экспериментальных животных для достижения пределов циркулирующих концентраций в плазме, которые включают IC50 (т.е. концентрацию тест-соединения, при которой достигается половина максимального ингибирования симптомов), определенную на клеточной культуре. Такую информацию можно использовать для более точного определения подходящих доз для людей. Уровни в плазме могут быть измерены, например, методом высокоэффективной жидкостной хроматографии.

Фармацевтические композиции можно помещать в контейнер, упаковку или дозатор вместе с инструкциями по введению.

В данном описании «идентичность», как это известно в данной области, представляет собой взаимосвязь между двумя или более полипептидными последовательностями, или двумя или более полинуклеотидными последовательностями, как определено сравнением последовательностей. В данной области «идентичность» также означает степень сходства между полипептидными или полинуклеотидными последовательностями, в зависимости от обстоятельств, как определено по совпадениям между цепочками таких последовательностей. Идентичность в процентах можно легко рассчитать известными способами, включая, без ограничения, способы, описанные в публикациях Computational Molecular Biology, Lesk, A.M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Hienje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988), все из которых полностью включены в настоящий документ путем ссылки. Предпочтительные способы определения идентичности разработаны так, чтобы выявить наибольшее число совпадений между изучаемыми последовательностями. Способы определения идентичности систематизированы в общедоступных компьютерных программах. Предпочтительные компьютерные программы для определения процентной идентичности между двумя последовательностями включают, без ограничения, пакет программ GCG (публикация Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984), которая полностью включена в настоящий документ путем ссылки), BLASTP, BLASTN и FASTA (публикация Atschul, S.F. et al., J. Molec. Biol. 215: 403-410 (1990), которая полностью включена в настоящий документ путем ссылки). Программа BLAST X является общедоступной в NCBI и других источниках (публикации BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990), которые полностью включены в настоящий документ путем ссылки). В качестве иллюстрации, под полинуклеотидом, имеющим нуклеотидную последовательность, обладающую по меньшей мере, например, 95% «идентичностью» со стандартной нуклеотидной последовательностью «SEQ ID NO:A», подразумевается, что нуклеотидная последовательность полинуклеотида идентична стандартной нуклеотидной последовательности, за исключением того, что полинуклеотидная последовательность может включать до пяти точечных мутаций на каждые 100 нуклеотидов стандартной нуклеотидной последовательности «SEQ ID NO:A». Иными словами, чтобы получить полинуклеотид, имеющий нуклеотидную последовательность, по меньшей мере на 95% идентичную стандартной нуклеотидной последовательности, до 5% нуклеотидов в стандартной последовательности может быть удалено или заменено другим нуклеотидом, или количество нуклеотидов до 5% от общего количества нуклеотидов в стандартной последовательности может быть вставлено в стандартную последовательность. Указанные мутации стандартной последовательности могут наблюдаться в терминальных положениях 5' или 3' стандартной нуклеотидной последовательности, или где-либо между указанными терминальными положениями, быть рассеянными или индивидуально среди нуклеотидов в стандартной последовательности, или в виде одной или нескольких смежных групп в пределах стандартной последовательности. Аналогично, под полипептидом, имеющим аминокислотную последовательность, обладающую по меньшей мере, например, 95% идентичностью со стандартной аминокислотной последовательностью «SEQ ID NO:В», подразумевается, что аминокислотная последовательность полипептида является идентичной стандартной последовательности, за исключением того, что полипептидная последовательность может включать до пяти аминокислотных изменений на каждые 100 аминокислот стандартной аминокислотной последовательности «SEQ ID NO:В». Иными словами, чтобы получить полипептид, имеющий аминокислотную последовательность, по меньшей мере на 95% идентичную стандартной аминокислотной последовательности, до 5% аминокислотных остатков в стандартной последовательности может быть удалено или заменено другой аминокислотой, или количество аминокислот до 5% от общего количества аминокислотных остатков в стандартной последовательности может быть вставлено в стандартную последовательность. Указанные изменения в стандартной последовательности могут наблюдаться в амино- или карбокситерминальных положениях стандартной аминокислотной последовательности, или где-либо между указанными терминальными положениями, быть рассеянными или индивидуально среди остатков в стандартной последовательности, или в виде одной или нескольких смежных групп в пределах стандартной последовательности.

Используемый в настоящем документе термин «гибридизуется в строгих условиях» описывает условия для гибридизации и промывания, при которых нуклеотидные последовательности, кодирующие рецептор, по меньшей мере на 50% гомологичные друг другу, обычно остаются гибридизованными друг с другом. Условия могут быть такими, что последовательности, по меньшей мере приблизительно на 65%, по меньшей мере приблизительно на 70% или по меньшей мере приблизительно на 75% или более гомологичные друг другу, обычно остаются гибридизованными друг с другом. Указанные строгие условия известны специалистам и могут быть найдены в публикации Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6. 3.1-6.3.6, которая полностью включена в настоящий документ путем ссылки. Одним примером строгих условий гибридизации является гибридизация в 6× хлориде натрия/цитрате натрия (SSC) при температуре около 45°C, с последующим одним или несколькими промываниями в 0,2×SSC, 0,1% SDS при 50-65°C. В одном варианте осуществления настоящего изобретения выделенная молекула нуклеиновой кислоты рецептора, которая гибридизуется в строгих условиях с последовательностью SEQ ID NO:1, соответствует природно-встречающейся молекуле нуклеиновой кислоты. Используемое в настоящем документе выражение «природно-встречающаяся» молекула нуклеиновой кислоты относится к молекуле РНК или ДНК, имеющей нуклеотидную последовательность, которая встречается в природе (например, кодирует натуральный белок).

В данном описании термин «антитело или фрагмент антитела» относится к антителу (например, IgG, IgM, IgA, IgD или IgE) или фрагменту (такому как Fab, F(ab')2, Fv, связанный дисульфидными мостиками Fv, scFv, мультиспецифичное антитело с закрытой конформацией, связанный дисульфидными мостиками scFv, диатело), полученному от любого вида, продуцирующего антитело в естественных условиях, или созданному с использованием технологии рекомбинантной ДНК, или выделенному из сыворотки, В-клеток, гибридом, трансфектом, дрожжей или бактерий.

В данном описании термин «лечение» означает лечение существующего заболевания и/или профилактическое лечение с целью предотвращения возникновения заболевания. В качестве таковых, способы по настоящему изобретению можно использовать для лечения, предотвращения, ингибирования прогрессирования или отсрочки возникновения заболевания.

Термин «биомаркер» используется повсеместно в данной области и означает особый биологический или полученный биологическим путем индикатор процесса, события или состояния. Иными словами, биомаркер является показателем определенного биологического состояния, такого как наличие раковой ткани. В некоторых случаях различные формы биомаркеров могут быть показателями определенных патологических состояний, но, не ограничиваясь какой бы то ни было теорией, полагают, что простое наличие повышенных уровней биомаркеров по настоящему изобретению в жидкостях организма, таких как мокрота или моча, является показателем рака легкого или рака мочевого пузыря, соответственно. Хотя в настоящее время не представляется, что секретируются различные гликоформы, например, пептида EN2, последние, тем не менее, охватываются настоящим изобретением. Например, различные гликоформы, такие как измененная гликоформная структура или содержание сахара, все же могут быть определены для EN2, но они могут осуществляться и могут даже также быть показателем прогрессирования рака мочевого пузыря или рака легкого. Усечения, мутации или делеции пептида EN2 или сшивки с ним, или его фрагменты также предусмотрены.

Как обсуждалось выше, неожиданно было установлено, что имеет место значимое увеличение экспрессии гена EN2 в опухолях мочевого пузыря и легкого по сравнению с нормальной тканью. Кроме того, EN2 обнаруживается в моче пациентов с раком мочевого пузыря. Полагают, что EN2 может секретироваться или может быть выявлен в жидкостях организма благодаря утечке из поврежденных или мертвых клеток. Указанные повышенные уровни являются показателем рака мочевого пузыря и рака легкого как ранней, так и поздней стадии. В то время как имеет место значимое повышение между контрольными или нормальными уровнями и ранней стадией рака мочевого пузыря и рака легкого, также имеется весьма значимое увеличение между ранней и поздней стадией рака мочевого пузыря и рака легкого. В широком смысле, преимуществом настоящего изобретения является то, что субстанция, а также состояние рака может быть выявлено. Это способствует прогнозу и назначению адекватного лечения.

Другим преимуществом настоящего изобретения является то, что можно поставить точный диагноз, не прибегая к неприятным и потенциально вредным инвазивным процедурам, которые также могут быть неточными. Кроме того, настоящее изобретение является особенно чувствительным. Предпочтительно, способами по настоящему изобретению можно выявлять возникновение рака раньше любого другого способа обнаружения и раньше возникновения явных симптомов рака. Таким образом, рак можно лечить на ранней стадии, когда он является более чувствительным к такому лечению и с меньшей вероятностью перейдет в метастатическую стадию.

Биомаркер по настоящему изобретению можно использовать в способах диагностики, например, для клинического скрининга и в способах прогностической оценки, мониторинга результатов лечения, идентификации пациентов, которые с наибольшей вероятностью отреагируют на конкретную схему лечения, скрининга и разработки лекарственных средств. Помимо этого, биомаркеры по настоящему изобретению и их применение являются ценными для идентификации новых способов медикаментозного лечения и для открытия новых мишеней для медикаментозного лечения.

Термин «диагноз» охватывает идентификацию, подтверждение и/или описание признаков наличия или отсутствия рака мочевого пузыря или рака легкого вместе со стадией их развития, такой как ранняя стадия или поздняя стадия, или доброкачественного или метастатического рака.

ПРИМЕРЫ

EN2 при раке мочевого пузыря

Заявители изучили экспрессию EN2 при раке мочевого пузыря. Количество транскриптов мРНК EN2 в трех различных опухолях ТСС сравнивали с их количеством в нормальной ткани, прилегающей к опухоли («NAT»), используя полуколичественную ПЦР. Было установлено, что EN2 экспрессируется на уровне, который в 1457 раз выше в опухолях, чем в NAT.

Дальнейшее исследование было проведено для того, чтобы выяснить, отражается ли указанная разница в экспрессии гена в истинном количестве белка EN2, присутствующего в моче пациентов с раком мочевого пузыря. С этой целью мочу собирали у пациентов, которые проходили цистоскопическое исследование по подозрению на рак мочевого пузыря. Использовали 20 мкл мочи для анализа на белок EN2 посредством вестерн блоттинга с использованием способов, описанных ниже. Всего было обследовано 62 пациента, из которых только у трех впоследствии диагностировали рак мочевого пузыря. У всех трех указанных пациентов обнаружили в моче белок EN2, в то время как у 59 пациентов, у которых было установлено отсутствие заболевания, не имелось поддающегося обнаружению количества белка EN2. Результаты представлены на фигуре 1.

EN2 при раке легкого

Заявители изучили экспрессию EN2 при раке легкого. Количество транскриптов мРНК EN2 в трех различных опухолях NSCLC сравнивали с их количеством в нормальной ткани, прилегающей к опухоли («NAT»), и в А549, клеточной линии, полученной из опухоли NSCLC, используя полуколичественную ПЦР. Было установлено, что, относительно NAT, EN2 экспрессируется на уровне, который в 28,9 и 14,6 раз выше в опухолях и в клетках А549, соответственно. Результаты представлены на фигуре 2.

Использованные способы

1. Обнаружение белка EN2 в образцах мочи (рак мочевого пузыря)

Обнаружение белка EN2 посредством вестерн блоттинга: 1,5 мл мочи центрифугировали при 10000 g в течение пяти минут для удаления клеток и клеточного дебриса. Затем 20 мкл супернатанта смешивали непосредственно с 5 мкл буфера, являющегося подвижной фазой, из геля LDL (Invitrogen) и 2 мкл восстанавливающего агента (Invitrogen) и нагревали до 70°C в течение десяти минут. Белки разделяли с использованием электрофореза в 10% SDS-полиакриламидном геле и переносили на мембрану из поливинилиденфторида. Антитело к EN2 (Abcam, UK) использовали в концентрации 0,5 мкг/мл.

2. Обнаружение РНК EN2 в образцах тканей (рак мочевого пузыря и рак легкого)

Количественная ПЦР: РНК сначала денатурировали нагреванием до 65°C в течение пяти минут. 1-5 мкг РНК инкубировали в объеме 50 мкл при 37°C в течение одного часа с конечными концентрациями 10 мМ DTT, 1 мМ dNTP смеси, а также 100 нг/мл поли-Т праймеров, 200 единиц обратной транскриптазы (Invitrogen, USA) и 40 единиц РНКазы OUT (Invitrogen, USA). Реакцию синтеза кДНК заканчивали, подвергая пробирки действию температуры 80°C в течение пяти минут. ОТ-ПЦР осуществляли с использованием устройства Stratagene MX4000 Real Time PCR, измеряющего накопление продукта ПЦР во время экспоненциальной фазы реакции с помощью зеленой флуоресценции SYBR. Экспрессию EN2 рассчитывали относительно экспрессии гена бета-актина, которая является относительно постоянной во многих клеточных типах.

3. Обнаружение EN2 на поверхности клеток рака мочевого пузыря

Четыре клеточные линии, полученные от больных раком мочевого пузыря, инкубировали с антителом к EN2, затем с вторичным антителом с флуоресцентной меткой. Клетки затем сортировали с использованием FACS. Результаты показаны на фигуре 3. Черная линия показывает клетки, обработанные только вторичным антителом, а серая линия показывает клетки, обработанные обоими антителами. Сдвиг серой кривой вправо указывает на то, что белок EN2 был доступен на поверхности клетки для связывания с первичным антителом. Указанные результаты показывают, что клеточные линии «TCC», «EJ» и «BHK», но не «T24», имеют белок EN2 на поверхности клетки.

Приобретение тканей: РНК опухолей мочевого пузыря и легкого, вместе с РНК из нормальной прилегающей ткани покупали у Ambion Inc., USA.

Последовательности праймеров для количественной ПЦР:

Бета-актин (человека):

HsBeta-ActinF: 5' ATGTACCCTGGCATTGCCGAC 3' (SEQ ID NO:3)

HsBeta-ActinR: 5' GACTCGTCATACTCCTGCTTG3' (SEQ ID NO:4)

EN2 (человека):

HsEN2F: 5' GAACCCGAACAAAGAGGACA 3' (SEQ ID NO:5)

HsEN2R: 5' CGCTTGTTCTGGAACCAAAT 3' (SEQ ID NO:6)

Следует понимать, что различные изменения и модификации предпочтительных в настоящее время вариантов осуществления изобретения, описанных в настоящем документе, будут очевидны для специалистов в данной области. Такие изменения и модификации могут быть осуществлены без отступления от сущности и объема настоящего изобретения и без уменьшения присущих ему преимуществ. Таким образом, прилагаемая формула изобретения охватывает указанные изменения и модификации.

1. Применение (i) последовательности нуклеиновой кислоты, состоящей из SEQ ID NO:1, или (ii) аминокислотной последовательности, состоящей из SEQ ID NO:2, в способе диагностики рака мочевого пузыря у пациента.

2. Способ диагностики рака мочевого пузыря у пациента или идентификации пациента, имеющего риск развития рака мочевого пузыря, где указанный способ включает:
(a) определение количества специфичного для рака биомаркера, содержащего (i) последовательность нуклеиновой кислоты, состоящую из SEQ ID NO:1, или (ii) аминокислотную последовательность, состоящую из SEQ ID NO:2, в образце, содержащем мочу или ткань мочевого пузыря, полученном от пациента;
(b) сравнение в образце, полученном от пациента, количества определенного специфичного для рака биомаркера с количеством специфичного для рака биомаркера в нормальном контроле;
в котором разница между количеством специфичного для рака биомаркера в образце, полученном от пациента, и количеством специфичного для рака биомаркера в нормальном контроле связана с наличием рака мочевого пузыря или связана с риском развития рака мочевого пузыря.

3. Способ по п. 2 для выявления рака на ранней стадии, в котором повышение между контролем и образцом, полученным от пациента, указывает на наличие рака на ранней стадии.

4. Способ по п. 2 для выявления рака на поздней стадии, в котором повышение между контролем и образцом, полученным от пациента, указывает на наличие рака на поздней стадии.

5. Способ мониторинга прогрессирования рака мочевого пузыря у пациента, где указанный способ включает:
(a) определение количества специфичного для рака биомаркера, содержащего (i) последовательность нуклеиновой кислоты, состоящую из SEQ ID NO:1, или (ii) аминокислотную последовательность, состоящую из SEQ ID NO:2, в образце, содержащем мочу или ткань мочевого пузыря, полученном от пациента;
(b) сравнение в образце, полученном от пациента, количества определенного специфичного для рака биомаркера с количеством специфичного для рака биомаркера в нормальном контроле; и
(c) повторение этапов (а) и (b) через два или более интервалов времени,
в котором увеличение с течением времени количества специфичного для рака биомаркера в образце, полученном от пациента, связано с увеличением прогрессирования рака мочевого пузыря, а уменьшение с течением времени количества специфичного для рака биомаркера в образце, полученном от пациента, связано с уменьшением прогрессирования рака мочевого пузыря.

6. Способ по п. 5 для мониторинга изменения стадии рака, в котором увеличение, относительно образца более ранней стадии или контроля, указывает на прогрессирование рака с более ранней стадии до более поздней стадии заболевания.

7. Способ мониторинга эффективности лечения рака мочевого пузыря, включающий
а) выявление и/или количественную оценку наличия специфичного для рака биомаркера, содержащего (i) последовательность нуклеиновой кислоты, состоящую из SEQ ID NO:1, или (ii) аминокислотную последовательность, состоящую из SEQ ID NO:2, в образце, содержащем мочу или ткань мочевого пузыря, полученном от пациента;
b) сравнение в образце, полученном от пациента, количества определенного специфичного для рака биомаркера с количеством специфичного для рака биомаркера в контрольном образце, полученном до начала лечения;
где увеличение количества специфичного для рака биомаркера в образце, полученном от пациента, связано с ускорением прогрессирования рака мочевого пузыря и является показателем отсутствия эффективности лечения, а уменьшение количества специфичного для рака биомаркера в образце, полученном от пациента, связано с уменьшением прогрессирования рака мочевого пузыря и является показателем эффективности лечения.

8. Способ по любому из пп. 2-7, в котором образец включает ткань мочевого пузыря, полученную от пациента.

9. Способ по п. 8, в котором образец включает мочу.

10. Набор для применения в способе по любому из пп. 2-9, где указанный набор включает лиганд, способный связываться или специфическим образом распознавать специфичный для рака биомаркер содержащий (i) последовательность нуклеиновой кислоты, состоящую из SEQ ID NO:1, или (ii) аминокислотную последовательность, состоящую из SEQ ID NO:2, и поддающийся обнаружению в жидкости организма, а также репортерные средства.



 

Похожие патенты:

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Изобретение относится к области биохимии, в частности к способу определения зиготности растения сои, включающего арилоксиалканоатдиоксигеназу (AAD-12) с SEQ ID NO: 1, где указанное растение содержит трансгенную конструкцию, включающую ген AAD-12, состоящий из остатков 2731-9121 SEQ ID NO: 1, и указанная трансгенная конструкция фланкирована 5′-фланкирующей геномной ДНК сои и 3′-фланкирующей геномной ДНК сои, где указанная 5′-фланкирующая геномная ДНК содержит остатки 1-2730 SEQ ID NO: 1, указанная 3′-фланкирующая геномная ДНК содержит остатки 9122-10212 SEQ ID NO: 1, а также к комплекту для его выполнения.

Группа изобретений относится к области молекулярной биологии. Сущность изобретения состоит в подавлении активности активированного онкогена AML-ETO методом РНК-интерференции в злокачественных кроветворных клетках, полученных от больных лейкозом, с использованием конструкции малой шпилечной РНК, встроенной в лентивирусный вектор pLSLP-AML-ETO-shRNA, кодируемой нуклеотидной последовательностью двухцепочечной ДНК, представляющей собой: 5′-р-gatccgCCTCGAAATCGTACTGAGActtcctgcaa TCTCAGTACGATTTCGAGGtttttg-3′ (смысловая цепь), 5′-р-aattcaaaaaCCTCGAAATCGTACT GAGAttgcaggaagTCTCAGTACGATTTCGAGGcg-3′ (антисмысловая цепь).

Изобретение относится к биотехнологии и касается библиотеки нуклеотидных последовательностей в составе клонировочного плазмидного вектора. Целью изобретения является конструирование олигонуклеотидных праймеров для получения библиотеки полноразмерных генов, кодирующих иммунодоминантные белки р17, р30, р54, р60, р72 вируса АЧС.

Изобретение относится к области биотехнологии, а именно к набору для выявления ДНК вируса оспы свиней методом полимеразной цепной реакции в реальном времени. Набор включает олигонуклеотидные праймеры и флуоресцентно-меченый зонд следующего состава: SPVU - 5' - gta сса ttt tgg agg аса cg - 3', SPVD - 5' - ttc aat aaa tcg cca gtt gta с - 3', SPVZ - 5'- [FAM] ggt acc ata tct ata tat ccc tgt tg [BHQ1] - 3'.

Изобретение относится к области биотехнологии. Способ обнаружения вещества, которое опосредует положительную регуляцию транскрипции гена биологического маркера, или определения, опосредует ли вещество положительную регуляцию транскрипции гена биологического маркера, состоит из следующих этапов: обеспечение первой системы анализа, включающей последовательность мРНК, которая содержит область, кодирующую первый репортерный белок, функционально связанную с промотором первого биологического маркера; обеспечение второй системы анализа, включающей вторую последовательность мРНК, которая содержит область, кодирующую второй репортерный белок, функционально связанную с промотором второго биологического маркера; осуществление контакта указанной второй системы анализа с веществом; осуществления контакта указанной первой системы анализа со стандартным веществом или контрольным веществом и определение уровней транскрипции указанных первой и второй последовательностей мРНК.

Изобретение относится к биотехнологии и представляет собой выделенную нуклеиновую кислоту для типирования и/или маркировки штаммов Bifidobacterium lactis, состоящую из последовательности локуса CRISPR В.lactis, выбранной из группы, состоящей из a) Balal (SEQ ID NO: 1); b) последовательности повтора Balal, выбранной из последовательности SEQ ID NO: 2 и ее вариантов; c) последовательности спейсера Balal, выбранной из SEQ ID NO:3-24; где варианты последовательности SEQ ID NO: 2 выбраны из группы, состоящей из: замены Т в положении 12, замены Т в положении 14 и замены А в положении 36.
Изобретение относится к биотехнологии, а именно к способу диагностики хронической сердечной недостаточности (ХСН). Способ включает исследование крови человека методом полимеразной цепной реакции с гибридизационно-флуоресцентной детекцией продуктов амплификации.
Изобретение относится к биотехнологии, а именно к способу диагностики хронической сердечной недостаточности (ХСН). Способ включает исследование крови человека методом полимеразной цепной реакции с гибридизационно-флуоресцентной детекцией продуктов амплификации.

Изобретение относится к биотехнологии. Предложен способ определения наличия в биологических жидкостях, окружающей среде и продуктах питания бактерий Escherichia coli штамма O157:Н7, включающий дезинтеграцию бактерий ферментативной обработкой и лизис неионным детергентом, адсорбцию на парамагнитных частицах при помощи специфического моноклонального антитела, детекцию антигена бактерий Е.coli O157:Н7 при помощи специфического биотинилированного моноклонального антитела, связывание полученного комплекса с нековалентным коньюгатом ДНК-матрицы с нейтравидином, диссоциацию твердофазного комплекса "антитело-антиген Е.coli O157:Н7 - биотинилированное антитело-коньюгат" добавлением раствора глицин - HCl рН 2.6, ПЦР-амплификацию ДНК-матрицы и выявление наличия бактерий Е.coli O157:Н7 по скорости нарастания флуоресцентного сигнала.

Изобретения касаются векторной конструкции, штамма Escherichia coli, включающего такую векторную конструкцию, и способа получения рекомбинантного анальгетического пептида РТ1.

Изобретение относится к области биотехнологии, конкретно к получению модифицированного фактора FVII, и может быть использовано в медицине. Полипептид FVII модифицируют путем замены аминокислотного остатка, выбранной из D196L, D196I, D196Y, К197Е, K197D, K197L, К197М, K197I, K197V, K197F, K197W, K197Y, K199D и K199E, в аминокислотной последовательности FVII, представленной в виде SEQ ID NO: 3, или в соответствующих остатках его предшественника с SEQ ID NO: 1 или SEQ ID NO: 2.

Представленная группа изобретений относится к области биотехнологии и касается способов сбора функциональных клеток (варианты). Охарактеризованные решения заключаются в имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель, где популяция клеток мобилизована в емкость с помощью любого из белков HMGB1, HMGB2, HMGB3, S100A8, S100A9 или гиалуроновой кислоты или смеси любых двух или более из указанных.

Изобретение относится к биотехнологии. Предложены: клещевой аллерген домашней пыли, представляющий собой полипептид, содержащий определенную аминокислотную последовательность, приведенную в описании в перечне списка последовательностей; кодирующая полипептид молекула ДНК; экспрессирующий вектор на её основе и трансформированная им рекомбинантная клетка для экспрессии полипептида.

Изобретение относится к области биохимии, в частности к способу получения мутеинов липокалина 2 (Lcn2, hNGAL) человека. Способ основан на мутагенезе молекулы нуклеиновой кислоты, кодирующей белок Lcn2 человека.

Группа изобретений относится к медицине, а именно к гематологии и может быть использована при лечении расстройств, ассоциированных с кровотечением. Способ по изобретению включает введение субъекту химерного полипептида фактора VIIa, где указанный химерный полипептид фактора VIIa включает домен EGF-2 и каталитический домен фактора VII; домен GLA, выбранный из группы, состоящей из домена GLA фактора VII, домена GLA фактора IX и домена GLA белка S; и домен EGF-1, выбранный из группы, состоящей из домена EGF-1 фактора IX и домена EGF-1 белка S.

Настоящее изобретение относится к области иммунологии. Предложен выделенный пептид, представляющий собой фрагмент белка CDC45L и обладающий способностью индуцировать цитотоксические Т-лимфоциты в форме комплекса с молекулой HLA-A*2402 или HLA-A*0201.

Изобретение относится к области биотехнологии, конкретно к интернализации терапевтических молекул внутрь клетки, и может быть использовано в медицине. Получают композицию для доставки молекул нуклеиновых кислот в клетки, содержащую по меньшей мере один пептид с по меньшей мере 92% идентичностью к GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); или YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), присоединенный к одной или нескольким молекулам нуклеиновых кислот.

Группа изобретений относится к способам для лечения или предупреждения заболеваний, вызванных неоваскуляризацией хориоидеи человека (неоваскулярной макулопатией), а также к фармацевтическим композициям, содержащим в качестве активного ингредиента по меньшей мере один пептид из пептидов, содержащих аминокислотную последовательность, полученную из белка VEGF-рецептора 1, и обладающих активностью индуцировать цитотоксические Т-клетки в присутствии антиген-представляющих клеток и по меньшей мере один пептид из пептидов, содержащих аминокислотную последовательность, полученную из белка VEGF-рецептора 2 и обладающих активностью индуцировать цитотоксические Т-клетки в присутствии антиген-представляющих клеток или кодирующие их полинуклеотиды, где клетки сосудистого эндотелия, вовлеченные в неоваскуляризацию хориоидеи у человека, экспрессируют VEGFR-1 рецепторный белок на поверхности клеток.

Настоящее изобретение относится к области биотехнологии и может быть использовано для рекомбинантной экспрессии иммуномодуляторных белков. Конструируют вектор, содержащий полинуклеотид, кодирующий генный переключатель, при этом указанный полинуклеотид содержит (1) по меньшей мере одну последовательность фактора транскрипции, которая функционально связана с промотором, при этом указанная по меньшей мере одна последовательность фактора транскрипции кодирует лиганд-зависимый фактор транскрипции, и (2) полинуклеотид, кодирующий полипептид IL-12 и один или более иммуномодуляторных полипептидов, выбранных из IL-2, IL-7, IL-15, IL-18, IL-21, GM-CSF, CCL3 (MIP-1a), CCL5 (RANTES), CCL7 (MCP3), XCL1 (лимфотактин), CCL19 (MIP-3b), CXCL9 (MIG), CXCL10 (IP-10), CXCL12 (SDF-1), CCL21 (6Ckine) или TNF-альфа.
Наверх