Пептид для лечения сахарного диабета 2-го типа и его осложнений



Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений
Пептид для лечения сахарного диабета 2-го типа и его осложнений

 


Владельцы патента RU 2573933:

Дафот Энтерпрайсис Лимитед (CY)

Изобретение относится к биотехнологии. Представлен аналог эксенатида формулы H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH. Изобретение позволяет лечить и проводить профилактику сахарного диабета, а также лечить и проводить профилактику осложнений сахарного диабета 2-го типа, таких как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия. 3 ил., 7 табл., 13 пр.

 

Изобретение относится к новому аналогу эксенатида формулы H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH, который может быть использован для лечения и профилактики сахарного диабета, а также для лечения и профилактики осложнений сахарного диабета 2-го типа, таких как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия.

Изобретение относится к области медицины и фармации и может быть использовано в качестве лекарственных средств для профилактики и лечения сахарного диабета 2-го типа, а также его осложнений, таких как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия.

Сахарный диабет 2-го типа (СД 2 или инсулиннезависимый диабет) - это хроническое, полиорганное заболевание, которое проявляется в основном нарушением обмена углеводов. В результате патологических изменений развивается гипергликемия, кроме того, имеет место дисфункция специализированных клеток поджелудочной железы, ответственных за выработку инсулина. Основной причиной летальности пациентов с сахарным диабетом 2-го типа является, прежде всего, развитие макрососудистых осложнений (поражение коронарных, церебральных и периферических артерий). Также СД 2 является одним из основных компонентов развития метаболического синдрома (инсулинрезистентного или синдрома X) [1]. В последнее время растет число наблюдений того, что СД 2 является патологическим маркером развития болезни Альцгеймера [2].

По данным ВОЗ на окончание 2013 года во всем мире насчитывается около 347 миллионов человек больных диабетом [3]. В 2004 году 3,4 миллиона человек умерли от последствий высокого содержания сахара в крови [4]. В 2010 году число смертельных случаев от осложненного диабета осталось на прежнем уровне [5]. По прогнозам ВОЗ, в 2030 году диабет станет седьмой по значимости причиной смерти [4]. Было принято считать, что СД 1-го типа в развитых странах встречается у 10-15% пациентов, а СД 2-го типа - у 85-90%. Но в последние годы частота СД 2-го типа в развитых странах очень быстро растет, а число больных СД 1-го типа изменилось мало. Согласно последней информации ВОЗ, соотношение СД 1-го и 2-го типов в мире сегодня изменилось в сторону увеличения частоты СД 2-го типа [5].

Наиболее ранним и частым осложнением сахарного диабета является диабетическая нейропатия [6], которая характеризуется расстройством нервной системы, связанным с поражением малых кровеносных сосудов (vasa vasorum, vasa nervorum). Данное осложнение не только приводит к снижению трудоспособности, но и нередко является причиной развития тяжелых инвалидизирующих поражений и гибели пациентов. Патологический процесс затрагивает все нервные волокна: чувствительные, двигательные и вегетативные. По данным разных авторов, диабетическая нейропатия встречается у 90-100% больных сахарным диабетом. Частота поражений нервной системы при сахарном диабете прямо пропорционально зависит от длительности заболевания, причем в некоторых случаях она предшествует появлению основных клинических признаков диабета. Так, у 5% пациентов с манифестацией сахарного диабета уже имеются симптомы поражения нервной системы, которые с увеличением длительности заболевания возрастают, достигая 60% при сроке диабета более 25 лет.

При сахарном диабете поражаются все отделы нервной системы: центральная нервная система (энцефалопатия, миелопатия), периферическая нервная система (поли- и мононейропатии) и периферическая вегетативная нервная система (автономная нейропатия).

Учитывая вышеизложенное, очевидно, что разработка и внедрение в повседневную практику препарата для терапии как самого сахарного диабета 2-ого типа, так и его осложнений представляется перспективным.

В настоящее время основу медикаментозного лечения сахарного диабета 2-го типа и его осложнений составляют сахароснижающие препараты, которые объединены в несколько групп:

- первая группа включает в себя два вида препаратов - тиазолидиндионы (розиглитазон и пиоглитазон), PPARγ-агонисты, стимуляторы ядерных гамма-рецепторов, и бигуаниды (Метформин, Сиофор, Авандамет, Багомет, Глюкофаж, Метфогамма). Препараты этой группы повышают чувствительность клеток к инсулину, снижают инсулинорезистентность и всасываемость глюкозы клетками кишечника, поэтому они часто назначаются людям с избыточной массой тела;

- вторая группа сахароснижающих препаратов также состоит из двух типов препаратов - производные сульфонилмочевины (Манинил, Диабетон, Амарил, Глюренорм, Глибинез-ретард), которые стимулируют выработку собственного инсулина, повышая тем самым его эффективность, и меглитиниды (Репаглинид (Новонорм) и Натеглинид (Старликс)), которые усиливают синтез инсулина поджелудочной железой, а также снижают постпрандиальные пики (повышение сахара после еды);

- третья группа сахароснижающих препаратов включает в себя препарат Акарбозу (Глюкобай), который снижает всасываемость клетками кишечника глюкозы за счет того, что блокирует фермент альфа-глюкозидазу, расщепляющий поступающие с пищей полисахариды.

Новым направлением в лечении и профилактике осложнений СД 2 являются прямые инкретиномиметики, агонисты рецепторов глюкагоноподобного пептида - 1 (ГПП-1) и непрямые - блокаторы дипептидилпептидазы 4 типа. К прямым миметикам инкретинов относятся такие препараты как эксенатид (Баета), лираглутид (Виктоза), альбиглутид и дулаглютид. К непрямым относятся Ситаглиптин (Янувия), Саксаглиптин (Онглиза), Линаглиптин (Тражента) и Вилдаглиптин (Галвус).

Особый интерес представляет группа инкретиноподобных препаратов.

Инкретины, такие как ГПП-1 улучшают функцию бета-клеток, подавляют неадекватно повышенную секрецию глюкагона и вызывают усиление глюкозозависимой секреции инсулина. Эксенатид (эксендин-4), представляющий собой миметик инкретиновых рецепторов (ГПП-1Р), является одним из лекарственных средств, эффективность лечения и профилактика его осложнений которым инсулиннезависимого сахарного диабета является доказанной в клинических испытаниях на людях.

Эксенатид представляет собой полипептид, известный первоначально под названием экзендин-4 (exendin-4), способ выделения которого из яда ящерицы Heloderma suspectum и аминокислотная последовательность (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGG-PSSGAPPPS-NH2) впервые были опубликованы в апреле 1992 г. [7]. Экзендин-4, являясь представителем семейства инкретиновых пептидов, обладает широким спектром активностей, таких как глюкозозависимое увеличение секреции инсулина, усиление переработки глюкозы, подавление аппетита, замедление перемещения пищи из желудка и т.д.

У пациентов с сахарным диабетом 2-го типа на фоне гипергликемии введение эксенатида подавляет избыточную секрецию глюкагона, при этом эксенатид не нарушает нормального глюкагонового ответа на гипогликемию.

Терапия эксенатидом в сочетании с метформином и/или препаратами сульфонилмочевины приводит к снижению концентрации глюкозы в крови натощак, постпрандиальной глюкозы крови, а также показателя гликозилированного гемоглобина (HbA1c), улучшая тем самым гликемический контроль у данных пациентов.

Известны области применения эксенатида: так, в патенте США [8] раскрывается применение эксенатида для стимуляции выделения инсулина с эффективностью большей, чем у эндогенного гормона ГПП-1. В описании изобретения приведенные примеры подтверждают, что эксенатид эффективен для лечения сахарного диабета.

В дальнейшем были обнаружены другие терапевтические эффекты эксенатида: снижение веса [9], снижение моторики и замедление опорожнения желудка [10, 11], а также инотропное и диуретическое действие эксенатида [12, 13, 14]. Описано применение эксенатида для лечения поликистоза яичника [15, 16, 17], лечения и профилактики нефропатии [18, 19], профилактики и лечения сердечной аритмии [20], для дифференцировки клеток костного мозга [21], лечения сахарного диабета у беременных [22, 23], для модуляции уровня триглицеридов и лечения дислипидемии [24, 25], подавления секреции глюкагона [26, 27], для дифференцировки неинсулинопроизводящих клеток в инсулинопроизводящие [28]. Заявка [29] описывает применение эксенатида, агонистов и антагонистов эксенатида для воздействия на центральную нервную систему. Патенты [30, 31] описывают применение эксенатида и других агонистов инкретиновых рецепторов, для снижения всасывания пищи. Заявка [32] описывает стабилизированные соединения эксенатида. Патенты [33, 34] описывают новые применения эксенатида (экзендина и агонистов экзендина).

Все вышеперечисленное указывает на высокую эффективность эксенатида в профилактике и лечении СД 2. Однако такие осложнения, возникающие при сахарном диабете 2 типа, как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия не корригируются при терапии как эксенатидом так и всеми другими вышеперечисленными сахароснижающими средствами.

Поэтому существует задача создания новых аналогов эксенатида, эффективных при лечении осложнений, возникающих при сахарном диабете 2 типа, таких как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия.

Ближайшим аналогом заявляемого изобретения является патент США US 5424286 [8], выбранный в качестве прототипа, в котором общим с заявляемым изобретением является применение инкретиномиметиков для стимуляции выделения инсулина.

Основным недостатком известного изобретения является отсутствие у заявленных инкретиномиметиков (эксенатидов) терапевтических эффектов, позволяющих проводить профилактику и лечение таких осложнений сахарного диабета как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия.

Таким образом, техническим результатом заявленного изобретения будет профилактика и лечение таких осложнений сахарного диабета как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия.

Технический результат в заявляемом изобретении достигается тем, что используется соединение формулы:

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH

обладающее терапевтическим эффектом, позволяющим проводить профилактику и лечение диабетической нейропатии, мышечной дистрофии и эндотелиопатии.

Синтез заявляемого соединения описан в примерах 1-5.

Пример 1. Синтез Fmoc-Gly-Pro-Ser(tBu)-Ser(tBu)-Gly-OH

В реакторе для твердофазного синтеза суспендировали 6.0 г 2-хлортритильной смолы (емкость 1.5 ммоль/г) в 45 мл DCM, выдерживали в течение 5 мин, смолу отфильтровывали, промывали 2×30 мл DCM. К смоле добавляли раствор 2.95 г (9.9 ммоль) Fmoc-Gly-OH и 6 мл (36 ммоль) DIPEA в 30 мл DCM, перемешивали в течение 60 мин при комнатной температуре. Смолу отфильтровывали, промывали 2×30 мл DCM, обрабатывали 2×30 мл смеси DCM/метанол/DIPEA (17:2:1) в течение 10 мин, промывали 2×30 мл DCM и 3×30 мл DMF. В реактор загружали 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.67 г (20.0 ммоль) Fmoc-Ser(tBu)-ОН, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.67 г (20.0 ммоль) Fmoc-Ser(tBu)-ОН, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 6.75 г (20.0 ммоль) Fmoc-Pro-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 3.50 г (20.0 ммоль) Fmoc-Gly-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, 3×30 мл DCM. Затем смолу обрабатывали 10×30 мл 1% раствором трифторуксусной кислоты в DCM, получаемые растворы объединяли в колбе, содержащей 30 мл 10% раствора пиридина в метаноле. Смесь упаривали до объема ~50 мл, к остатку добавляли 200 мл воды. Выпавший осадок отфильтровывали, промывали водой, сушили. Получено 6.4 г продукта (91%) с чистотой по ВЭЖХ 97%.

Пример 2. Синтез Fmoc-Glu(OtBu)-Glu(OtBu)-Glu(OtBu)-Ala-Val-Arg(CF3COOH)-Leu-Phe-Ile-Glu(OtBu)-Trp(Boc)-Leu-Lys(Boc)-Asn(Trt)-Gly-OH

В реакторе для твердофазного синтеза суспендировали 6.0 г 2-хлортритильной смолы (емкость 1.5 ммоль/г) в 45 мл DCM, выдерживали в течение 5 мин, смолу отфильтровывали, промывали 2×30 мл DCM. К смоле добавляли раствор 2.95 г (9.9 ммоль) Fmoc-Gly-OH и 6 мл (36 ммоль) DIPEA в 30 мл DCM, перемешивали в течение 60 мин при комнатной температуре. Смолу отфильтровывали, промывали 2×30 мл DCM, обрабатывали 2×30 мл смеси DCM/метанол)/DIPEA (17:2:1) в течение 10 мин, промывали 2×30 мл DCM и 3×30 мл DMF. В реактор загружали 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 11.93 г (20.0 ммоль) Fmoc-Asn(Trt)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 9.37 г (20.0 ммоль) Fmoc-Lys(Boc)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.07 г (20.0 ммоль) Fmoc-Leu-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 10.53 г (20.0 ммоль) Fmoc-Trp(Вос)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 8.51 г (20.0 ммоль) Fmoc-Glu(OtBu)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.07 г (20.0 ммоль) Fmoc-Ile-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.75 г (20.0 ммоль) Fmoc-Phe-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.07 г (20.0 ммоль) Fmoc-Leu-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 8.66 г (20.0 ммоль) Fmoc-Arg-OH.HCl, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 6.79 г (20.0 ммоль) Fmoc-Val-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 6.23 г (20.0 ммоль) Fmoc-Ala-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 8.51 г (20.0 ммоль) Fmoc-Glu(OtBu)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 8.51 г (20.0 ммоль) Fmoc-Glu(OtBu)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 8.51 г (20.0 ммоль) Fmoc-Glu(OtBu)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, 3×30 мл DCM. Затем смолу обрабатывали 10×30 мл 1% раствором трифторуксусной кислоты в DCM, получаемые растворы объединяли в колбе, содержащей 30 мл 10% раствора пиридина в метаноле. Смесь упаривали до объема ~50 мл, к остатку добавляли 200 мл воды. Выпавший осадок отфильтровывали, промывали водой, сушили. Получено 21.8 г (80%) продукта с чистотой по ВЭЖХ 95%.

Пример 3. Синтез Boc-His(Trt)-Gly-Glu(OtBu)-Gly-Thr(tBu)-Phe-Thr(tBu)-Ser(tBu)-Asp(OtBu)-Leu-Ser(tBu)-Lys(Boc)-Gln(Trt)-Gly-OH

В реакторе для твердофазного синтеза суспендировали 6.0 г 2-хлортритильной смолы (емкость 1.5 ммоль/г) в 45 мл DCM, выдерживали в течение 5 мин, смолу отфильтровывали, промывали 2×30 мл DCM. К смоле добавляли раствор 2.95 г (9.9 ммоль) Fmoc-Gly-OH и 6 мл (36 ммоль) DIPEA в 30 мл DCM, перемешивали в течение 60 мин при комнатной температуре. Смолу отфильтровывали, промывали 2×30 мл DCM, обрабатывали 2×30 мл смеси DCM/метанол/DIPEA (17:2:1) в течение 10 мин, промывали 2×30 мл DCM и 3×30 мл DMF. В реактор загружали 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 12.21 г (20.0 ммоль) Fmoc-Gln(Trt)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 9.37 г (20.0 ммоль) Fmoc-Lys(Boc)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.67 г (20.0 ммоль) Fmoc-Ser(tBu)-ОН, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.07 г (20.0 ммоль) Fmoc-Leu-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 8.23 г (20.0 ммоль) Fmoc-Asp(OtBu)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.67 г (20.0 ммоль) Fmoc-Ser(tBu)-ОН, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.95 г (20.0 ммоль) Fmoc-Thr(tBu)-ОН, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.75 г (20.0 ммоль) Fmoc-Phe-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 7.95 г (20.0 ммоль) Fmoc-Thr(tBu)-ОН, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 5.95 г (20.0 ммоль) Fmoc-Gly-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 8.51 г (20.0 ммоль) Fmoc-Glu(OtBu)-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 5.95 г (20.0 ммоль) Fmoc-GIy-OH, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×30 мл DMF, добавляли 30 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×30 мл DMF.

В реактор загружали охлажденный (4°C) раствор 9.95 г (20.0 ммоль) Boc-His(Trt)-ОН, 2.98 г (22.0 ммоль) HOBt и 3.42 мл (22.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×30 мл DMF, 3×30 мл DCM. Затем смолу обрабатывали 10×30 мл 1% раствором трифторуксусной кислоты в DCM, получаемые растворы объединяли в колбе, содержащей 30 мл 10% раствора пиридина в метаноле. Смесь упаривали до объема ~50 мл, к остатку добавляли 200 мл воды. Выпавший осадок отфильтровывали, промывали водой, сушили. Получено 20.9 г (85%) продукта с чистотой по ВЭЖХ 95%.

Пример 4. Синтез 14-глицин-экзендин-4 (Heloderma suspectum)-(1-39)-пептидил-окта-D-аргинил-глицина

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro_Pro-Ser-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH

В реакторе для твердофазного синтеза суспендировали 2.0 г 2-хлортритильной смолы (емкость 1.5 ммоль/г) в 15 мл DCM, выдерживали в течение 5 мин, смолу отфильтровывали, промывали 2×10 мл DCM. К смоле добавляли раствор 0.98 г (3.3 ммоль) Fmoc-Gly-OH и 2 мл (12 ммоль) DIPEA в 10 мл DCM, перемешивали в течение 60 мин при комнатной температуре. Смолу отфильтровывали, промывали 2×10 мл DCM, обрабатывали 2×10 мл смеси DCM/метанол/DIPEA (17:2:1) в течение 10 мин, промывали 2×10 мл DCM и 3×10 мл DMF. В реактор загружали 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 2.60 г (6.0 ммоль) Fmoc-D-Arg-OH.HCl, 0.98 г (7.2 ммоль) HOBt и 1.12 мл (7.2 ммоль) DIC в 10 мл DMF, перемешивали в течение 2 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 2.60 г (6.0 ммоль) Fmoc-D-Arg-OH.HCl, 0.98 г (7.2 ммоль) HOBt и 1.12 мл (7.2 ммоль) DIC в 10 мл DMF, перемешивали в течение 4 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 3.46 г (8.0 ммоль) Fmoc-D-Arg-OH.HCl, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 10 мл DMF, перемешивали в течение 3 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 3.46 г (8.0 ммоль) Fmoc-D-Arg-OH.HCl, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 10 мл DMF, перемешивали в течение 4 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 3.46 г (8.0 ммоль) Fmoc-D-Arg-OH.HCl, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 10 мл DMF, перемешивали в течение 10 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 4.33 г (10.0 ммоль) Fmoc-D-Arg-OH.HCl, 1.62 г (12.0 ммоль) HOBt и 1.88 мл (12.0 ммоль) DIC в 10 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 4.33 г (10.0 ммоль) Fmoc-D-Arg-OH.HCl, 1.62 г (12.0 ммоль) HOBt и 1.88 мл (12.0 ммоль) DIC в 10 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 4.33 г (10.0 ммоль) Fmoc-D-Arg-OH.HCl, 1.62 г (12.0 ммоль) HOBt и 1.88 мл (12.0 ммоль) DIC в 10 мл DMF, перемешивали в течение 16 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 3.07 г (8.0 ммоль) Fmoc-Ser(tBu)-ОН, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 2.70 г (8.0 ммоль) Fmoc-Pro-OH, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 2.70 г (8.0 ммоль) Fmoc-Pro-OH, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 2.70 г (8.0 ммоль) Fmoc-Pro-OH, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 2.49 г (8.0 ммоль) Fmoc-Ala-OH, 1.35 г (10.0 ммоль) HOBt и 1.56 мл (10.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 5.90 г (8.0 ммоль) Fmoc-GlyProSer(tBu)Ser(tBu)Gly-OH (продукт примера 1), 1.62 г (12.0 ммоль) HOBt и 1.88 мл (12.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 12 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 11.35 г (4.0 ммоль) Fmoc-Glu(OtBu)-Glu(OtBu)Glu(OtBu)AlaValArg(HCl)LeuPheIleGlu(OtBu)Trp(Boc)LeuLys(Boc)Asn(Trt)Gly-ОН (продукт примера 2), 0.81 г (6.0 ммоль) HOBt и 0.95 мл (6.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 24 час при комнатной температуре. Смолу отфильтровывали, промывали 6×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, перемешивали в течение 5 мин, отфильтровывали, промывали 3×10 мл DMF, добавляли 10 мл 20% раствора диэтиламина в DMF, выдерживали в течение 20 мин, отфильтровывали, промывали 5×10 мл DMF.

В реактор загружали охлажденный (4°C) раствор 9.94 г (4.0 ммоль) Boc-His(Trt)Gly-Glu(OtBu)GlyThr(tBu)PheThr(tBu)Ser(tBu)Asp(OtBu)LeuSer(tBu)Lys(Boc)Gln(Trt)Gly-OH (продукт примера 3), 0.81 г (6.0 ммоль) HOBt и 0.95 мл (6.0 ммоль) DIC в 30 мл DMF, перемешивали в течение 24 час при комнатной температуре. Смолу отфильтровывали, промывали 6×20 мл DMF, 4×20 мл DCM, сушили, добавляли 50 мл смеси TFA/TIS/EDT/H2O (97:1:1:1), выдерживали в течение 4 час при комнатной температуре, отфильтровывали, промывали 3×20 мл трифторуксусной кислотой, объединенные фильтраты упаривали до объема ~20 мл, к остатку добавляли 60 мл сухого эфира. Выпавший осадок отфильтровывали, промывали на фильтре эфиром, сушили. Полученный продукт растворяли в 50 мл воды, раствор замораживали и лиофилизовали. Лиофилизат растворяли в 40 мл воды и наносили на колонку с ионообменной смолой Amberlite IRA-400 (Cl-форма). Колонку промывали водой, фракции, содержащие продукт, объединяли, упаривали до объема ~50 мл и наносили на обращеннофазную колонку Waters X-Bridge C18, 10 мкм, 127 Å, 50×250 мм. Элюирование проводили при скорости потока элюента 50 мл/мин. Фаза A: 0,1% HCl/H2O, B: ацетонитрил. Градиент: 0% (В)-70% (В) за 70 минут. Фракции, содержащие основной продукт, объединяли, упаривали до объема ~50 мл, замораживали и лиофилизовали. Получено 3.9 г (20%) продукта с чистотой (ВЭЖХ) 97.5%. Масс спектр: вычислено для C231H374N82O70 МН+ 5420.98, получено МН+ 5420.80. Аминокислотный анализ: аланин 2.02 (2), аргинин 9.0 (9), аспарагиновая кислота + аспарагин 2.05 (2), глутаминовая кислота + глутамин 5.80 (6), глицин 7.25 (7), гистидин 1.02 (1), изолейцин 1.03 (1), лейцин 2.96 (3), лизин 2.07 (2), фенилаланин 2.05 (2), пролин 4.10 (4), серии 4.85 (5), треонин 1.90 (2), валин 1.02 (1).

Пример 5. Синтез H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH при помощи штамма Corynebacterium acetoacidophilum

1.1. Конструирование вектора pBSΔCg10278 для удаления гена Cg10278, кодирующего PBP1a

Геномная последовательность С.acetoacidophilum АТСС 13032 и нуклеотидная последовательность гена Cg1278, кодирующего пенициллинсвязывающий белок PBP1a, известны (GenBank, инвентарный номер ВА000036 (версия ВА000036.3 GI: 42602314, locus_tag=«NCg10274»). Со ссылкой на эту последовательность синтезировали праймеры P1, P2, P3 и P4. С помощью ПЦР, используя в качестве матрицы хромосомную ДНК штамма С.acetoacidophilum АТСС 13869, приготовленную обычным способом (Saito Н. and Miura K.I., Biochim. Biophys. Acta, 1963, 72:619-629), и праймеры P1 и P2, и P3 и P4, были получены фрагмент (около 1 т.п.н.) с 5′-стороны и фрагмент (около 1 т.п.н.) с 3′-стороны от Cg10278, кодирующего PBP1a, соответственно. Затем с помощью ПЦР, используя в качестве матрицы оба полученных ДНК-фрагмента и праймеры P1 и P4, был получен ДНК-фрагмент (около 2 т.п.н.), состоящий из обоих фрагментов, слитых друг с другом. В праймеры P1 и P4 были введены сайты распознавания для ферментов рестрикции ВатН I и Xba I, соответственно. Для ПЦР использовали Pyrobest ДНК-полимеразу (производитель Takara Bio) и условия, рекомендованными производителем. Этот ДНК-фрагмент обрабатывали ферментами рестрикции BamH I и Xba I и вводили в сайт BamH I-Xba I pBS4, описанного в WO 2005/113744, с целью получения вектора pBSΔCg10278 для делеции гена Cg0278. Для лигирования использовали DNA Ligation Kit Ver. 2.1 (производитель Takara Bio) и условия рекомендованными производителем.

1.2. Конструирование PBP1a-дефицитного штамма

Штамм С.acetoacidophilum YDK010, описанный в WO 2004/029254, трансформировали сконструированным вектором pBSACgl0278. Штамм С.acetoacidophilum YDK010 является штаммом, дефицитным по белку поверхностного слоя клетки PS2 штамма С.acetoacidophilum AJ12036 (FERM ВР-734) (WO 2004/029254). Штамм отбирали из полученных трансформантов в соответствии тем, как описано в WO 2005/113744 и WO 2006/057450 с целью получения штамма YDK010ΔPBP1a, дефицитного по гену Cg1278.

Представленные ниже примеры, касаются фармакологических испытаний, полученного пептида.

Целью исследования явилось выявление сахароснижающей активности и профилактического и терапевтического действия заявляемого соединения (в дальнейшем «пептид Д») при развитии осложнений на модели химического экспериментального диабета, индуцированного однократным введением стрептозотоцина (STZ) и никотинамида крысам- самцам [35].

В качестве препаратов сравнения были использованы:

1. Баета® (как эталонный препарат для профилактики и лечения осложнений СД 2) - прозрачный раствор для подкожного введения 250 мкг/1 мл: шприц-ручки 1,2 мл, BAXTER Pharmaceutical Solutions.

2. Субстанция синтетический эксенатид.

3. Метформин (Сиофор® 500) (как классическое сахароснижающее средство из группы бигуанидов).

ИСПОЛЬЗУЕМАЯ РЕАГЕНТИКА И МАТЕРИАЛЫ

Набор реагентов для определения уровня гликозилированного гемоглобина (ООО «Фосфосорб», Россия).

ИСПОЛЬЗУЕМОЕ ОБОРУДОВАНИЕ

1. Дозатор медицинский лабораторный, 10-100 мкл.

2. Дозатор медицинский лабораторный, 100-1000 мкл.

3. Микроцентрифуга Z 216 МК (Hermle Labortechnik GmbH, Германия).

4. Глюкометр OneTouch UltraEasy® (LifeScan, США).

5. Тест-полоски OneTouch Ultra® (LifeScan, США).

6. Нити фон Фрея (Stoelting, США).

ЖИВОТНЫЕ

АДАПТАЦИЯ И ОТБОР ЖИВОТНЫХ

Лабораторных животных до начала исследования содержали 7 дней для адаптации при групповом содержании в клетках. Во время этого периода у животных каждый день контролировали клиническое состояние путем визуального осмотра. Животные с обнаруженными в ходе осмотра отклонениями в экспериментальные группы включены не были. Перед началом исследования животные, отвечающие критериям включения в эксперимент, были распределены на группы.

РАСПРЕДЕЛЕНИЕ ПО ГРУППАМ

Отбор животных осуществляли при помощи метода модифицированной блочной рандомизации [36]. Для этого всех поступивших из питомника животных случайным образом помещали в ячейки блока рандомизации (число ячеек блока рандомизации кратно числу групп в эксперименте). Далее, пользуясь генератором случайных чисел (статистическая программа Statistica 6.0), получали перечень данных, содержащий номера ячеек с животными и соответствующие им номера групп, куда в дальнейшем были размещены животные [36].

ИДЕНТИФИКАЦИЯ ЖИВОНЫХ

Маркировка клетки кодировала пол, количество животных, дату начала эксперимента, название группы. Каждому отобранному в исследование животному был присвоен индивидуальный номер путем нанесения метки на хвост.

Животные содержались в стандартных условиях в соответствии с правилами, утвержденным МЗ СССР 06.07.73 г., по устройству, оборудованию и содержанию экспериментально-биологических клиник (вивариев) и ГОСТ P 53434-2009.

Животные содержались в стандартных прозрачных пластиковых клетках, группами по 5 особей, на подстиле; клетки покрыты стальными решетчатыми крышками с кормовым углублением. Площадь пола на одно животное - 440 см2 (минимально допустимая площадь 250 см2).

«Корм для содержания лабораторных животных» ПК-120-1, приготовленный по ГОСТ P 50258-92 в соответствии с нормами утвержденными приказом МЗ СССР №755 от 12.08.77 г. давался ad libitum в кормовое углубление стальной решетчатой крышки клетки (при измерении уровня глюкозы, животных депривировали от корма на 18 часов). Ветеринарное свидетельство №247 №0294922 (ООО «Аллер-Петфуд», Россия) сертификат соответствия №POCRU.ПР98.H00093/0051289 срок действия с 17/05/2011 по 16/05/2014.

Животные получали воду, очищенную согласно СОП ОЖ-ОС-4 и нормированную по органолептическим свойствам, по показателям pH, сухого остатка, восстанавливающих веществ, диоксида углерода, нитратов и нитритов, аммиака, хлоридов, сульфатов, кальция и тяжелых металлов в соответствии с СОП АБ-38, на основании ГОСТ 51232-98 «Вода питьевая. Общие требования к организации и методам контроля качества». Вода в стандартных поилках со стальными крышками-носиками давалась ad libitum.

В качестве подстила использовали древесные гранулы 6 мм (ООО «ЗооСПб», Россия). Животные содержались в контролируемых условиях окружающей среды (19,5-21°C и относительной влажности воздуха 61-75%). Световой режим составлял 12 часов света и 12 часов темноты. Устанавливали режим проветривания, обеспечивающий около 15 объемов помещения в час, концентрацию CO2 не более 0,15 объемных %, аммиака не более 0,001 мг/л. Температуру и влажность воздуха регистрировали ежедневно. Никаких существенных отклонений этих параметров в период акклиматизации и в ходе эксперимента не произошло.

ДИЗАЙН ИССЛЕДОВАНИЯ

Характеристика исследуемых групп путь и длительность введения изучаемых веществ

В соответствии с графиком эксперимента у животных на 0 день была проведена индукция экспериментального сахарного диабета с помощью однократной инъекции стрептозотоцина (STZ) внутрибрюшинно в дозе 65 мг/кг, разведенного предварительно в цитратном буфере (pH=6,5). За 2 часа до этого внутрибрюшинно всем животным был введен никотинамид в дозе 230 мг/кг (5% раствор) [35, 37].

Уровень глюкозы в периферической крови измерялся у крыс натощак (животные лишались корма на ночь) до индукции патологии, затем через 1, 3 и 9 суток после индукции патологии. После начала введения изучаемых веществ, уровень глюкозы измерялся каждые 10 дней и в день эвтаназии. Регистрация массы тела проводилась в те же дни, что и измерение уровня глюкозы. В течение эксперимента тест на аллодинию проводили на 60-й, 70-й и 80-й дни введения лекарственных препаратов. При алкогольной нейропатии тест на тактильную реактивность проводили на 1, 50 и 100 день введения препаратов.

В день эвтаназии у животных забирали образец венозной крови для определения уровня гликозилированного гемоглобина. Также на патоморфологическое исследование были взяты следующие органы: седалищный нерв, часть артерии брыжейки, часть артерии сетчатки, часть икроножной мышцы, поджелудочная железа.

ГРАФИК ЭКСПЕРИМЕНТА И МАНИПУЛЯЦИИ

Пример 6. Определение глюкозы в крови экспериментальных животных

Измерение уровня глюкозы в периферической крови у крыс проводили с помощью глюкометра One Touch® и тест-полосок One Touch® глюкозоксидазным методом. Крысы на ночь, перед измерением уровня глюкозы, лишались корма, но не воды. Процесс измерения выглядел следующим образом: животное с нужной меткой извлекалось из клетки, проводилась обработка хвоста антисептиком, делался прокол вены, с помощью иглы от шприца, когда выделялась капля крови - подносился глюкометр с тест-полоской. Полученные данные заносились в первичную карту.

На фигуре 1 видно, что на фоне применения исследуемых препаратов наблюдалась общая тенденция к снижению концентрации глюкозы. Двухфакторный дисперсионный анализ (ANOVA) с повторными измерениями выявил статистически значимое влияние исследуемых препаратов на концентрацию глюкозы в периферической крови (F4,25=3,49, p=0,02). Последующее межгрупповое сравнение достоверно показало отличие группы, получавшей метформин, начиная с 20 дня введения препарата (p<0,05, тест Бонферрони), а также групп, получавших заявляемый пептид (пептид Д), начиная с 40-го дня введения препарата (p<0,05, тест Бонферрони) и эксенатид, начиная с 50-го дня введения препарата (p<0,05, тест Бонферрони), по сравнению с группой контроля.

Парное сравнение между исходным уровнем глюкозы до терапии («0»-точка) и последним днем терапии (80-й день) показали статистически значимое различие в группах, принимавших метформин (p=0,017, t-test) и пептид Д (p=0,011, t-test) (фигура 1).

В итоге можно сделать вывод о том, что заявляемый пептид Д оказал сахароснижающее действие при терапии длительностью 80 дней, начиная с 40-го дня введения. Инкретиноподобный препарат - эксенатид также проявил гипогликемическое действие, начиная с 50-го дня введения, хотя его выраженность была ниже, чем у пептида Д. Введение Баеты® не оказало влияния на уровень глюкозы в периферической крови, но препарат сравнения метформин проявил, как и ожидалось, сахароснижающие свойства, начиная с 20-го дня терапии.

Пример 7. Определение гликозилированного гемоглобина в периферической крови

Определение гликозилированного гемоглобина в венозной крови проводили с помощью набора реагентов «Диабет-Тест, HbA1c» (ООО «Фосфосорб», Россия), методом аффинной хромотографии гликозилированной и негликозилированной фракций гемоглобина в гемолизате крови крыс.

На 81 день ежедневного введения исследуемых препаратов у экспериментальных животных из хвостовой вены были взяты образцы крови для определения гликозилированного гемоглобина в гемолизате эритроцитов крови животных. Полученные данные приведены в таблице 1.

Из данных таблицы 1 видно, что у животных контрольной группы наблюдалось статистически значимое повышение концентрации HbA1c в 4 раза по сравнению с интактной группой (p=0,0002, t-тест). Данные изменения характеризуют выраженное развитие экспериментальной патологии.

На фоне применения исследуемых препаратов установлено статистически значимое снижение концентрации HbA1c (F4,17=11,83, p<0,0001). Последующее межгрупповое сравнение выявило максимальный эффект терапии в группах, получавшей заявляемый пептид Д (p<0,0001) и метформин (p<0,0001), в группах, получавших терапию Баетой® и эксенатидом, эффект был не столь выражен (p=0,0018 и p=0,0015, соответственно).

Пример 8. Оценка тактильной аллодинии у крыс с диабетической нейропатией

Крысу помещали в пластмассовую клетку с решетчатым полом, сделанным из металлической проволоки, и оставляли в этой клетке на 5 минут для угасания ориентировочных реакций. Определение среднеэффективного порога тактильной реактивности проводили по методу Чаплан и соавторов [38] с помощью набора из 8 стандартных волосков фон Фрея (Stoelting, США). Жесткость волосков, выражаемая как минимальное усилие необходимое для сгибания волоска, возрастала логарифмически с абсолютными значениями от 0,692 г до 28,840 г.

У каждой крысы порог вначале определяли на левой лапе, а затем на правой лапе. Кончиком волоска прикасались к середине плантарной поверхности лапы с усилием, необходимым для сгибания волоска, и удерживали волосок в таком положении 6-8 секунд. Положительный ответ регистрировали, если животное резко отдергивало лапу во время касания или если после удаления волоска следовало резкое сгибание лапы.

Тестирование начинали с использования волоска, соответствующего усилию в 3,630 г. Затем стимулы (волоски) предъявляли в возрастающей или убывающей последовательности. В случае положительного ответа предъявляли волосок с меньшей жесткостью, а в случае негативного ответа предъявляли волосок с большей жесткостью. После первоначального определения порога чувствительности по тому же принципу предъявляли еще 4 волоска.

Психофизиологический среднеэффективный порог тактильной реактивности рассчитывали по методу, описанному Диксоном [39].

В таблице 2 представлены результаты экспериментов по изучению влияния 80-дневного введения исследуемых препаратов на степень развития тактильной аллодинии.

В выполненных экспериментах к 60 дню введения препаратов проявление тактильной аллодинии в контрольной группе было максимальным (F1;14=669,8, p<0,0001), что говорит о сформировавшейся модели диабетической нейропатии, с выраженным болевым синдромом.

Для дальнейшей оценки полученных результатов была проведена статистическая обработка с использованием двухфакторного дисперсионного анализа с повторными измерениями, который позволил определить значимость фактора «введение препаратов» на экспрессию тактильной аллодинии (F4,43=10,93; p<0,0001). Последующее межгрупповое сравнение (тест Бонферрони) показало уменьшение выраженности тактильной аллодинии в группе, получавшей пептид Д, начиная с 60-го дня введения. В таблице 3 представлены значения критерия F для всех использованных веществ. Последующие межгрупповые сравнения (тест Бонферрони) подтвердили достоверное влияние только в группе, получавшей заявляемый пептид Д.

Таким образом, при изучении эффектов исследуемых препаратов было показано следующее: Баета®, эксенатид и метформин при индивидуальном сравнении показателей несколько снижали выраженность проявления аллодинии, однако последующее межгрупповое сравнение не подтвердило статистически значимого влияния. Введение же заявляемого пептида Д, начиная с 60-го дня введения, достоверно уменьшало проявления тактильной аллодинии у крыс с диабетической нейропатией (таблица 2-3). Данное наблюдение позволяет сделать вывод о том, что при длительном лечении (начиная с 60-го дня введения) заявляемым пептидом Д имеет место терапевтический эффект в отношении одного из самых распространенных осложнений СД 2, периферической диабетической нейропатии, что обусловлено, вероятно, нейропротекторным действием заявляемого пептида Д.

Пример 9. Оценка тактильной аллодинии у крыс с алкогольной нейропатией

Оценка тактильной аллодинии происходила так же, как и в примере 7. Симптомы алкогольной нейропатии (тактильная аллодиния) наблюдались, начиная с 8 недели (56-60 дней) потребления 30% алкоголя крысами по методике форсированного питья [40] (F1;12=26,25; p=0,0003; фигура 2), что говорит о сформировавшейся модели алкогольной нейропатии с выраженным болевым синдромом.

Для дальнейшей оценки полученных результатов была проведена статистическая обработка с использованием двухфакторного дисперсионного анализа с повторными измерениями, который позволил определить значимость фактора «введение препаратов» на степень развития тактильной аллодинии (F1,10=8,79, p=0,014). Последующее межгрупповое сравнение (post hoc) показало уменьшение выраженности тактильной аллодинии в группе, получавшей лечение заявляемым пептидом Д на 100-й день введения по сравнению с контрольной группой в соответствующей точке измерения (p<0,05; тест Бонферрони; фигура 2).

Суммируя вышеизложенное, можно сделать вывод о том, что заявляемый пептид Д обладает нейропротективными свойствами в отношении нейродегенеративных процессов, развивающихся при алкогольной и диабетической периферической нейропатии.

ПАТОМОРФОЛОГИЧЕСКОЕ ИССЛЕДОВАНИЕ

Патоморфологическому исследованию подлежали все экспериментальные животные в конце исследования.

Патоморфологическое исследование включало в себя некропсию, макроскопическое исследование, гистологическое исследование следующих внутренних органов: средняя часть седалищного нерва, артерия сетчатки, часть артерии брыжейки, часть икроножной мышцы, поджелудочная железа. Некропсия выполнялась под непосредственным наблюдением патоморфолога. Образцы указанных тканей вырезали и фиксировали в 10% растворе нейтрального формалина, а глазное яблоко в фиксаторе Дэвидсона, в течение 24 часов, далее материал проходил стандартную обработку для изготовления гистологических и гистохимических препаратов с толщиной серийных парафиновых срезов 5-7 мкм. Для микроскопического исследования срезы тканей и органов окрашивали гематоксилином и эозином. Образцы нервной ткани окрашивали гематоксилином и эозином, толуидиновым синим по Нисслю, пикрофуксином по Ван-Гизону. Для выявления миелиновых волокон и продуктов распада миелина, поперечные и продольные срезы нервов, полученные на замораживающем микротоме, окрашивали Суданом черным по Лизону [41, 42, 43]. Ядра докрашивали гематоксилином Майера. Образцы икроножной мышцы окрашивали гематоксилином и эозином и пикрофуксином по Ван-Гизону.

Морфологическое исследование гистологических препаратов проводилось при помощи светооптического микроскопа Carl Zeiss (Германия) при увеличении 100, 200 и 400. Микрофотографирование проводили при помощи цифровой фотокамеры Axio Scope A1 (Германия). Морфометрию проводили полуавтоматически и вручную с помощью программного обеспечения AxioVision Rel. 4.8. и редактора изображений PhotoM 1.21.

Для оценки действия исследуемых субстанций была проведена сравнительная гистологическая оценка их влияния:

1. На островковый аппарат поджелудочной железы, где проведено измерение площади островков.

2. На артерии мышечного типа и микроциркуляторного русла (артериолы и капилляры) сетчатки глаза, артерии брыжейки, где проведено морфометрическое измерение диаметра капилляров и толщина интимы артерий.

3. На состояние седалищного нерва.

4. На состояние поперечно-полосатой мускулатуры.

Пример 10. Оценка состояния интимы брыжеечной артерии крыс

На фигуре 3 представлены данные по влиянию исследуемых веществ на состояние интимы брыжеечной артерии крыс. При парном сравнении интактной и контрольной групп было показано, что происходит достоверное увеличение толщины интимы сосудов в контрольной группе (p<0,0001, t-test). Данное увеличение толщины и набухание интимы сосудов свидетельствует в пользу развития процессов эндотелиопатии. Последующий дисперсионный однофакторный анализ данных (ANOVA) показал, что длительное введение исследуемых веществ предупреждает увеличение толщины интимы сосудов брыжеечной артерии у крыс (F4,25=12,87; p<0,0001). Межгрупповое сравнение показало достоверное уменьшение толщины интимы сосудов во всех группах по сравнению с контрольной группой (p<0,05, тест Бонферрони). Максимальный эффект был в группе, получавшей заявляемый пептид Д (p<0.0001, тест Бонферрони).

Пример 11. Оценка состояния нервной ткани седалищного нерва

На основании установленных патоморфологических изменений в нервной ткани можно сделать вывод о том, что моделирование STZ-индуцированного сахарного диабета 2-го типа сопровождалось выраженной картиной диабетической нейропатии, которая характеризовалась уменьшением толщины и диаметра нервных стволов, деформацией и набуханием миелиновых оболочек, поврежденных нервных волокон, отеком межуточной ткани, избыточным накоплением липидов в эпи- и периневрии, разрастанием эндоневральной соединительной ткани.

Отдельные волокна находились в состоянии гидропической дистрофии. Также в очагах демиелинизации встречались скопления мелких суданофильных гранул, свидетельствующих о продолжающемся распаде миелина.

Введение метформина не оказало терапевтического эффекта на нервную ткань. В образцах ткани данной группы обнаруживались грубые повреждения нервных стволов и волокон, проявляющиеся выраженной полиморфноядерной инфильтрацией периневрия и эпиневрия с очаговой дегенерацией миелиновых оболочек, а также набуханием и деформацией волокон, появлением продуктов распада миелина в виде суданофильных гранул, прилежащих к базальной мембране неповрежденных миелиновых волокон.

При введении Баеты® и эксенатида наблюдалось лишь незначительное накопление липидов в периневрии и эндоневрии. Очевидно, дегенеративные явления в данной группе были существенно ниже или не проявлялись вовсе. Напротив, введение заявляемого пептида Д оказало положительный терапевтический эффект, при этом выраженных морфологических отличий в строении седалищных нервов от группы интактных животных не определялось.

При патоморфологическом анализе показателей нервной ткани было установлено, что толщина нервного ствола достоверно уменьшалась в контрольной группе по сравнению с интактными животными (p<0,0001; t-test), что может свидетельствовать о дегенеративных изменениях в ткани и подтверждается патоморфологической картиной развития патологии (таблица 4).

Как было ранее отмечено, патоморфологическая картина образцов нервной ткани в группе, получавшей метформин, указывает на отек нервного ствола и чрезмерное увеличение его толщины, что свидетельствует об усилении патологии, а не о терапевтическом эффекте. В связи с этим был проведен статистический анализ без включения указанной выше группы. Однофакторный дисперсионный анализ (ANOVA) выявил достоверное влияние введения исследуемых веществ на толщину нервного ствола (F3,34=4,83; p=0,007). Последующее межгрупповое сравнение (post hoc) подтвердило достоверное увеличение толщины ствола нерва в группе, получавшей заявляемый пептид Д (p<0,01; тест Бонферрони), по сравнению с контрольной группой.

При анализе такого патоморфометрического показателя как площадь соединительной ткани эндоневрия, было установлено, что при моделировании патологии происходило достоверное разрастании эндоневральной соединительной ткани (p<0,0018; t-test), что может свидетельствовать о преобладании дегенеративных проявлений над репаративными [Карпова и Криштоп, 2013]. Проведение однофакторного, дисперсионного анализа (ANOVA) показало достоверное влияние введения исследуемых веществ на площадь эндоневральной соединительной ткани (F4,25=8,58; p=0,0002). Последующее межгрупповое сравнение (post hoc) подтвердило достоверное уменьшение площади эндоневральной, соединительной ткани во всех группах (p<0,01; тест Бонферрони). Максимальный эффект был зафиксирован в группах, принимавших заявляемый пептид Д (p=0,0002; тест Бонферрони) (таблица 4), что можно трактовать как усиление репаративных процессов в нервной ткани.

Пример 12. Оценка состояния мышечной ткани (икроножная мышца)

На основании установленных патоморфологических изменений в поперечнополосатой мышечной ткани икроножных мышц можно сделать вывод о том, что развитие экспериментального СД 2 сопровождалось выраженной картиной мышечной дистрофии, которая характеризовалась истончением и деформацией мышечных волокон, умеренным разрастанием окружающей соединительной ткани, в некоторых случаях с замещением атрофированных волокон коллагеновой соединительной тканью, а также увеличением количества ядер мышечной клетки (миоядер). В соединительной ткани эндо- и перимизия у животных с атрофией волокон обнаруживалась умеренная воспалительная инфильтрация.

В группе, получавшей Баету® и эксенатид, отмечалось очаговое разрастание соединительной ткани с замещением поврежденных мышечных волокон и умеренной лимфоцитарной инфильтрацией. В группе, где животные получали метформин, на фоне резкого увеличения миоядерного соотношения отмечалась минимальная очаговая воспалительная инфильтрация волокон и межуточной ткани.

На фоне сформированной патологии введение заявляемого пептида Д оказало выраженное терапевтическое действие на мышечную ткань. Патологические изменения встречались в этих группах в единичных случаях и были минимальны по сравнению с контрольной группой.

При анализе площади поперечного сечения мышечных волокон было установлено, что развитие экспериментального СД 2 типа сопровождается достоверным снижением площади поперечного сечения волокон мышечной ткани (p<0,0001; t-test) с параллельным уменьшением количества миоядер в волокнах (около 70%), что можно трактовать как признаки мышечной дистрофии. Проведение однофакторного дисперсионного анализа (ANOVA) показало достоверное влияние введения исследуемых веществ на площадь поперечного сечения мышечных волокон (F4,22=13,67; p<0,0001). Последующее межгрупповое сравнение (post hoc), подтвердило достоверное увеличение площади поперечного сечения мышечных волокон во всех группах (p<0,01; тест Бонферрони), за исключением группы, получавшей Баету® (р=0,051; тест Бонферрони). Максимальный эффект был зафиксирован в группах, принимавших эксенатид (p<0,0001; тест Бонферрони) и заявляемый пептид Д (p=0,0004; тест Бонферрони) (таблица 5).

Пример 13. Островковый аппарат поджелудочной железы

В таблице 6 представлены обобщенные данные по влиянию исследуемых веществ на островковый аппарат поджелудочной железы экспериментальных животных. При парном сравнении интактной и контрольной групп было показано, что происходит достоверное уменьшение островков Лангерганса в контрольной группе (p<0,0001, t-test). Данное уменьшение площади островкового аппарата свидетельствует о развитии патологии, которая также коррелирует с увеличением уровня глюкозы в периферической крови. Попарное сравнение контрольной группы с экспериментальными, выявило статистически значимое влияние введения всех исследуемых веществ на площадь островков поджелудочной железы (таблица 7). Данное наблюдение указывает на то, что длительное введение исследуемых веществ приводит к увеличению площади островков и тем самым способствует процессам репарации островкового аппарата поджелудочной железы.

Таким образом, при патоморфологическом анализе органов и тканей было выявлено, что моделирование стрептозатоцин-индуцированного сахарного диабета 2-го типа сопровождалось эндотелиопатией, уменьшением площади островкового аппарата поджелудочной железы, а также выраженной картиной развития периферической диабетической нейропатией и дистрофическими изменениями в поперечно-полосатых мышцах голени.

Максимальный и выраженный терапевтический эффект наблюдался после 80-дневного введения заявляемого пептида Д. Введение данного соединения оказало положительное лечебное действие в отношении осложнений сахарного диабета 2-го типа, таких как диабетическая нейропатия, мышечная дистрофия, эндотелиопатия, благоприятно влияло на репаративные процессы в островковом аппарате поджелудочной железы. Анализ гистологических образцов коррелируют с клиническими данными. В частности выраженный лечебный эффект был отмечен в проявлении признаков аллодинии и снижении содержания гликозилированного гемоглобина в эритроцитах экспериментальных животных. Также было отмечено выраженное гипогликемическое действия данного соединения, которое было сопоставимо с таковым у метформина.

Учитывая вышеизложенное, можно сделать вывод о том, что заявляемый пептид Д является высокоэффективным средством терапии и профилактики осложнений сахарного диабета 2-го типа, в частности диабетической нейропатии, а также обладает нейропротективным действием и в отношении алкогольной нейропатии.

Литература

1. Stern, M.P., Williams, K., Gonzalez-Villalpando, C, Hunt, K.J., Haffner, S.M., 2004. Does the metabolic syndrome improve identification of individuals at risk of type 2 diabetes and/or cardiovascular disease? Diabetes Care 27, 2676-2681.

2. Fu, W., Patel, A., Jhamandas J.H., 2013. Amylin receptor: a common pathophysiological target in Alzheimer′s disease and diabetes mellitus. Front Aging Neurosci. 5, 42.

3. Danaei, G., Finucane, M.M., Lu, Y., Singh, G.M., Cowan, M.J., Paciorek, C.J., Lin, J.K., Farzadfar, F., Khang, Y.H., Stevens, G.A., Rao, M., Ali, M.K., Riley, L.M., Robinson, C.A., Ezzati, M., 2011. National, regional, and global trends in fasting plasma glucose and diabetes prevalence since 1980: systematic analysis of health examination surveys and epidemiological studies with 370 country-years and 2.7 million participants. Lancet 378, 31-40.

4. Global health risks. Mortality and burden of disease attributable to selected major risks. Geneva, World Health Organization, 2009.

5. Mathers, C.D., Loncar, D., 2006. Projections of global mortality and burden of disease from 2002 to 2030. PLoS. Med. 3, e442.

6. Недосугова Л.В. Патогенез, клинические проявления, подходы к лечению диабетической полинейропатии // Медицинский совет, 12. 2013. С. 43-49.

7. Eng, J. et al., Isolation and Characterization of Exendin-4, an Exendin-3 Analogue, from Heloderma suspectum Venom. J. Biol. Chem., Vol. 267, Issue 11, 7402-7405, Apr, 1992.

8. US 5424286 Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same.

9. US 2005043238 Exendin formulations for weight reduction.

10. US 6858576 Method for regulating gastrointestinal motility.

11. US 9800449 Use of exendins and agonists thereof for the reduction of food intake.

12. US 2005037958 Inotropic and diuretic effects of GLP-1 and GLP-1 agonists.

13. US 6703359 Inotropic and diuretic effects of exendin.

14. JP 2002509078 Inotropic and diureticeffects of exendin and GLP-1.

15. US 2004266678 Methods and compositions for treating polycystic ovary syndrome.

16. MX 2008015640 Compounds for treatment of metabolic disorders.

17. US 2009291100 Therapeutic agent for polycystic ovary syndrome (PCOS).

18. JP 2006520747 Methods and compositions for treating polycystic ovary syndrome.

19. US 2004209803 Compositions for the treatment and prevention of nephropathy.

20. AU 2003297356 Prevention and treatment of cardiac arrhythmias.

21. AU 2003262628 Bone marrow cell differentiation.

22. US 2004092443 Long-acting exendins and exendin agonists.

23. US 2004023871 Use of exendins and agonists thereof for the treatment of gestational diabetes mellitus.

24. JP 2003519667 Use of exendins and agonists thereof for modulation oftriglyceride levels and treatment of dyslipidemia.

25. US 2003036504 Use of exendins and agonists thereof for modulation oftriglyceride levels

and treatment of dyslipidemia.

26. US 9410225 Method for regulating gastrointestinal motility.

27. RU 2247575 Method for inhibiting glucagon.

28. US 2007041951 Differentiation of non-insulin producing cells into insulin producing cells

by GLP-1 or exendin-4 and uses thereof.

29. PT 1019077 Novel exendin agonist compounds.

30. LU 91342 Use of exendins and agonists thereof for the reduction of food intake.

31. US 2002137666 Use of exendins and agonists thereof for the reduction of food intake.

32. US 2006194719 Stabilized exendin-4 compounds.

33. US 2003087821 Exendins, exendin agonists, and methods for their use.

34. EP 1419783 Use of a composition comprising anexendin or a compound derived therefrom and a pharmaceutical carrier.

35. Szkudelski T. Streptozotocin-nicotinamide-induced diabetes in the rat // Characteristics of

the experimental model. Exp Biol Med (Maywood). 2012; 237 (5):481-90.

36. Altaian D.G. Bland J.M. How to randomize // BMJ. 1999. Vol. 11. p. 319 (7211)

37. Руководство по доклиническим исследованиям лекарственных средств // ФГБУ "НЦЭМСП" Под редакцией Миронова А.Н. Том. 1. 2012. 695 с.

38. Chaplan, S.R., et al. "Quantitative assessment of tactile allodynia in the rat paw." // J. Neurosci. Methods 53.1 (1994): 55-63.

39. Dixon W.J. Efficient analysis of experimental observations // Ann. Rev. Pharmacol. Toxicol. - 1980. - Vol. 20. - P. 441-462.

40. Weiss, F., and Koob, G.F. The neuropharmacology of ethanol self-administration. // In: Meyer, R.E.; Koob, G.F.; Lewis, M.J.; and Paul, S.M., eds. Neuropharmacology of Ethanol: New Approaches. / Boston: Birkhauser, 1991. pp. 125-162.

41. Козырев K.M., Марзаганова З.A., Дзиццоева П.А. Сравнительная клинико-морфологическая характеристика болезни Пика и болезни Альцгеймера // Вестник новых медицинских технологий. 2013. №1, 7 с.

42. Махмутов O.K. Реактивные изменения в нервах на ранних сроках проводниковой анестезии // Ветеринарный доктор, 2007. С. 23-25.

43. Чумасов Е.И. Методические разработки по диагностике демиелизирующих заболеваний человека и животных. 1993. С. 1-16.

Соединение, представленное формулой:
H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH, обладающее терапевтическим действием для лечения и профилактики сахарного диабета 2-го типа и его осложнений, таких как диабетическая нейропатия, мышечная дистрофия и эндотелиопатия.



 

Похожие патенты:

Изобретение относится к области молекулярной биологии. Предложен способ получения постоянной линии клеток-амниоцитов человека, включающий трансфекцию зародышевых клеток-амниоцитов человека молекулой нуклеиновой кислоты, содержащей последовательность нуклеиновой кислоты, кодирующую продукты генов аденовирусов Е1А и Е1В, причем указанную последовательность нуклеиновой кислоты получают из серотипа 5 аденовируса человека, и последующую трансфекцию постоянной линии клеток-амниоцитов человека, полученной на первом этапе, молекулой нуклеиновой кислоты, содержащей последовательность нуклеиновой кислоты, кодирующую большой SV40 Т-антиген.

Изобретение относится к новому новый классу производных пептидо-нуклеиновых кислот, которые показывают хорошую клеточную пенетрацию и сильную связывающую аффинность к нуклеиновой кислоте.

Изобретение относится к биотехнологии. Способ получения рекомбинантного белка SAV-RGD, специфически узнающего клетки меланомы человека, предусматривает культивирование в питательной среде штамма Escherichia coli MG1655/pSAV-RGD, получение периплазматической фракции клеток указанного штамма, очистку рекомбинантного белка ионообменной хроматографией с последующей ультрафильтрацией и лиофилизацией.

Изобретение относится к области биотехнологии, конкретно к новым гетеромультимерным белкам, полученным из модифицированного убиквитина, и может быть использовано в медицине для лечения или диагностики заболеваний, ассоциированных с гиперпродукцией экстрадомена В фибронектина (ED-B).

Изобретение относится к области биотехнологии и может быть использовано для идентификации гетеромультимерных убиквитинов со способностью связываться с лигандом-антигеном.

Группа изобретений относится к биотехнологии. Предложен белок-предшественник для рекомбинантного получения пептидов с длиной последовательности от 5 до 70 аминокислотных остатков.
Изобретение относится к биохимии. Описано средство, снижающее половое влечение и прерывающее течку, а также предохраняющее от нежелательной беременности.

Изобретение относится к биотехнологии. Описываются самоорганизующиеся пептидные наночастицы (SAPN), включающие эпитопы Т-клеток и/или эпитопы В-клеток.

Изобретение относится к новому способу химического превращения пептидной цепи в тиоэфир пептида. Группу -C(=X)-R1 вводят в тиоловую группу остатка цистеина, и затем полученный пептид в органическом растворителе реагирует с соединением, имеющим замещаемую группу, представленную формулой: -NH-C(=Y)NHR3, и группа -NH-C(=Y)NHR3 связывается в реакции присоединения с карбоксильной группой пептидной связи на N-концевой стороне остатка цистеина, посредством чего пептидную связь расщепляют и фрагмент пептида на С-концевой стороне вырезают.

Изобретение относится к области генной инженерии и может быть использовано для регулирования проницаемости метан-продуцирующей клетки. Получают полипептид, который способен проникать в метан-продуцирующую клетку и повышать ее проницаемость, характеризующийся аминокислотной последовательностью SEQ ID NO:117, 118 или 119 или по меньшей мере 90% идентичностью к указанной последовательности или по меньшей мере 15 последовательно расположенными аминокислотами указанной последовательности.

Изобретение относится к области биотехнологии, вирусологии и ветеринарии. Изобретение раскрывает применение иммуногенной композиции, содержащей рекомбинантный белок PCV2 ORF2, для индукции иммунного ответа против PCV2 или для получения лекарственного средства для индукции иммунного ответа против PCV2. При этом количество рекомбинантного белка PCV2 ORF2 в композиции составляет по меньшей мере 2 мкг. Предложенное изобретение может быть использовано в ветеринарии. 2 н. и 17 з.п. ф-лы, 3 ил., 24 табл., 5 пр.

Изобретение относится к биотехнологии, а именно к способу выделения вирусоподобных частиц VLP. Получают растения или растительный материал, содержащий VLP, локализованные в апопласте. Получают смесь протопластов/сферопластов и апопластов посредством обработки растения или растительного материала мультикомпонентной ферментной смесью, разрушающей клеточные стенки, содержащей целлюлазу. Получают фракцию протопласта/сферопласта и фракцию апопласта из смеси протопластов/сферопластов и апопластов. Выделяют фракцию апопласта, причем фракция апопласта содержит VLP. Выделяют VLP из фракции апопласта. Предложенное изобретение позволяет с высокой эффективностью выделить вирусоподобные частицы. 3 н. и 40 з.п. ф-лы, 12 ил., 15 табл., 9 пр.

Настоящее изобретение относится к области бактериофаговой терапии для лечения и регулирования бактериальных инфекций. Представленная группа изобретений касается выделенного бактериофага, обладающего активностью против Pseudomonas aeruginosa, белков, кодируемых геномом такого бактериофага, фармацевтической композиции, содержащей такие белки, применяющейся для изготовления лекарственного средства для лечения инфекции, обусловленной Pseudomonas aeruginosa, способа диагностики бактериальной инфекции, вызванной Pseudomonas aeruginosa, и способа уменьшения или ингибирования колонизации или роста Pseudomonas aeruginosa на твердой поверхности. Представленная группа может быть использована в больницах для избирательного лечения инфекций, обусловленных Pseudomonas aeruginosa, не оказывая при этом влияния на нормальную окружающую флору. 12 н. и 18 з.п. ф-лы, 228 ил., 1 табл., 8 пр.

Настоящие изобретения относятся к области ветеринарии и касаются иммуногенной композиции (варианты) и применения пептида рибосомального белка Р0 эктопаразитов. Охарактеризованная иммуногенная композиция содержит пептид рибосомального белка Р0 экстопаразитов, либо нуклеиновую кислоту, кодирующую такой полипептид. Этот пептид локализован между аминокислотами 267 и 301 белка P0, и может быть получен рекомбинантными способами или химическим синтезом. Этот пептид можно сливать с белком или пептидом-носителем, или с иммунным носителем и включать в масляный состав. Составы, содержащие пептид, обеспечивают защиту против клещей, например, вида Rhipicephalus microplus, Rhipicephalus sanguineus и Ixodes scapularis и эктопаразитов, известных как «морские вши», таких как Caligus и Lepeophtheirus. и могут быть использованы для борьбы с заражениями эктопаразитами или с переносом ассоциированных с ними патогенов. 3 н. и 9 з.п. ф-лы, 13 ил., 5 табл., 12 пр.

Группа изобретений относится к способам синтеза гликопептида, имеющего сиалированную сахарную цепь. Путем реакции этерификации осуществляют связывание смолы, имеющей гидроксильную группу с аминокислотой, у которой азот аминогруппы защищен Вос-группой. Отсоединяют Вос-группу с образованием свободной аминогруппы. Осуществляют элонгацию аминокислоты, связанной со смолой, путем дополнительного связывания другой аминокислоты, у которой азот аминогруппы защищен Вос-группой. Отсоединяют Вос-группу с образованием свободной аминогруппы. Осуществляют гидролиз смолы с помощью кислоты. Указанные аминокислоты по меньшей мере единожды являются сиалированными, причем карбоксильная группа сиаловой кислоты защищена фенацильной группой. Также получают производное сиалилгликоаспарагина. Изобретения позволяют получать сиалированные гликопептиды, в которых присутствует лабильная к щелочам неприродная аминокислота, а также предотвратить деградацию сиаловой кислоты. 2 н. и 20 з.п. ф-лы, 11 ил., 4 пр.
Наверх