Генетические маркеры, ассоциированные с засухоустойчивостью кукурузы

Изобретение относится к биохимии. Описан способ получения кукурузного растения с улучшенной оптимизаций водопотребления и растение, полученное таким способом. Изобретение позволяет получать растения, обладающие повышенной засухоустойчивостью. 3 н. и 11 з.п. ф-лы, 6 ил., 13 табл., 13 пр.

 

Раскрытый в настоящем документе объект изобретения претендует на приоритет предварительной заявки на патент США серийный №61/289, 718, поданной 23 декабря 2009 г., и предварительной заявки на патент США серийный №61/369, 999, поданной 2 августа 2010, раскрытие каждой из которых включено в настоящее описание посредством отсылки в полном объеме.

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Раскрытый в настоящем документе объект изобретения относится к кукурузе, такой как кукуруза вида Zea mays, и способам разведения данного вида. Более конкретно, раскрытый в настоящем документе объект изобретения относится к линиям кукурузы, таким как линии Zea mays, с одним или более генотипами с улучшенной оптимизацией водопотребления, а также способам разведения данного вида, причем в некоторых вариантах выполнения изобретения способы включают в себя анализ генетических маркеров и/или анализ последовательностей нуклеиновых кислот.

УРОВЕНЬ ТЕХНИКИ

Засуха является одним из основных факторов, ограничивающих продуцирование кукурузы в мире - 15% мирового урожая кукурузы теряется каждый год из-за засухи. Периоды засухи могут возникать в любое время в течение вегетационного периода, но кукуруза особенно чувствительна к засухе в период до и во время цветения. Если засуха возникает во время такого критического периода, то она может привести к значительному снижению урожая зерна.

Идентификация генов, которые повышают засухоустойчивость кукурузы, может привести к более эффективному производству сельскохозяйственных культур, давая возможность для идентификации, селекции и получения кукурузы с повышенной засухоустойчивостью. Таким образом, целью разведения растений является объединение в одном растении различных желательных признаков. Для полевых культур, таких как кукуруза, такие признаки могут включать в себя большую урожайность и лучшее агрономическое качество. Однако генетические локусы, которые влияют на урожайность и агрономическое качество, не всегда известны, и даже если они известны, то их вклад в такие признаки зачастую неясен. Таким образом, необходимо идентифицировать новые локусы, которые могут положительно влиять на такие желательные признаки, и/или необходимо обнаружить возможности к такому воздействию у известных локусов.

Будучи обнаруженными, такие желательные локусы могут быть отобраны в рамках программы разведения с целью получения растений, несущих желательные признаки. Пример варианта выполнения способа генерации таких растений включает в себя перенос интрогрессией последовательностей нуклеиновой кислоты из растений, которые обладают желательной генетической информацией, в растения, которые не обладают ею, осуществляя скрещивание растений с применением традиционных способов разведения. Желательные локусы могут быть интрогрессированы в имеющиеся в продаже сорта растений, применяя селекцию с использованием маркера (MAS) или скрещивание с использованием маркера (МАВ). MAS и МАВ предполагают использование одного или более молекулярных маркеров для идентификации и селекции таких растений-потомков, которые содержат один или более локусов, кодирующих желаемые признаки. Такие идентификация и селекция могут быть основаны на селекции информативных маркеров, ассоциированных с желаемыми признаками. МАВ также может быть применено для получения почти изогенных линий (NIL), несущих представляющие интерес локусы, позволяя более детальное изучение воздействия, которое каждый локус может оказывать на желаемый признак, а также является эффективным способом получения популяций с помощью возвратного скрещивания инбредных линий (BIL).

Засуха во время культивирования кукурузы представляет собой один из основных факторов, ограничивающих продуцирование кукурузы в мире. Если засуха наступает непосредственно перед или во время цветения, то она может приводить к увеличению продолжительности интервала времени между цветением и выметыванием пестичных столбиков и снижению урожайности зерна. 15% мировой кукурузы или свыше 19 миллионов тонн теряется ежегодно из-за засухи. Идентификация генов-кандидатов, которые могут улучшить засухоустойчивость культур кукурузы, может привести к более эффективному сельскохозяйственному производству в пострадавших районах.

Что действительно необходимо, так это новые способы и композиции для генетического анализа сортов Zea mays в отношении засухоустойчивости и для применения полученной информации при получении новых растений Zea mays, которые обладают улучшенными признаками оптимизации водопотребления водопотребления.

РАСКРЫТИЕ ИЗОБРЕТЕНИЯ

В данном разделе, содержащем сущность изобретения, перечисляется несколько вариантов выполнения раскрытого в настоящем документе объекта изобретения и во многих случаях перечисляются вариации и перестановки данных вариантов выполнения изобретения. Настоящий раздел, касающийся сущности изобретения, представляет собой просто приведенные в качестве примера многочисленные и разнообразные варианты выполнения изобретения. Упоминание одного или более характерных признаков данного варианта выполнения изобретения также приводится в качестве примера. Подобный вариант выполнения изобретения может обычно существовать с или без упомянутого признака(ов), аналогичным образом, данные признаки могут быть применены к другим вариантам выполнения раскрытого в настоящем документе объекта изобретения, независимо от того, перечислены они в настоящем разделе, касающемся сущности изобретения, или нет. Чтобы избежать чрезмерного повторения, данный раздел не перечисляет или не предлагает все возможные комбинации таких признаков.

Настоящее изобретение относится к композициям и способам идентификации, селекция и получения кукурузы с повышенной засухоустойчивостью. Настоящее изобретение также относится к засухоустойчивому кукурузному растению или зародышевой плазме.

Некоторые варианты выполнения изобретения относятся к способам идентификации засухоустойчивого кукурузного растения или зародышевой плазмы. Такие способы могут содержать обнаружение в кукурузном растении или зародышевой плазме маркера, ассоциированного с повышенной засухоустойчивостью.

Некоторые варианты выполнения изобретения относятся к способам получения засухоустойчивого кукурузного растения. Такие способы могут содержать обнаружение в кукурузной зародышевой плазме присутствия маркера, ассоциированного с повышенной засухоустойчивостью, и продуцирование растения-потомка из упомянутой кукурузной зародышевой плазмы.

В некоторых вариантах выполнения изобретения присутствие маркера, ассоциированного с повышенной засухоустойчивостью, обнаруживают с помощью маркерного зонда. В некоторых таких вариантах выполнения изобретения присутствие маркера, ассоциированного с повышенной засухоустойчивостью, обнаруживают в продукте амплификации из образца нуклеиновой кислоты, изолированной из кукурузного растения или зародышевой плазмы. В некоторых вариантах выполнения изобретения маркер содержит гаплотип, и для обнаружения аллелей, которые составляют гаплотип, применяют множество зондов. В некоторых таких вариантах выполнения изобретения аллели, которые составляют гаплотип, обнаруживают во множестве продуктов амплификации из образца нуклеиновой кислоты, изолированной из кукурузного растения или зародышевой плазмы.

Некоторые варианты выполнения изобретения относятся к способам селекция засухоустойчивого кукурузного растения или зародышевой плазмы. Такие способы могут содержать скрещивание первого кукурузного растения или зародышевой плазмы со вторым кукурузным растением или зародышевой плазмой, причем первое кукурузное растение или зародышевая плазма содержит маркер, ассоциированный с повышенной засухоустойчивостью, и селекция растения-потомка или зародышевой плазмы, который обладает данным маркером.

Некоторые варианты выполнения изобретения относятся к способам интрогрессии аллели, ассоциированной с повышенной засухоустойчивостью, в кукурузное растение или зародышевую плазму. Такие способы могут включать скрещивание первого кукурузного растения или зародышевой плазмы, содержащей аллель, ассоциированную с повышенной засухоустойчивостью, со вторым кукурузным растением или зародышевой плазмой, лишенным упомянутой аллели, и повторное возвратное скрещивание растений-потомков, содержащих упомянутую аллель, со вторым кукурузным растением или зародышевой плазмой для получения устойчивых к засухе кукурузного растения или зародышевой плазмы, содержащих аллель, ассоциированную с повышенной засухоустойчивостью. Потомство, содержащее аллель, ассоциированную с повышенной засухоустойчивостью, может быть идентифицировано обнаружением в их геномах присутствия маркера, ассоциированного с упомянутой аллелью.

Настоящее изобретение также относится к кукурузным растениям и/или зародышевым плазмам, идентифицированным, произведенным или отобранным любым из способов по изобретению, а также к любому потомству или семенам, полученному из кукурузного растения или зародышевой плазмы, идентифицированному, произведенному или отобранному с помощью данных способов.

Настоящее изобретение также относится к не встречающимся в природе кукурузным растениям и/или зародышевым плазмам, содержащим один или более маркер, ассоциированный с повышенной засухоустойчивостью.

Настоящее изобретение также относится к изолированным и/или очищенным маркерам, ассоциированным с повышенной засухоустойчивостью. Такие маркеры могут содержать нуклеотидную последовательность, которая по меньшей мере на 85%, 90%, 95% или на 99% идентична любой из последовательностей SEQ ID NO: 1-117, 400 и 401, их обратной комплементарной последовательности или их информативным или функциональным фрагментам.

Настоящее изобретение также относится к композициям, содержащим пару праймеров, способных амплифицировать образец нуклеиновой кислоты, изолированный из кукурузного растения или зародышевой плазмы для создания маркера, ассоциированного с повышенной засухоустойчивостью. Такие композиции могут содержать, состоять, по существу, из или состоять из одной из пар праймеров для амплификации, указанных в таблице 1.

Таблица 1
SEO ID NO примеров олигонуклеотидных праймеров, которые могут быть применены для анализа локусов, аллелей и гаплотипов оптимизации водопотребления
Геномный локус Примеры праймеров амплификации Примеры праймеров анализа
1, 61 118, 119 232, 233
2, 63 120, 121 346, 347;
348, 349
3, 63 122, 123 234, 235
4, 64 124, 125 236, 237
5, 65 126, 127 238, 239
6, 66 128, 129 240, 241
7, 67 130, 131 242, 243;
244, 245;
246, 247;
248, 249;
250, 251;
350, 351;
352, 353;
8, 68 132, 133 252, 253
9, 69 134, 135 254, 255
10, 70 136, 137 256, 257
11, 71 138, 139 258, 259
12, 13, 72 140, 141 260, 261;
262, 263;
264, 265;
266, 267
14, 73 142, 143 268, 269
15, 74 144, 145 270, 271
16, 75 146, 147 272, 273
17, 76 148, 149 274, 275
18, 77 150, 151 276, 277
19, 78 152, 153 278, 279;
280, 281;
282, 283;
354, 355;
356, 357
20, 79 154, 155 284, 285
21, 80 156, 157 286, 287
22, 81 158, 159 288, 289
23, 82 160, 161 358, 359;
360, 361
24, 83 162, 163 362, 363
25, 84 164, 165 290, 291;
364, 365
26, 85 166, 167 366, 367
27, 86 168, 169 292, 293
368, 369
28, 87 170, 171 294, 295
29, 88 172, 173 370, 371
30, 89 174, 175 296, 297;
298, 299
31, 90 176, 177 300, 301
32, 91 178, 179 302, 303
33, 92 180, 181 372, 373
34, 93 182, 183 304, 305;
306, 307;
308, 309
35, 94 184, 185 310, 311
36, 95 186, 187 312, 313
37, 96 188, 189 314, 315;
316, 317
38, 97 190, 191 318, 319;
320, 321
39, 98 192, 193 322, 323
40, 99 194, 195 324, 325
41, 100 196, 197 326, 327;
328, 329
42, 101 198, 199 330, 331
43, 102 200, 201 332, 333
44, 45, 103 202, 203 374, 375;
376, 377
46, 104 204, 205 378, 379
47, 105 206, 207 380, 381
48, 106 208, 209 382, 383
49, 107 210, 211 334, 335
50, 51, 108 212, 213 336, 337;
384, 385
52, 109 214, 215 338, 339
53, 110 216, 217 340, 341
54, 111 218, 219 344, 345
55, 112 220, 221 386, 387
56, 113 222, 223 388, 389;
390, 391
57, 114 224, 225 392, 393
58, 115 226, 227 394, 395
59, 116 228, 229 396, 397
60, 117 230, 231 398, 399
400, 401 402, 407 408, 409;
410, 411;
412, 413

Маркер, ассоциированный с повышенной засухоустойчивостью, может содержать, состоять, по существу, из или состоять из одной аллели или комбинации аллелей в одном или более генетических локусах.

Таким образом, некоторые варианты выполнения раскрытого здесь объекта изобретения относятся к способам получения гибридных растений с улучшенной оптимизацией водопотребления. В некоторых вариантах выполнения изобретения способ содержит: (а) предоставление первого растения, содержащего первый генотип, содержащий любой из гаплотипов А-М, (b) предоставление второго растения, содержащего второй генотип, содержащий любой из гаплотипов А-М, причем второе растение содержит по меньшей мере один из гаплотипов А-М, который отсутствует в первом растении, (с) скрещивание первого растения и второго кукурузного растения для получения поколения F1, идентификацию одного или более членов поколения F1, которое содержит желаемый генотип, содержащий любую комбинацию гаплотипов А-М, причем желаемый генотип отличается как от первого генотипа (а), так и от второго генотипа (b), посредством чего продуцируется гибридное растение с улучшенной оптимизацией водопотребления. В некоторых вариантах выполнения изобретения гаплотипы А-М определяются следующим образом:

i) гаплотип А содержит нуклеотид G в позиции, которая соответствует позиции 115 последовательности SEQ ID NO: 1, нуклеотид А в позиции, которая соответствует позиции 270 SEQ ID NO: 1, нуклеотид Т в позиции, которая соответствует позиции 301 SEQ ID NO: 1, и нуклеотид А в позиции, которая соответствует позиции 483 SEQ ID NO: 1 на хромосоме 8 в геноме первого растения;

ii) гаплотип В содержит делецию в позициях 4497-4498 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4505 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4609 последовательности SEQ ID NO: 7, нуклеотид А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4792 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4836 последовательности SEQ ID NO: 7, нуклеотид С в позиции, которая соответствует позиции 4844 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4969 последовательности SEQ ID NO: 7, и тринуклеотид ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7 на хромосоме 8 в геноме первого растения;

iii) гаплотип С содержит нуклеотид А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 8, нуклеотид G в позиции, которая соответствует позиции 390 последовательности SEQ ID NO: 8, и нуклеотид А в позиции, которая соответствует позиции 477 последовательности SEQ ID NO: 8 на хромосоме 2 в геноме первого растения;

iv) гаплотип D содержит нуклеотид G в позиции, которая соответствует позиции 182 последовательности SEQ ID NO: 19, нуклеотид А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотид G в позиции, которая соответствует позиции 330 последовательности SEQ ID NO: 19, и нуклеотид G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19 на хромосоме 8 в геноме первого растения;

v) гаплотип Е содержит нуклеотид С в позиции, которая соответствует позиции 61 последовательности SEQ ID NO: 21, нуклеотид С в позиции, которая соответствует позиции 200 последовательности SEQ ID NO: 21, и делецию девяти нуклеотидов в позициях, которые соответствуют позициям 316-324 последовательности SEQ ID NO: 21 на хромосоме 5 в геноме первого растения;

vi) гаплотип F содержит нуклеотид G в позиции, которая соответствует позиции 64 последовательности SEQ ID NO: 27, и нуклеотид Т в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27 на хромосоме 8 в геноме первого растения;

vii) гаплотип G содержит нуклеотид С в позиции, которая соответствует позиции 98 последовательности SEQ ID NO: 28, нуклеотид Т в позиции, которая соответствует позиции 147 последовательности SEQ ID NO: 28, нуклеотид С в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 28, и нуклеотид Т в позиции, которая соответствует позиции 496 последовательности SEQ ID NO: 28 на хромосоме 9 в геноме первого растения;

viii) гаплотип Н содержит нуклеотид Т в позиции, которая соответствует позиции 259 последовательности SEQ ID NO: 30, нуклеотид Т в позиции, которая соответствует позиции 306 последовательности SEQ ID NO: 30, нуклеотид А в позиции, которая соответствует позиции 398 последовательности SEQ ID NO: 30, и нуклеотид С в позиции, которая соответствует позиции 1057 последовательности SEQ ID NO: 30 на хромосоме 4 в геноме первого растения;

ix) гаплотип I содержит нуклеотид С в позиции, которая соответствует позиции 500 последовательности SEQ ID NO: 36, нуклеотид G в позиции, которая соответствует позиции 568 последовательности SEQ ID NO: 36, и нуклеотид Т в позиции, которая соответствует позиции 698 последовательности SEQ ID NO: 36 на хромосоме 6 в геноме первого растения;

х) гаплотип J содержит нуклеотид А в позиции, которая соответствует позиции 238 последовательности SEQ ID NO: 42, делецию нуклеотидов, которые соответствуют позициям 266-268 последовательности SEQ ID NO: 42, и нуклеотид С в позиции, которая соответствует позиции 808 последовательности SEQ ID NO: 42 в геноме первого растения;

xi) гаплотип К содержит нуклеотид С в позиции, которая соответствует позиции 166 последовательности SEQ ID NO: 49, и нуклеотид А в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 49, нуклеотид G в позиции, которая соответствует позиции 650 последовательности SEQ ID NO: 49, и нуклеотид G в позиции, которая соответствует позиции 892 последовательности SEQ ID NO: 49 на хромосоме 8 в геноме первого растения;

xii) гаплотип L содержит нуклеотид С в позициях, которые соответствуют позициям 83, 428, 491 и 548 последовательности SEQ ID NO: 53 на хромосоме 9 в геноме первого растения, а также

xiii) гаплотип М содержит нуклеотид С в позиции, которая соответствует позиции 83 в последовательности SEQ ID NO: 400, нуклеотид А в позиции, которая соответствует позиции 119 последовательности SEQ ID NO: 400, и нуклеотид Т в позиции, которая соответствует позиции 601 последовательности SEQ ID NO: 400.

В некоторых вариантах выполнения изобретения гибридное растение с улучшенной оптимизацией водопотребления содержит каждый из гаплотипов А-М, которые присутствуют в первом растении, а также по меньшей мере один дополнительный гаплотип, выбранный из гаплотипов А-М, который присутствует во втором растении. В некоторых вариантах выполнения изобретения первое растение является рекуррентным родителем, содержащим по меньшей мере один из гаплотипов А-М, и второе растение является донором, который содержит по меньшей мере один из гаплотипов А-М, который отсутствует в первом растении. В некоторых вариантах выполнения изобретения первое растение является гомозиготным по меньшей мере по двум, трем, четырем или пяти гаплотипам А-М. В некоторых вариантах выполнения изобретения гибридное растение содержит по меньшей мере три, четыре, пять, шесть, семь, восемь или девять гаплотипов А-М.

В некоторых вариантах выполнения изобретения идентификация содержит генотипирование одного или более членов поколения F1, полученного скрещиванием первого растения и второго растения, по отношению к каждому из гаплотипов, присутствующему в первом растении или во втором растении.

В некоторых вариантах выполнения изобретения первое растение и второе растение представляют собой растения Zea mays.

В некоторых вариантах выполнения изобретения улучшенная оптимизация водопотребления обеспечивает повышенный или стабильный урожай в среде с нехваткой воды, по сравнению с контрольным растением. В некоторых вариантах выполнения изобретения гибрид с улучшенной оптимизацией водопотребления может быть высеян с более высокой густотой посева. В некоторых вариантах выполнения изобретения гибрид с улучшенной оптимизацией водопотребления не демонстрирует обусловленного сцеплением генов падения урожая (yield drag) при выращивании в условиях благоприятной влажности.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к гибридным растениям Zea mays, производимым раскрытыми в настоящем документе способами, или к их клетке, культуре ткани, семени, или частям.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к инбредным растениям Zea mays, производимым возвратным скрещиванием и/или самоопылением и/или продуцированном двойных гаплоидов из гибридных растений Zea mays, раскрытых здесь, или к их клетке, культуре ткани, семени, или частям.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к инбредным или гибридным растениям Zea mays, геном которых содержит по меньшей мере три, четыре, пять, шесть, семь, восемь или девять гаплотипов А-М, причем гаплотипы А-М связаны с оптимизацией водопотребления и определены в настоящем документе. В некоторых вариантах выполнения изобретения инбредное или гибридное растение Zea mays содержит геном, содержащий гаплотипы С, D и G; гаплотипы С, D и L; гаплотипы С, G, Н; гаплотипы С, G и I; гаплотипы С, I и L; гаплотипы Е, G, и I; гаплотипы F, G и Н; гаплотипы А, С, F и G; гаплотипы С, Е, Н и I; гаплотипы С, G, Н, и I; гаплотипы С, Н, I и К; гаплотипы С, Н, I и L; гаплотипы E, F, G и Н; гаплотипы A, C, G, H и I; гаплотипы В, С, D, G и L; гаплотипы С, E, G, H и I; гаплотипы С, G, H, I и L; гаплотипы A, C, G, H, I и K; гаплотипы С, E, F, G, H, I, J, K и L; гаплотипы C, D, G и M; гаплотипы С, D, L и М; гаплотипы С, G, Н и М; гаплотипы С, G, I и М; гаплотипы С, I, L и М; гаплотипы E, G, I и М; гаплотипы F, G, H и М; гаплотипы А, С, F, G и М; гаплотипы С, E, Н, I и М; гаплотипы С, G, Н, I и М; гаплотипы С, Н, I, K и М; гаплотипы С, Н, I, L и М; гаплотипы E, F, G, Н и М; гаплотипы А, С, G, Н, I и М; гаплотипы В, С, D, G, L и М; гаплотипы С, E, G, Н, I и М; гаплотипы С, G, H, I, L и М; гаплотипы А, С, G, Н, I, K и М и гаплотипы С, E, F, G, Н, I, J, K, L и М. В некоторых вариантах выполнения изобретения инбредное или гибридное растение Zea mays представляет собой гибридное растение, которое является гомозиготным по меньшей мере по одному из гаплотипов А-М.

В некоторых вариантах выполнения изобретения инбредное или гибридное растение Zea mays содержит геном, содержащий гаплотипы А, С, E, G, H и I, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, E, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, E, F, G, H и L, необязательно дополнительно содержащийгаплотип М; гаплотипы В, С, D, G, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, E, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, E, F, G, H, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, H и I, необязательно дополнительно содержащий гаплотип М; гаплотипы С, E, F, G, H и I, необязательно дополнительно содержащий гаплотип М; гаплотипы С, E, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, E, F, G и Н, необязательно дополнительно содержащий гаплотип М; гаплотипы D, E, F, G и Н, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, H и I, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, E, G, Н, I и K, необязательно дополнительно содержащий гаплотип М; гаплотипы С, E, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, E, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, E, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, H и I, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, Н, I и К, необязательно дополнительно содержащий гаплотип М; гаплотипы С, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, E, F, G, H и I, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н, I и K, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержит гаплотип М; гаплотипы С, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы. С, Е, F, G, Н, I и K, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, Е, F, G, Н и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, G, Н и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; и/или гаплотипы В, С, D, Е, G, I и L, необязательно дополнительно содержащий гаплотип М.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к гибридным или инбредным растениям Zea mays, которые были модифицированы, чтобы включить в них трансген. В некоторых вариантах выполнения изобретения трансген кодирует продукт гена, который обеспечивает устойчивость к гербициду, отобранному из глифосата, сульфонилмочевины, имидазолинина, дикамбы, глюфисината, феноксипропионовой кислоты, cycloshexome, триазина, бензонитрила и броксинила.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к способам идентификации растений Zea mays, содержащих по меньшей мере одну аллель, ассоциированную с оптимизацией водопотребления, как раскрыто здесь. В некоторых вариантах выполнения изобретения способы содержат: (а) генотипирование по меньшей мере одного растения Zea mays по меньшей мере одним нуклеиново-кислотным маркером, выбранным из последовательностей SEQ ID NO: 1-60 и 400 и (b) селекция по меньшей мере одного растения Zea mays, содержащего аллель по меньшей мере одного из по меньшей мере одного нуклеиново-кислотных маркеров, связанного с оптимизацией водопотребления.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к растениям Zea mays, полученным интрогрессией представляющей интерес аллели локуса, ассоциированного с признаком оптимизации водопотребления, в зародышевую плазму Zea mays. В некоторых вариантах выполнения изобретения интрогрессия содержит (а) селекция растения Zea mays, которое содержит аллель локуса, ассоциированного с признаком оптимизации водопотребления, причем локус, ассоциированный с признаком оптимизации водопотребления, содержит последовательность нуклеотидов, которая по меньшей мере на 90% идентична любой из последовательностей SEQ ID NO: 1-117, 400 и 401 и (b) интрогрессию аллели, представляющей интерес, в зародышевую плазму Zea mays, лишенной данной аллели.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к способам выявления и/или селекцияа засухоустойчивого кукурузного растения или зародышевой плазмы. В некоторых вариантах выполнения изобретения раскрытые в настоящем документе способы содержат обнаружение в кукурузном растении или зародышевой плазме присутствия маркера, ассоциированного с повышенной засухоустойчивостью, причем маркер выбран из группы, состоящей из:

нуклеотида G в позиции, которая соответствует позиции 100 последовательности SEQ ID NO: 2, тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 116 последовательности SEQ ID NO: 23, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида G в позиции, которая соответствует позиции 562 последовательности SEQ ID NO: 25, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида G в позиции, которая соответствует позиции 100, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 23, нуклеотида С в позиции, которая соответствует позиции 746 последовательности SEQ ID NO: 24, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

делеции нуклеотида в позиции, которая соответствует позициям 264-271 последовательности SEQ ID NO: 2, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID N0: 55, нуклеотида С в позиции, которая соответствует позиции 516 последовательности SEQ ID NO: 56, нуклеотида G в позиции, которая соответствует позиции 729 последовательности SEQ ID NO: 59, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 87 последовательности SEQ ID NO: 47, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, и нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, и нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48,

и их комбинаций, таким образом выявляя и/или отбирая засухоустойчивое кукурузное растение или зародышевую плазму.

Таким образом, задачей раскрытого в настоящем документе объекта изобретения является обеспечение способов переноса одного или более признаков оптимизации водопотребления в кукурузную зародышевую плазму.

Вышеприведенная задача раскрытого в настоящем документе объекта изобретения в целом или частично достигается раскрытым в настоящем документе объектом изобретения; другие цели станут очевидными по мере дальнейшего описания, как лучше всего описано ниже.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фигура 1 представляет собой графическое изображение аллелей, присутствующих в нескольких локусах некоторых сортов кукурузы, применяемых в протоколах скрещивания, описанных в настоящем документе.

Фигура 2 представляет собой графическое изображение гаплотипов гомозиготных линий растений, полученных от скрещивания NP2391 и CML333 ("гомозиготная CML333-" и "гомозиготная CML333+") и гибридных линий F1, полученных от скрещивания каждой из вышеупомянутых гомозиготных линий NP2460 ("CML333-" H"CML333+"). Строчными буквами обозначены аллели, унаследованные от донорной линии CML322. Заглавными буквами обозначены аллели, унаследованные от NP2391 или NP2460.

Фигура 3 представляет собой графическое изображение гаплотипов гомозиготных линий растений, полученных от скрещивания NP2391 и CML322 ("гомозиготная CML322-" и "гомозиготная CML322+") и гибридных линий F1, полученных от скрещивания каждой из вышеупомянутых гомозиготных линий NP2460 ("CML322-" и "CML322+"), Строчными буквами обозначены аллели, унаследованные от донорной линии CML322. Заглавными буквами обозначены аллели, унаследованные OTNP2391 или NP2460.

Фигура 4 представляет собой графическое изображение гаплотипов гомозиготных линий растений, полученных от скрещивания NP2391 и Cateto SP VII ("гомозиготная Cateto -" и "гомозиготная Cateto+") и гибридных линий F1, полученных от скрещивания каждой из вышеупомянутых гомозиготных линий NP2460 ("Cateto-" и "Cateto+"). Строчными буквами обозначены аллели, унаследованные от донорной линии Cateto SP VII. Заглавными буквами обозначены аллели, унаследованные OTNP2391 или NP2460.

Фигура 5 представляет собой графическое изображение гаплотипов гомозиготных линий растений, полученных от скрещивания NP2391 и Confite Милиоспо AYA 38 ("гомозиготная Confite -" и "гомозиготная Confite+") и гибридных линий F1, полученных от скрещивания каждой из вышеупомянутых гомозиготных линий NP2460 ("Confite-" и "Confite+"). Строчными буквами обозначены аллели, унаследованные от донорной линии Confite Милиоспо AYA 38. Заглавными буквами обозначены аллели, унаследованные от NP2391 или NP2460.

Фигура 6 представляет собой графическое изображение гаплотипов гомозиготных линий растений, полученных от скрещивания NP2391 и Tuxpeno VEN 692 ("гомозиготная Tuxpeno-" и "гомозиготная Tuxpeno+") и гибридных линий F1, полученных от скрещивания каждой из вышеупомянутых гомозиготных линий NP2460 ("Tuxpeno-" и "Tuxpeno+"). Строчными буквами обозначены аллели, унаследованные от донорной линии Tuxpeno VEN 692. Заглавными буквами обозначены аллели, унаследованные от NP2391 или NP2460.

Для каждой из фигур 1-6 аллели представляют собой следующее:

Аллель Позиция нуклеотида и SEO ID NO:
1 позиция 87 SEQ ID NO: 47
2 позиция 386 SEQ ID NO: 46
3 позиции 4979-4981 SEQ ID NO: 7
4 позиция 4641 SEQ ID NO: 7
5 позиция 472 SEQ ID NO: 48
6 позиция 237 SEQ ID NO: 56
7 позиция 516 SEQ ID NO: 56
8 позиция 266 SEQ ID NO: 44
9 позиция 475 SEQ ID NO: 45
10 позиция 173 SEQ ID NO: 57
11 позиция 746 SEQ ID NO: 24
12 позиция 391 SEQ ID NO: 33
13 позиция 258 SEQ ID NO: 29
14 позиция 217 SEQ ID NO: 23
15 позиция 116 SEQ ID NO: 23
16 позиция 463 SEQ ID NO: 19
17 позиция 309 SEQ ID NO: 19
18 позиции 264-271 SEQ ID NO: 2
19 позиция 100 SEQ ID NO: 2
20 позиция 486 SEQ ID NO: 58
21 позиция 111 SEQ ID NO: 51
22 позиция 254 SEQ ID NO: 27
23 позиция 729 SEQ ID NO: 59
24 позиция 267 SEQ ID NO: 60
25 позиция 562 SEQ ID NO: 25
26 позиция 1271 SEQ ID NO: 26
27 позиция 193 SEQ ID NO: 55

КРАТКОЕ ОПИСАНИЕ ПЕРЕЧНЯ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Настоящее раскрытие содержит множество нуклеотидных и/или аминокислотных последовательностей. На всем протяжении раскрытия и сопровождающего перечня последовательностей для идентификации нуклеотидов применяется стандарт ВОИС ST.25 (1998, далее "Стандарт ST.25"). Данный стандарт идентификации нуклеотидов приводится ниже.

Таблица 2
Соглашения об наименовании нуклеотидов в стандарте ВОИС ST.25
Символ Значение Символ Значение
а а k g или t/u
с с S g или c
g g W а или t/u
t t b g или с или t/u
u u d а или g или t/u
r g или a h а или с или t/u
v t/u или с v а или g или с
m а или с n а или g или с или t/u, неизвестное, прочее или отсутствует

В некоторых случаях сопровождающий перечень последовательностей включает в себя одно или более конкретно указанных определений для некоторых нуклеотидных позиций, как изложено в строчках от <220> до <223> соответствующих записей перечня последовательностей. Например, в то время как в соответствии со стандартом ST.25 нуклеотид "n" обычно заменяет любой из а, с, g или t, то в последовательности SEQ ID NO: 2 отмечается, что последовательность "rmnnnnnn" в нуклеотидных позициях 264-271 определяется так, чтобы представлять или присутствие или отсутствие последовательности нуклеотидов "CACCAAGG". Аналогично, в последовательности SEQ ID NO: 5 отмечается, что последовательность "nnnn" в нуклеотидных позициях 818-821 определяется так, чтобы представлять или присутствие или отсутствие последовательности нуклеотидов "CGCG". Таким образом, в то время как на протяжении настоящего описания необходимо следовать стандарту ST.25, Заявлению s и перечню последовательностей, некоторые последовательности, раскрытые здесь, представляют собой конкретные отклонения от стандарта ST.25 и отмечены соответственно.

Дополнительно, независимо от того, конкретно это отмечено или нет, для каждого чтения "n" в перечне последовательностей следует понимать, что любой отдельный "n" (в том числе, все или некоторые n в последовательности последовательных n) может представлять а, с, g, t/u, неизвестный или другой нуклеотид или его отсутствие. Таким образом, если в перечне последовательностей конкретно не определено противоположное, то в некоторых вариантах выполнения изобретения "n" может не представлять нуклеотид. Например, последовательность SEQ ID NO: 7 содержит ряд из 52-х n между нуклеотидами 4549 и 4600, включительно. Понятно, что один или более данных n может отсутствовать, включая, но не ограничиваясь ими, все 52 или любое их подмножество.

SEQ ID NO: 1 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zmlga4, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 2 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 3 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr1, подпоследовательности которой могут быть амплифицированы с генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 4 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrA, кодирующим зависимый от напряжения анионный канал, подпоследовательности которой могут быть амплифицированы с хромосомы 7 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 5 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr2, подпоследовательности которой могут быть амплифицированы с хромосомы 2 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 6 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr3, подпоследовательности которой могут быть амплифицированы с хромосомы 2 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 7 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr4, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 8 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmMa3, подпоследовательности которой могут быть амплифицированы с хромосомы 2 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 9 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr6, подпоследовательности которой могут быть амплифицированы с хромосомы 4 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 10 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmBglcn, подпоследовательности которой могут быть амплифицированы с хромосомы 3 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 11 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmLOC100276591, подпоследовательности которой могут быть амплифицированы с генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4. SEQ ID NO: 12 и 13 представляют собой нуклеотидные последовательности, которые связаны с локусом оптимизации водопотребления ZmDr7, подпоследовательности которых могут быть амплифицированы с хромосомы 1 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 14 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr8, подпоследовательности которой могут быть амплифицированы с генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 15 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmHsp70, подпоследовательности которой могут быть амплифицированы с хромосомы 1 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 16 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr9, подпоследовательности которой могут быть амплифицированы с хромосомы 4 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 17-представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrB, подпоследовательности которой могут быть амплифицированы с генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 18 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmAdh1-1s, подпоследовательности которой могут быть амплифицированы с хромосомы 1 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 19 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr10, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 20 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrC, подпоследовательности которой могут быть амплифицированы с генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 21 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr5, подпоследовательности которой могут быть амплифицированы с хромосомы 5 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 22 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrD, кодирующим ингибитор 2 субтилизина-химотрипсина, подпоследовательности которой могут быть амплифицированы с хромосомы 5 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 23 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 24 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 25 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr12, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 26 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 27 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrE, кодирующим легумин-подобный белок (сl2-1), подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 28 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrF, кодирующим предполагаемую целлюлозосинтазу, подпоследовательности которой могут быть амплифицированы с хромосомы 9 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 29, представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 30 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDhn2, подпоследовательности которой могут быть амплифицированы с хромосомы 4 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 31 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr16, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 32 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr17, подпоследовательности которой могут быть амплифицированы с генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 33 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 34 представляет собой нуклеотидную последовательность, что связано с локусом оптимизации водопотребления ZmZCN6, подпоследовательности которой могут быть амплифицированы с хромосомы 4 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 35 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrG, подпоследовательности которой могут быть амплифицированы с хромосомы 5 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 36 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDhn1, подпоследовательности которой могут быть амплифицированы с хромосомы 6 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 37 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrH, подпоследовательности которой могут быть амплифицированы с хромосомы 5 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 38 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrI, подпоследовательности которой могут быть амплифицированы с хромосомы 3 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 39 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrJ, кодирующим mcm5 фактор репликации ДНК, подпоследовательности которой могут быть амплифицированы с хромосомы 5 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 40 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmH2B1, подпоследовательности которой могут быть амплифицированы с хромосомы 4 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 41 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDr3, подпоследовательности которой могут быть амплифицированы с хромосомы 2 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 42 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrK, кодирующим неорганическую фосфатазу, подпоследовательности которой могут быть амплифицированы с генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 43 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmCat1, подпоследовательности которой могут быть амплифицированы с хромосомы 5 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 44 и 45 представляют собой нуклеотидные последовательности, которые связаны с локусом оптимизации водопотребления Zea mays, подпоследовательности которых могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 46 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 47 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 48 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 49 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmRIC1, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 50 и 51 представляют собой нуклеотидные последовательности, которые связаны с локусом оптимизации водопотребления ZmPK4, подпоследовательности которых могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 52 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zpu1, подпоследовательности которой могут быть амплифицированы с хромосомы 2 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 53 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления ZmDrL, подпоследовательности которой могут быть амплифицированы с хромосомы 9 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 54 представляет собой нуклеотидную последовательность, которая связана с локусом воды оптимизации ZmDrM, кодирующим транспортер гексозы, подпоследовательности которой могут быть амплифицированы с хромосомы 7 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 55 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 56 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 57 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 58 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 59 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 60 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 8 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 400 представляет собой нуклеотидную последовательность, которая связана с локусом оптимизации водопотребления Zea mays, подпоследовательности которой могут быть амплифицированы с хромосомы 4 генома Zea mays с помощью полимеразной цепной реакции с амплификационными праймерами, как указано ниже в таблице 4.

SEQ ID NO: 61-117 и 401 представляют собой нуклеотидные последовательности в базе данных GenBank® (доступные через Интернет на сайте Национального центра биотехнологической информации (NCBI) Национальных институтов здоровья США), которые соответствуют (то есть происходят от того же хромосомного локуса в Zea mays) последовательностям SEQ ID NO: 1-60 и 400. Отношения между последовательностями SEQ ID NO: 1-60 и 400 и 61-117 и 401 приведены ниже в таблице 3.

Таблица 3
Последовательности в базе данных GenBank®, соответствующие последовательностям SEO ID NO: 1-60 и 400
SEQ ID NO: Номер доступа GENBANK® Соответствующие нуклеотиды * SEQ ID NO соответствующих нуклеотидов
1 AC214546.3 79631-80177 61
2 AC206432.3 76561-76072 62
3 AC218964.2 18179-18598 63
4 AC198035.3 158268-157254 64
5 AC204020.3 180680-179781 65
6 AC206638.3 120959-121302 66
7 AC206220.1 197895-190521 67
8 AC213636.3 7053-6486 68
9 AC184130.4 28529-28053 69
10 AC186650.4 44576-75791 70
11 AC214515.3 46309-46830 71
12, 13 AC211214.4 215368-214930 72
14 AC199476.4 103707-103339 73
15 AC213668.4 30778-29943 74
16 AC196196.4 76499-75481 75
17 AC214144.3 162815-162317 76
18 AC190915.3 6402-5517 77
19 AC209819.3 153562-152716 78
20 AC187243.3 135331-136145 79
21 АС203390.3 86249-86674 80
22 АС195458.3 170810-171228 81
23 АС201782.4 26367-27234 82
24 АС218166.3 71588-72496 83
25 АС194405.3 40048-39222 84
26 АС213631.3 77810-79676 85
27 АС217937.3 111822-111263 86
28 АС211740.4 24016-14511 87
29 АС199040.3 88703-89626 88
30 АС203943.3 104038-102899 89
31 АС210725.4 219394-219870 90
32 АС231410.4 60838-60463 91
33 АС195798.3 48792-47973 92
34 АС183820.4 23492-22810 93
35 АС214256.3 19884-20648 94
36 АС214345.3 27168-26399 95
37 АС198140.3 149518-149097 96
38 АС204009.3 60314-59762 97
39 АС205343.3 136853-136242 98
40 АС196429.3 5293-5956 99
41 АС206638.3 118845-119524 100
42 АС191554.3 29279-28345 101
43 AC197489.3 40538-39734 102
44, 45 AC212232.3 61043-62624 103
46 AC187869.3 65344-64604 104
47 АС212049.4 47472-46845 105
48 AC194834.3 115968-117051 106
49 АС187038.3 139008-139936 107
50, 51 АС212049.4 54492-53643 108
52 AC202148.4 92457-93062 109
53 AC194911.4 42128-41419 110
54 AC195167.2 55324-56161 111
55 АС202530.4 20157-19337 112
56 АС218457.2 26390-27041 113
57 АС195989.4 114536-115181 114
58 АС207558.3 122483-121881 115
59 АС204398.3 137510-138350 116
60 АС211925.4 71848-71390 117
400 AC 196429.3 5293-5956 401
* Цифры в данной колонке, идущие от низшего значения к высшему, показывают, что запись в базе данных GenBank® соответствует последовательности нуклеотидов с той же цепи, что и в соответствующей последовательности, раскрытой в последовательностях SEQ ID NO: 1-60 и 400. Для тех записей, в которых цифры в данной колонке идут от высшего значения к низшему значению, нуклеотидная последовательность, раскрытая в записи базы данных GenBank®, является обратным комплементом нуклеотидной последовательности, соответствующей последовательности в последовательностях SEQ ID NO: 1-60 и 400.

Последовательности SEQ ID NO: 61-117и401 были добавлены в базу данных GenBank® центром Genome Sequencing Center, Washington University School of Medicine в Сент-Луисе, штат Миссури, США. Как указано в аннотациях к данным записям в базе данных, последовательности были частью усилий консорциума The Maize Sequencing Consortium по секвенированию генома Zea mays. В настоящее время усилия по секвенированию не завершены, и различные участки генома Zea mays остаются несеквенированными и/или последовательности не были упорядочены (или потенциально, были разупорядочены) в базе данных GenBank®.

В таблице 4 перечислены последовательности SEQ ID NO. для олигонуклеотидов, которые могут быть применены для амплификации нуклеиновых кислот Zea mays, полученных из локусов, которые соответствуют последовательностям SEQ ID NO: 1-117, 400 и 401, и примеры ампликонов, продуцируемых таким образом. В таблице 4 приводится позиция нуклеотида в каждой последовательности локусов последовательностей SEQ ID NO 1-60, относящаяся к полиморфизму (в некоторых вариантах выполнения изобретения SNP), который ассоциируется с признаком оптимизации водопотребления, а также соответствующая позиция нуклеотида для полиморфизма в каждом ампликоне.

Таблица 4
SEO ID NO для олигонуклеотидов, которые могут быть использованы для амплификации и/или анализа локусов Zea mays, соответствующих последовательностям SEO ID NO: 1-117, 400 и 401
Локус (SEQ ID NO) Примеры праймеров для амплификации (SEQ ID NO) Позиция(и) SNP в последовательности SEQ ID NO: 1-60 Примеры используемых при анализе праймеров (SEQ ID NO)
1, 61 118 и 119 115
270 232, 233
301
483
2, 62 120 и 121 100 348, 349
264-271 346, 347
3, 63 122 и 123 216 234, 235
4, 64 124 и 125 503 236, 237
5, 65 126 и 127 818-821 238, 239
6, 66 128 и 129 254 240, 241
7, 67 130 и 131 4497-4498 246, 247
4505
4609
4641 244, 245
352, 353
4792 248, 249
4836 250, 251
4844
4969
4979-4981 242, 243
350, 351
8, 68 132 и 133 217 252, 253
390
477
9, 69 134 и 135 292 254, 255
10, 70 136 и 137 166 256, 257
11, 71 138 и 139 148 258, 259
12, 13, 140 и 141 94 (12) 260, 261
72 35 (13) 262, 263
86 (13) 264,265
89 (13) 266, 267
14, 73 142 и 143 432 268, 269
15, 74 144 и 145 753 270, 271
16, 75 146 и 147 755 272, 273
17, 76 148 и 149 431 274, 275
18,77 150 и 151 518 276, 277
19, 78 152 и 153 182 280, 281
309 282, 283
356, 357
330
463 278, 279
354, 355
20, 79 154 и 155 773-776 284, 285
21,80 156 и 157 61
200
316-324 286, 287
22, 81 158 и 159 211 288, 289
23, 82 160 и 161 116 360, 361
217 358, 359
24, 83 162 и 163 746 362, 363
25, 84 164 и 165 562 290, 291
364, 365
26, 85 166 и 167 1271 366, 367
27, 86 168 и 169 64
254 292, 293
368, 369
28, 87 170 и 171 98
147
224
496 294, 295
29, 88 172 и 173 258 370, 371
30, 89 174 и 175 259 298, 299
296
398 296, 297
1057
31, 90 176 и 177 239 300, 301
32, 91 178 и 179 208 302, 303
33, 92 180 и 181 391 372, 373
34, 93 182 и 183 144-145 304,305
169 308, 309
537 306, 307
35, 94 184 и 185 76 310, 311
36, 95 186 и 187 500
568
698 312, 313
37, 96 188 и 189 375 316, 317
386 314, 315
38, 97 190 и 191 309 318, 319
342 320,321
39, 98 192 и 193 445 322, 323
40, 99 194 и 195 602 324, 325
41, 100 196 и 197 190 326, 327
580 328, 329
42, 101 198 и 199 238
266-268 330, 331
808
43, 102 200 и 201 708 332, 333
44, 45, 202 и 203 266 (44) 374, 375
103 475 (45) 376, 377
46, 104 204 и 205 386 378, 379
47, 105 206 и 207 87 380, 381
48, 106 208 и 209 472 382, 383
49, 107 210 и 211 166
24
650 334, 335
892
50, 51, 212 и 213 111 (51) 384, 385
108 541 (50) 336, 337
52, 109 214 и 215 442 338, 339
53, 110 216 и 217 83
428 342, 343
491 340, 341
548
54, 111 218 и 219 126 344, 345
55, 112 220 и 221 193 386, 387
56, 113 222 и 223 237 388, 389
516 390, 391
57, 114 224 и 225 173 392, 393
58, 115 226 и 227 486 394, 395
59, 116 228 и 229 729 396, 397
60, 117 230 и 231 267 398, 399
400, 401 402, 403; 83 408, 409;
404, 405; 119 410, 411;
406, 407 601 412, 413

Как видно из таблиц 3 и 4, некоторые из последовательностей SEQ ID NO: 1-399 связаны друг с другом. К примеру, SEQ ID NO: 1 представляет собой нуклеотидную последовательность из Zea mays, которая была картирована в локусе Zmlga4 на хромосоме 8 Zea mays. Подпоследовательность SEQ ID NO: 1 может быть амплифицирована в реакции амплификации (например, ПЦР) для получения ампликона с помощью олигонуклеотидов, имеющих нижеприведенные последовательности SEQ ID NO: 118 и 119. В позиции 270 последовательности SEQ ID NO: 1 имеется SNP, и конкретный нуклеотид, который присутствует в любом образце нуклеиновой кислоты в данной позиции, может быть определен с помощью олигонуклеотидов, имеющих нижеприведенные последовательности SEQ ID NO: 232 и 233.

Кроме того, номер доступа GenBank® AC214546.3 включает в себя подпоследовательность (например, нуклеотиды 79,631-80,177; последовательность SEQ ID NO: 61), которая сама очень похожа на последовательность SEQ ID NO: 1 (с 538 идентичными нуклеотидами из 552 нуклеотидов, процент идентичности составляет 98%) и, следовательно, присутствует в том же локусе, из которого происходит последовательность SEQ ID NO: 1. Различия между двумя последовательностями (которые могут быть обнаружены с применением алгоритма BLAST, алгоритма ClustalX или любого другого подходящего способа анализа) могут быть отнесены к нормальной изменчивости в пределах популяций Zea mays. Подпоследовательность SEQ ID NO: 61 также может быть амплифицирована в реакции амплификации (например, ПЦР) для получения ампликона с помощью олигонуклеотидов, имеющих нижеприведенные последовательности SEQ ID NO: 118 и 119. Олигонуклеотиды, имеющие нижеприведенные последовательности SEQ ID NO: 232 и 233 также могут быть применены для анализа нуклеотидного основания, которое находится в положении, соответствующем позиции 270 последовательности SEQ ID NO: 1.

Для последовательностей SEQ ID NO: 2-399 аналогичные взаимоотношения существуют с описанными выше последовательностями, и специалист в данной области может идентифицировать их с помощью обычных способов анализа последовательностей. Следует отметить, что в отношении некоторых из последовательностей SEQ ID NO: 1-60, 400 полная нуклеотидная последовательность геномного клона, которая включает в себя полноразмерную последовательность, соответствующую данным последовательностям, возможно, еще не была добавлена консорциумом The Maize Sequencing Consortium в базу данных GenBank®. Тем не менее, с помощью информации о последовательностях, раскрытой здесь, специалист в данной области может однозначно идентифицировать локусы Zea mays, которые соответствуют последовательностям SEQ ID NO: 1-117.

ОСУЩЕСТВЛЕНИЕ ИЗОБРЕТЕНИЯ

Раскрытый в настоящем документе объект изобретения относится к композициям и способам выявления, селекция и/или получения кукурузы с повышенной засухоустойчивостью (также называемой здесь оптимизацией водопотребления), а также к кукурузным растениям, выявленным, отобранным и/или произведенным способом данного изобретения. В дополнение, раскрытый в настоящем документе объект изобретения относится к кукурузным растениям и/или зародышевым плазмам, имеющим в своих геномах один или более маркеров, ассоциированных с повышенной засухоустойчивостью.

Для оценки значения аллелей и/или гаплотипов при засухе проводился скрининг различных зародышевых плазм в контролируемых полевых экспериментах, содержащих контрольную обработку с полным орошением и экспериментальную обработку с ограниченным орошением. Цель обработки с полным орошением заключалась в обеспечении того, чтобы вода не ограничивала продуктивность урожая. Напротив, цель обработки с ограниченным орошением заключалась в обеспечении того, чтобы вода стала основным лимитирующим фактором, ограничивающим урожайность зерна. Основные действующие факторы (например, обработка и генотип) и их взаимодействия (например, генотип х обработка) могут быть обнаружены, когда два вида обработки применяли рядом друг с другом на данном поле. Более того, для каждого генотипа в панели количественно оценивались вызванный засухой фенотип, тем самым позволяя проводить ассоциации маркер: признак.

На практике способ обработки с ограниченным орошением может широко варьироваться в зависимости от зародышевой плазмы, подвергаемой скринингу, типа почвы, климатических условий на месте, режима орошения перед началом сезона и режима орошения в сезон, и т.д. Первоначально определяют место, где в сезон количество осадков невелико (чтобы свести к минимуму вероятность непреднамеренного орошения), и которое является подходящим для возделывания сельскохозяйственных культур. Кроме того, может быть важным определение сроков стрессового воздействия с целью обеспечения постоянство скрининга в данном месте из года в год или от участка к участку. Также может приниматься во внимание интенсивность обработки или, в некоторых случаях, желаемая потеря урожая в результате обработки с ограниченным орошением. Выбор слишком легкой интенсивности обработки может не выявить генотипической изменчивости. Выбор слишком тяжелой интенсивности обработки может приводить к слишком большой экспериментальной погрешности. Как только определены сроки стрессового воздействия и сделано описание интенсивности обработки, может осуществляться орошение таким образом, чтобы соответствовать данным целям.

I. Определения

В то время как считается, что последующие термины хорошо понятны специалисту в данной области техники, следующие определения приведены для облегчения объяснения раскрытого в настоящем документе объекта изобретения.

Принимается, что все технические и научные термины, применяемые в настоящем документе, если ниже не определено иначе, имеют то же значение, которое обычно понимается специалистом в данной области техники. Ссылки на способы, применяемые в настоящем документе, предназначены для обозначения способов, как обычно понимают в данной области техники, в том числе вариаций данных способов или замен эквивалентных способов, которые были бы очевидны для специалиста в данной области техники. В то время как последующие термины, как полагают, хорошо понятны специалисту в данной области техники, последующие определения приведены для облегчения объяснения раскрытого в настоящем документе объекта изобретения.

Следуя давней конвенции норм патентного права, термины: неопределенный артикль "а", неопределенный артикль "an" и определенный артикль "the" относятся к "одному или более" при применении в данной заявке, в том числе в формуле изобретения. Например, выражение "маркер" относится к одному или более маркерам. Аналогичным образом, выражение "по меньшей мере один" при применении здесь для обозначения субъекта относится, например, к 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100 или более данным субъектам, включая, но не ограничиваясь ими, целые значения числа от 1 до 100 и больше чем 100.

Если не указано иначе, должно быть понятно, что все числа, выражающие количества ингредиентов, условия реакции и т.д., применяемые в описании и формуле изобретения, модифицируются во всех случаях термином "около". Термин "около" при применении в данном документе, когда речь идет об измеряемой величине, такой как количество массы, вес, время, объем, концентрация или процент, предназначен, чтобы охватывать изменения, составляющие в некоторых вариантах выполнения изобретения ±20%, составляющие в некоторых вариантах выполнения изобретения ±10%, составляющие в некоторых вариантах выполнения изобретения ±5%, составляющие в некоторых вариантах выполнения изобретения ±1%, составляющие в некоторых вариантах выполнения изобретения ±0,5%, и составляющие в некоторых вариантах выполнения изобретения ±0,1% от указанного количества, поскольку такие изменения соответствуют выполнению раскрытых способов. Соответственно, если не указано обратное, числовые параметры, изложенные в данном описании и прилагаемой формуле изобретения, являются приблизительными и могут варьировать в зависимости от желаемых свойств, которые должен приобрести раскрытый в настоящем документе объект изобретения.

Применяемый здесь термин "и/или" означает и охватывает любые возможные комбинации одного или более ассоциированных перечисленных элементов, а также отсутствие их комбинаций при его интерпретации как противопоставления ("или").

Применяемый здесь термин "аллель" относится к варианту или альтернативной форме последовательности в генетическом локусе. В диплоидах одна аллель в каждом локусе наследуется потомком отдельно от каждого из родителей. Две аллели данного локуса, присутствующего в диплоидном организме, занимают соответствующие места на паре гомологичных хромосом, хотя специалист в данной области техники понимает, что аллели у любого конкретного индивида не обязательно представляют все аллели, которые имеются у данного вида.

Применяемый здесь термин "интервал времени между пылением и фазой выметывания пестичных столбиков" (ASI) относится к разнице между тем, когда растение начинает сбрасывать пыльцу (пыление), и когда у него начинается фаза выметывания пестичных столбиков (у женских особей). Данные собираются по каждому участку. В некоторых вариантах выполнения изобретения данный интервал выражается в днях.

Применяемое здесь выражение "ассоциированный с" относится к узнаваемому и/или оцениваемому взаимоотношению между двумя субъектами. Например, выражение "ассоциированный с признаком оптимизации водопотребления" относится к признаку, локусу, гену, аллели, маркеру, фенотипу и т.д. или их экспрессии, присутствие или отсутствие которых может влиять на степень, уровень и/или скорость, с которой растет представляющее интерес растение или часть его, обладающее признаком оптимизации водопотребления. Таким образом, маркер является "ассоциированным с" признаком, когда он связан с ним и когда присутствие маркера является индикатором того, встречается ли желаемый признак или форма признака и/или в какой степени желаемый признак или форма признака будет встречаться в растении/зародышевой плазме, содержащем маркер. Аналогичным образом, маркер является "ассоциированным с" аллелью, когда он связан с ней и когда присутствие маркера является индикатором того, присутствует ли аллель в растении/зародышевой плазме, содержащем маркер. Например, "маркер, ассоциированный с повышенной засухоустойчивостью" относится к маркеру, чье присутствие или отсутствие может быть применено для предсказания, будет ли и/или до какой степени будет засухоустойчивым фенотип растения.

Применяемые здесь термины "беккросс" и "возвратное скрещивание" относятся к способу, посредством которого растение-потомок повторно возвратно скрещивают с одним из его родителей. В схеме возвратного скрещивания родитель-"донор" относится к родительскому растению с желаемым геном или локусом, который нужно интрогрессировать. Родитель-"реципиент" (применяется один или более раз) или "рекуррентный" родитель (применяется два или более раза) относится к родительскому растению, в котором ген или локус интрогрессирован. Например, см. Ragot, M. et al. Marker-assisted Backcrossing: A Practical Example, in TECHNIQUES ET UTILISATIONS DES MARQUEURS MOLECULAIRES LES COLLOQUES, Vol.72, pp.45-56 (1995); и Openshaw et al., Marker-assisted Selection in Backcross Breeding, in proceedings of the symposium "analysis of molecular marker data," pp.41-43 (1994). Первоначальное скрещивание дает поколение F1. Термин "ВС1" относится ко второму использованию рекуррентного родителя, "ВС2" относится к третьему использованию рекуррентного родителя и так далее. В некоторых вариантах выполнения изобретения беккросс проводят повторно с индивидуальным потомком каждого последующего беккросс-поколения, который сам возвратно скрещен с тем же родительским генотипом.

Сантиморганида ("сМ") является единицей измерения частоты рекомбинации. Одна сМ равна 1% вероятности того, что маркер в одном генетическом локусе будет отделен от маркера во втором локусе, благодаря кроссинговеру в одном поколении.

Применяемый здесь термин "хромосома" применяется в признанном в данной области техники значении самовоспроизводящейся генетической структуры в клеточном ядре, содержащей клеточную ДНК и имеющей в своей нуклеотидной последовательности линейный набор генов. Номера хромосом Zea mays, описанные здесь, относятся к номерам хромосом, изложенным в работе Perm et al., 2002, которая основывается на номенклатурной системе, принятой L'institut National da Ia Recherché Agronomique (INRA; Paris, France).

Применяемое здесь выражение "консенсусная последовательность" относится к последовательности ДНК, сконструированной для идентифицирования нуклеотидных различий (например, полиморфизмов SNP и Indel) в аллелях в локусе. Консенсусная последовательность может представлять собой нить ДНК в локусе и определяет нуклеотид(ы) в одной или более позиции (например, в одном или более SNP и/или в одном или более Indel) в локусе. В некоторых вариантах выполнения изобретения консенсусная последовательность применяется для разработки олигонуклеотидов и зондов для обнаружения полиморфизмов в локусе.

Термин "содержащий", который является синонимом слова "включающий", "содержащий" или "характеризующийся", является инклюзивным или открытым понятием, не исключающим дополнительных, подразумеваемых элементов и/или стадий осуществления способа. "Содержащий" представляет собой термин области техники, который означает, что названные элементы и/или стадии присутствуют, но что другие элементы и/или стадии могут быть добавлены и все еще входят в объем соответствующего объекта изобретения.

Применяемое здесь выражение "состоящий из" исключает любой элемент, стадию или ингредиент, который конкретно не упоминается. Например, когда выражение "состоит из" появляется в пункте формулы изобретения, а не сразу после преамбулы, оно ограничивает только элемент, изложенный в данном пункте, другие элементы не исключаются из формулы изобретения в целом.

Применяемое здесь выражение "состоящий в основном из" ограничивает объем соответствующего описания или притязаний указанными материалами и/или стадиями, а также теми материалами и/или стадиями, которые существенно не влияют на основную(ые) и новую(ые) характеристику(и) раскрываемого и/или заявленного объекта. Например, раскрытый в настоящем документе объект изобретения относится в некоторых вариантах выполнения изобретения к интрогрессированию благоприятных аллелей и/или гаплотипов в кукурузные растения. Один локус, который содержит некоторые благоприятные аллели и/или гаплотипы, представлен последовательностью SEQ ID NO: 7, которая включает девять (9) различных полиморфизмов, изложенных в настоящем документе, с девятью различными благоприятными аллелями. Для любого данного интрогрессионного усилия по отношению к генетическому локусу, соответствующему последовательности SEQ ID NO: 7, данный способ может "состоять в основном из" интрогрессирования обнаруженной благоприятной аллели, выбранной из девяти данных полиморфных расположений, что означает, что упомянутая благоприятная аллель является единственной благоприятной аллелью, интрогрессированной в геном потомства. Следует отметить, однако, что дополнительные полиморфные локусы также будут интрогрессированы в геном, хотя последствия такой интрогрессии могут быть неизвестны или не представлять интереса.

В отношении терминов "содержащий", "состоящий в основном из" и "состоящий из", когда один из данных трех терминов применяется здесь, раскрытый в настоящем документе и заявленный объект может включать в себя применение любого из двух других терминов. Например, раскрытый в настоящем документе объект изобретения относится в некоторых вариантах выполнения изобретения к олигонуклеотидным праймерам, содержащим любую из последовательностей SEQ ID NO: 118-399 и 402-413. Понятно, что раскрытый в настоящем документе объект изобретения, таким образом, также содержит олигонуклеотидные праймеры, которые в некоторых вариантах выполнения изобретения состоят в основном из любой из последовательностей SEQ ID NO: 118-399 и 402-113, а также олигонуклеотидных праймеров, которые в некоторых вариантах выполнения изобретения состоят из любой из последовательностей SEQ ID NO: 118-399 и 402-113. Аналогичным образом, также понятно, что в некоторых вариантах выполнения изобретения способы раскрытого в настоящем документе объекта изобретения содержат стадии, раскрытые здесь, в некоторых вариантах выполнения изобретения способы раскрытого в настоящем документе объекта изобретения состоят в основном из стадий, которые раскрыты, и в некоторых вариантах выполнения изобретения способы раскрытого в настоящем документе объекта изобретения состоят из стадий, которые раскрыты в настоящем документе.

Применяемые здесь термины "скрещивание" или "скрещенные" относятся к слиянию гамет через опыление, чтобы произвести потомство (например, клетки, семена или растения). Данный термин охватывает как половые скрещивания (опыление одного растения другим), так и самоскрещивание (самоопыление, например, когда пыльца и яйцеклетка происходят из одного и того же растения). Термин "скрещивать" относится к акту слияния гамет через опыление для получения потомства.

Применяемые здесь термины "сорт" и "разновидность" относятся к группе аналогичных растений, которые можно отличить от других сортов в пределах одного вида по структурным и генетическим особенностям и/или производительности.

Применяемые здесь термины "желаемая аллель" и "аллель, представляющая интерес," применяются взаимозаменяемо для обозначения аллели, ассоциированной с желаемым признаком. В некоторых вариантах выполнения изобретения выражение "желаемая аллель" и/или "аллель, представляющая интерес," может быть связано с увеличением или с уменьшением данного признака или в данном признаке, в зависимости от характера желаемого фенотипа. В некоторых вариантах выполнения изобретения выражение "желаемая аллель" и/или "аллель, представляющая интерес," может быть связано с изменением в морфологии, цвете и т.д.

Применяемые здесь термины "засухоустойчивость" и "засухоустойчивый" относятся к способности растений переносить засуху и/или процветать в условиях засухи. Применяемые относительно зародышевой плазмы, данные термины относятся к способности растения, которое прорастает из зародышевой плазмы, переносить засуху и/или процветать в условиях засухи. Обычно растение или зародышевую плазму обозначают как "засухоустойчивое", если оно демонстрирует "повышенную засухоустойчивость".

Применяемый здесь термин "повышенная засухоустойчивость" относится к улучшению, повышению или увеличению в одном или более фенотипах оптимизации водопотребления, по сравнению с одним или более контрольными растениями (например, один или оба родителя или растение, у которого отсутствует маркер, ассоциированный с повышенной засухоустойчивостью). Примеры фенотипов оптимизации водопотребления включают в себя, но не ограничиваются ими, урожайность зерна при стандартном проценте влажности (YGSMN), влажность зерна в период сбора урожая (GMSTP), вес зерна на участок (GWTPN), процент выхода урожайности (PYREC), сокращение урожайности (YRED), интервал времени между пылением и фазой выметывания пестичных столбиков (ASI) и процент бесплодных растений (РВ). Таким образом, растение, которое демонстрирует более высокий YGSMN, чем один или оба его родителя, если каждое из них выращено в условиях засухи, отображает повышенную засухоустойчивость и может быть обозначено как "засухоустойчивое".

Применяемые здесь термины "элита" и "элитная линия" относятся к любой линии, которая является, по существу, гомозиготной и является результатом разведения и селекции с целью достижения желательной агрономической производительности.

Применяемый здесь термин "ген" относится к наследственной единице, включающей в себя последовательность ДНК, которая занимает конкретное место на хромосоме и содержит генетическую инструкцию для специфической характерной черты или признака в организме.

"Генетическая карта" представляет собой описание обусловленных сцеплением генов взаимоотношений между локусами на одной или более хромосомах в пределах данного вида, обычно изображаемое в схематической или табличной форме. Для каждой генетической карты расстояния между локусами измеряются частотами рекомбинации между ними. Рекомбинации между локусами могут быть обнаружены с помощью различных маркеров. Генетическая карта является продуктом картируемой популяции, типов применяемых маркеров и полиморфного потенциала каждого маркера между различными популяциями. Порядок локусов и генетические расстояния между ними могут отличаться от одной генетической карты до другой.

Применяемое здесь выражение "генетический маркер" относится к последовательности нуклеиновой кислоты (например, полиморфная последовательность нуклеиновой кислоты), которая были идентифицирована как ассоциированная с локусом или аллелью, представляющими интерес, и которая указывает на присутствие или отсутствие локуса или аллели, представляющих интерес, в клетке или организме. Примеры генетических маркеров включают, но не ограничиваются ими, гены, ДНК- или РНК-производные последовательности, промотеры, любые нетранслируемые области гена, микроРНК, siRNA, QTL, трансгены, мРНК, dsРНК, транскрипционные профили и паттерны метилирования.

Применяемый здесь термин "генотип" относится к генетической конституции индивида (или группы индивидов) в одном или более генетических локусах, в противоположность наблюдаемому и/или обнаруживаемому и/или проявляемому признаку (фенотипу). Генотип определяется аллелью(ми) и/или гаплотипом(ами) одного или более известных локусов, которые индивида унаследовал от своих родителей. Термин генотип может быть применен для обозначения генетической конституции индивида в одном локусе, в нескольких локусах или, более широко, термин генотип может быть применен для обозначения генетического устройства индивида для всех генов в его геноме. Генотипы могут быть охарактеризованы косвенно, например, с помощью маркеров, и/или охарактеризованы непосредственно секвенированием последовательности нуклеиновой кислоты.

Применяемый здесь термин "зародышевая плазма" относится к генетическому материалу индивида или из индивида (например, растение), группы индивидов (например, растительная линия, сорт или семья) или клона, происходящего от линии, сорта, вида или культуры. Зародышевая плазма может быть частью организма или клетки или может быть отделена от организма или клетки. В общем случае, зародышевая плазма обеспечивает генетический материал с конкретным молекулярным устройством, которое обеспечивает физическую основу для некоторых или для всех наследственных качеств организма или клеточной культуры. Применяемый здесь термин зародышевая плазма включает в себя клетки, семя или ткани, из которых можно выращивать новые растения, а также части растений, такие как листья, стебли, пыльца или клетки, из которых можно культивированием получить цельное растение.

"Гаплотип" представляет собой генотип индивида во множестве генетических локусов, то есть комбинацию аллелей. Типично, генетические локусы, которые определяют гаплотип, физически и генетически сцеплены между собой, то есть находятся на одном и том же сегменте хромосомы. Термин "гаплотип" может относиться к полиморфизмам в конкретном локусе, таком как один маркерный локус, или к полиморфизмам в нескольких локусах вдоль хромосомного сегмента.

"Гетерозисная группа" содержит набор генотипов, которые хорошо работают при скрещивании с генотипами из другой гетерозисной группы. Hallauer et al. Corn breeding, in corn and corn improvement p.463-564 (1998). Инбредные линии подразделяются на гетерозисные группы и внутри гетерозисной группы дополнительно подразделяются на семьи на основе нескольких критериев, таких как родословная, ассоциации на основе молекулярных маркеров, а также производительность в гибридных комбинациях. Smith et al., Theor. Appl. Gen. 80: 833 (1990).

Применяемый здесь термин "гетерозиготный" относится к генетическому статусу, когда в соответствующих локусах на гомологичных хромосомах находятся различные аллели. Применяемый здесь термин "гомозиготный" относится к генетическому статусу, когда в соответствующих локусах на гомологичных хромосомах находятся идентичные аллели. Следует отметить, что оба данных термина могут относиться к позициям одиночных нуклеотидов, позициям нескольких нуклеотидов, независимо от того, смежные они или нет, или к целым локусам на гомологичных хромосомах.

Применяемый здесь термин "гибридный" относится к семени и/или растению, полученному при скрещивании по меньшей мере двух генетически разнородных родителей.

Применяемый здесь термин "гибридный", когда применяется в контексте нуклеиновых кислот, относится к двухцепочечной молекуле нуклеиновой кислоты или дуплексу, образованному водородными связями между комплементарными нуклеотидами. Термины "гибридизоваться" и "отжиг" относятся к способу, при котором одиночные нити последовательностей нуклеиновой кислоты образуют сегменты двойной спирали посредством водородных связей между комплементарными основаниями.

Применяемое здесь выражение "Illumina® GoldenGate® Assay" относится к набору для высокопроизводительного анализа генотипирования, который продается Illumina Inc. Сан-Диего, Калифорния, США, с помощью которого можно получать SNP-специфичные ПЦР-продукты. Данный анализ подробно описан на сайте Illumina Inc. and in Fan et al., 2006.

Применяемое здесь выражение "в непосредственной близости", когда применяется для описания молекулы нуклеиновой кислоты, которая гибридизуется с ДНК, содержащей полиморфизм, относится к нуклеиновой кислоте, которая гибридизуется с последовательностью ДНК, непосредственно примыкающей к полиморфной позиции нуклеотидного основания. Например, молекула нуклеиновой кислоты, которая может быть применена в анализе однонуклеотидного удлинения, находится "в непосредственной близости" к полиморфизму.

Применяемый здесь термин "улучшенный" и его грамматические варианты относится к растению или его части, его потомству или тканевым культурам, которое, вследствие присутствия (или отсутствия) специфической аллели, ассоциированной с оптимизацией водопотребления (такой как, но не ограничиваясь ими, аллели, ассоциированные с оптимизацией водопотребления, раскрытые здесь), характеризуется более высоким или низким уровнем признака, ассоциированного с оптимизацией водопотребления, в зависимости от того, более высокий или более низкий уровень желательны для определенной цели.

Применяемый здесь термин "инбредный" относится к, по существу, гомозиготному растению или сорту. Данный термин может относиться к растению или сорту, которое является, по существу, гомозиготным на протяжении всего генома или которое является, по существу, гомозиготным по отношению к участку генома, представляющему особенный интерес.

Применяемый здесь термин "INDEL" (используется также написание "indel") относится к инсерции или делеции в паре нуклеотидных последовательностей, причем первая последовательность может быть обозначена как имеющая инсерцию относительно второй последовательности или вторая последовательность может быть обозначена как имеющая делецию относительно первой последовательности.

Применяемый здесь термин "информативный фрагмент" относится к нуклеотидной последовательности, содержащей фрагмент большей нуклеотидной последовательности, причем данный фрагмент позволяет идентификацию одной или более аллелей внутри большей нуклеотидной последовательности. Например, информативный фрагмент нуклеотидной последовательности SEQ ID NO: 1 содержит фрагмент нуклеотидной последовательности SEQ ID NO: 1 и позволяет идентификацию одной или более аллелей (например, нуклеотид G в позиции 115 последовательности SEQ ID NO: 1, нуклеотид А в позиции, которая соответствует позиции 270 последовательности SEQ ID NO: I, нуклеотид Т в позиции, которая соответствует позиции 301 последовательности SEQ ID NO: 1, и/или нуклеотид А в позиции, которая соответствует позиции 483).

Применяемое здесь выражение "интеррогативное положение" означает физическое положение на твердой подложке, которое может быть использовано в анализе для получения данных генотипирования для одного или более заданных геномных полиморфизмов.

Применяемые здесь термины "интрогрессия", "интрогрессирование" и "интрогрессированный" относятся как к естественной, так и к искусственной передаче желаемой аллели или комбинации желаемых аллелей генетического локуса или генетических локусов от одного генетического фона к другому. Например, желаемая аллель в указанном локусе может быть передана по меньшей мере одним потомком через половое скрещивание между двумя родителями одного и того же вида, где по меньшей мере один из родителей имеет желаемую аллель в геноме. Альтернативно, например, передача аллели может произойти рекомбинацией между двумя донорными геномами, например, в слитом протопласте, где по меньшей мере один из донорных протопластов имеет желаемую аллель в геноме. Желаемая аллель может быть выбранной аллелью маркера, QTL, трансгена или им подобного. Потомок, содержащий желаемую аллель, может быть повторно возвратно скрещен с линией, имеющей желаемый генетический фон, и отобран по желаемой аллели, в результате чего желаемая аллель фиксируется в желаемом генетическом фоне. Например, маркер, ассоциированный с повышенной засухоустойчивостью, можно интрогрессировать от донора рекуррентному родителю, не устойчивому к засухе или только частично устойчивому к засухе. Получившееся потомство можно повторно возвратно скрещивать и отбирать до тех пор, пока потомок не приобретет аллель засухоустойчивости на генетическом фоне рекуррентного родителя.

Применяемый здесь термин "изолированный" относится к нуклеотидной последовательности (например, генетический маркер), свободной от последовательностей, которые обычно фланкируют одну или обе стороны нуклеотидной последовательности в растительном геноме. Таким образом, выражение "изолированный и очищенный генетический маркер, ассоциированный с признаком оптимизации водопотребления в Zea mays," может означать, например, молекулу рекомбинантной ДНК, при условии, что одна из последовательностей нуклеиновой кислоты, которая, обычно фланкируя такую рекомбинантную молекулу ДНК во встречающемся в естественных условиях геноме, удалена или отсутствует. Таким образом, изолированные нуклеиновые кислоты включают в себя без ограничения рекомбинантную ДНК, которая существует как отдельная молекула (включая, но не ограничиваясь ими, фрагменты геномной ДНК, продуцируемые ПЦР или обработкой эндонуклеазы рестрикции), без присутствующих фланкирующих последовательностей, а также рекомбинантную ДНК, которая встроена в вектор, автономно реплицирующуюся плазмиду или в геномную ДНК растения как часть гибридной молекулы нуклеиновой кислоты или молекулы нуклеиновой кислоты, полученной слиянием.

Применяемый здесь термин "сцепление" относится к феномену, при котором аллели на одной и той же хромосоме имеют тенденцию передаваться вместе чаще, чем ожидалось при случайной передаче, если их передача была независимой. Таким образом, говорят, что две аллели на одной и той же хромосоме"сцеплены", когда они отделяются друг от друга в следующем поколении в некоторых вариантах выполнения изобретения менее чем в 50% случаев, в некоторых вариантах выполнения изобретения менее чем в 25% случаев, в некоторых вариантах выполнения изобретения менее чем в 20% случаев, в некоторых вариантах выполнения изобретения менее чем в 15% случаев, в некоторых вариантах выполнения изобретения менее чем в 10% случаев, в некоторых вариантах выполнения изобретения менее чем в 9% случаев, в некоторых вариантах выполнения изобретения менее чем в 8% случаев, в некоторых вариантах выполнения изобретения менее чем в 7% случаев, в некоторых вариантах выполнения изобретения менее чем в 6% случаев, в некоторых вариантах выполнения изобретения менее чем в 5% случаев, в некоторых вариантах выполнения изобретения менее чем в 4% случаев, в некоторых вариантах выполнения изобретения менее чем в 3% случаев, в некоторых вариантах выполнения изобретения менее чем в 2% случаев и в некоторых вариантах выполнения изобретения менее чем в 1% случаев.

Таким образом, "сцепление" обычно подразумевает и может также относиться к физической близости на хромосоме. Таким образом, два локуса сцеплены, если они находятся в пределах в некоторых вариантах выполнения изобретения 20 сантиморганид (сМ), в некоторых вариантах выполнения изобретения 15 сМ, в некоторых вариантах выполнения изобретения 12 сМ, в некоторых вариантах выполнения изобретения 10 сМ, в некоторых вариантах выполнения изобретения 9 сМ, в некоторых вариантах выполнения изобретения 8 сМ, в некоторых вариантах выполнения изобретения 7 сМ, в некоторых вариантах выполнения изобретения 6 сМ, в некоторых вариантах выполнения изобретения 5 сМ, в некоторых вариантах выполнения изобретения 4 сМ, в некоторых вариантах выполнения изобретения 3 сМ, в некоторых вариантах выполнения изобретения 2 сМ и в некоторых вариантах выполнения изобретения 1 сМ друг от друга. Аналогично, локус урожайности раскрытого в настоящем документе объекта изобретения сцеплен с маркером (например, генетический маркер), если он находится в некоторых вариантах выполнения изобретения в пределах 20, 15, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 сМ маркера.

Таким образом, термин "сцепление" относится к степени, с которой локус одного маркера ассоциирован с локусом другого маркера или иным локусом (например, локус засухоустойчивости). Взаимоотношение сцепления между молекулярным маркером и фенотипом может быть задано как "вероятность" или "заданная вероятность". Сцепление может быть выражено как желаемый предел или диапазон. Например, в некоторых вариантах выполнения изобретения любой маркер сцеплен (генетически и физически) с любым другим маркером, когда маркеры разделяются менее чем около 50, 40, 30, 25, 20 или 15 единицами карты (или сМ).

В некоторых вариантах выполнения раскрытого в настоящем документе объекта изобретения целесообразно определить пределы диапазона сцепления, например, от около 10 сМ до около 20 сМ, от около 10 сМ до около 30 сМ или около 10 сМ до около 40 сМ. Чем ближе маркер сцеплен со вторым локусом, тем лучше показатель для второго локуса, который становится маркером. Таким образом, "тесно сцепленные локусы", такие как маркерный локус и второй локус, отображают частоту рекомбинации между локусами, равную около 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3% или 2% или менее. В некоторых вариантах выполнения изобретения соответствующие локусы отображают частоту рекомбинации, равную около 1% или менее, например, около 0,75%, 0,5%, 0,25% или менее. Можно также сказать, что два локуса, локализованные в одной хромосоме и на таком расстоянии, что рекомбинация между данными двумя локусами происходит с частотой менее чем около 10% (например, около 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0,75%, 0,5% или 0,25% или менее), являются "проксимальными к" друг другу. Поскольку одна сМ представляет собой расстояние между двумя маркерами, которое показывает частоту рекомбинации, равную 1%, любой маркер является тесно сцепленным (генетически и физически) с любым другим маркером, который находится в непосредственной близости, например, на отдалении около 10 сМ или менее. Два тесно сцепленных маркера на одной и той же хромосоме могут быть размещены на отдалении около 9, 8, 7, 6, 5, 4, 3, 2, 1, 0,75, 0,5 или 0,25 сМ или менее друг от друга.

Применяемый здесь термин "неравновесие по сцеплению" относится к неслучайной сегрегации генетических локусов или признаков (или обоих). В любом случае неравновесие по сцеплению означает, что соответствующие локусы находятся в достаточной физической близости вдоль длины хромосомы, так что они отделяются вместе с более чем случайной (то есть неслучайной) частотой (в случае совместно отделяющихся признаков, локусы, обуславливающие признаки, находятся в достаточной близости друг от друга). Маркеры, которые демонстрируют неравновесие по сцеплению, считаются сцепленными. Сцепленные локусы разделяются совместно более чем в 50% случаев, например, от около 51% до около 100% случаев. Другими словами, два маркера, которые разделяются совместно, имеют частоту рекомбинации, равную менее чем 50% (и, по определению, разделены менее чем 50 сМ на одной и той же хромосоме). Как применяется здесь, сцепление может иметь место между двумя маркерами или же между маркером и фенотипом. Маркерный локус может быть "ассоциирован с" (сцеплен с) признаком, например, засухоустойчивостью. Степень сцепления молекулярного маркера с фенотипическим признаком измеряется, например, как статистическая вероятность совместной сегрегации данного молекулярного маркера с фенотипом.

Неравновесие по сцеплению чаще всего оценивают по величине r2, который рассчитывается по формуле, описываемой Hill and Robertson, Theor. Appl. Genet. 38: 226 (1968). Когда r2 равен 1, между двумя маркерными локусами существует полное неравновесие по сцеплению, означая, что маркеры не были разделены рекомбинацией и имеют ту же частоту аллелей. Значения r2 выше 1/3 показывают достаточно сильное неравновесие по сцеплению, что применимо для картирования. Ardlie et al., Nature Reviews Genetics 3: 299 (2002). Таким образом, аллели находятся в неравновесии по сцеплению, когда значения r2 между попарными маркерными локусами составляют больше чем или равны около 0.33, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9 или 1.0.

Применяемый здесь термин "равновесие по сцеплению" описывает ситуацию, когда два маркера разделяются независимо, то есть распределяются среди потомства случайно. Маркеры, которые показывают равновесие по сцеплению, считаются несцепленными (независимо от того, лежат или не лежат они на одной и той же хромосоме). Таким образом, выражение "неравновесие по сцеплению" определяется как изменение ожидаемой относительной частоты типов гамет в популяции многих индивидов в одном поколении, так что два или более локуса действуют как генетически сцепленные локусы. Если частота в популяции аллеля S равняется x, аллеля s равняется x', аллеля В равняется y и аллеля b равняется y', то ожидаемая частота генотипа SB равняется xy, таковая генотипа Sb равняется xy', таковая генотипа sB равняется x'y и таковая генотипа sb равняется x'y', и любое отклонение от данных частот является примером неравновесия.

Применяемое здесь выражение "группа сцепления" относится ко всем генам или генетическим признакам, которые находятся на одной и той же хромосоме. Те локусы внутри группы сцепления, которые находятся достаточно близко друг к другу, могут проявлять сцепление в генетических скрещиваниях. Так как вероятность кроссовера возрастает с увеличением физического расстояния между локусами на хромосоме, локусы, положения которых внутри группы сцепления удалены далеко друг от друга, могут не показывать заметного сцепление в прямых генетических тестах. Термин "группа сцепления" в основном применяется для обозначения генетических локусов, которые проявляют сцепленное поведение в генетических системах, для которых до сих пор не проведена хромосомная локализация генов. Таким образом, в настоящем контексте термин "группа сцепления" является синонимом хромосомы как физического субъекта, хотя специалист в данной области техники понимает, что группа сцепления также может быть определена как соответствующая области (например, меньшей, чем полная хромосома) данной хромосомы.

"Локус" представляет собой позицию на хромосоме, где находится ген или маркер или аллель. В некоторых вариантах выполнения изобретения локус может заключать в себе один или более нуклеотидов.

Применяемый здесь термин "маис" означает растение Zea mays L. подвида mays, также известное как "кукуруза".

Применяемый здесь термин "кукурузное растение" включает в себя целые кукурузные растения, клетки кукурузных растений, протопласт кукурузных растений, клетку кукурузных растений или культуры тканей кукурузы, из которых можно регенерировать кукурузные растения, каллюсы кукурузных растений и клетки кукурузных растений, которые являются интактными в кукурузных растениях, или части кукурузных растений, такие как семена кукурузы, кукурузные початки, цветы кукурузы, семядоли кукурузы, листья кукурузы, стебли кукурузы, почки кукурузы, корни кукурузы, кончики корней кукурузы и тому подобное.

Применяемые здесь термины "маркер", "генетический маркер" и "молекулярный маркер" применяются взаимозаменяемо для обозначения идентифицируемой позиции на хромосоме, наследование которой могут быть проверено, и/или реагента, который применяется в способах визуализации различий в последовательностях нуклеиновой кислоты, присутствующих в таких идентифицируемых позициях на хромосомах. Таким образом, в некоторых вариантах выполнения изобретения маркер содержит известную или обнаруживаемую последовательность нуклеиновых кислот. Примеры маркеров включают, но не ограничиваются ими, генетические маркеры, белковую композицию, уровни пептидов, уровни белков, масляную композицию, уровни масла, углеводную композицию, уровни углеводов, состав жирных кислот, уровни жирных кислот, аминокислотную композицию, уровни аминокислот, биополимеры, крахмальную композицию, уровни крахмала, ферментируемый крахмал, выход ферментации, эффективность брожения (например, определяемая как усвояемость через 24, 48 и/или 72 часа), выход энергии, вторичные вещества, метаболиты, морфологические характеристики и агрономические характеристики. Как таковой, маркер может содержать нуклеотидную последовательность, которая была ассоциирована с аллелью или аллелями, представляющими интерес, и свидетельствует о присутствии или отсутствии аллели или аллелей, представляющих интерес, в клетке или организме, и/или данная нуклеотидная последовательность является индикатором для реагента, который применяется для визуализации различий в нуклеотидной последовательности в такой идентифицируемой позиции или позициях. Маркер может представлять собой, но не ограничиваясь ими, аллель, ген, гаплотип, полиморфизм длин рестрикционных фрагментов (RFLP), простые повторяющиеся последовательности (SSR), произвольно амплифицированную полиморфную ДНК (RAPD), расщепленные амплифицированные полиморфные последовательности (CAPS) (Rafalski and Tingey, Trends in Genetics 9: 275 (1993)), полиморфизм длины амплифицированного фрагмента (AFLP) (Vos et al., Nucleic Acids Res. 23: 4407 (1995)), однонуклеотидный полиморфизм (SNP) (Brookes, Gene 234: 177 (1993)), амплифицированную область с известной последовательностью (SCAR) (Paran and Michelmore, Theor. Appl. Genet. 85: 985 (1993)), сайт с помеченной последовательностью (STS) (Onozaki et al., Euphytica 138: 255 (2004)), полиморфизм конформации одноцепочечной ДНК (SSCP) (Orita et al., Proc. Natl. Acad. Sci. USA 86: 2766 (1989)), последовательности между простьми повторяющимися последовательностями (ISSR) (Blair et al., Theor. Appl. Genet. 98: 780 (1999)), полиморфные участки, амплифицированные между ретротранспозонами (IRAP), микросателлитные полиморфные участки, амплифицированные между ретротранспозонами (REMAP) (Kalendar et al., Theor. Appl. Genet. 98: 704 (1999)), или продукт расщепления РНК (такой как Lynx tag). Маркер может присутствовать в геномной или экспрессированной нуклеиновых кислотах (например, EST). Термин маркер может также относиться к нуклеиновым кислотам, применяемым в качестве зондов или праймеров (например, пары праймеров) для применения в амплифицировании, гибридизации и/или обнаружении молекул нуклеиновой кислоты в соответствии со способами, хорошо известными в данной области техники. Большое количество молекулярных маркеров кукурузы известно в данной области техники и опубликовано или доступно из различных источников, таких как Интернет-ресурс Maize GDB и Интернет-ресурс Arizona Genomics Institute, в ведении Университета Аризоны.

В некоторых вариантах выполнения изобретения маркер соответствует продукту амплификации, полученному амплифицированием нуклеиновой кислоты Zea mays с одним или более олигонуклеотидами, например, полимеразной цепной реакцией (ПЦР). Применяемая здесь выражение "соответствует продукту амплификации" в контексте маркера относится к маркеру, который имеет нуклеотидную последовательность, которая является тем же самым продуктом амплификации (учитывая мутации, введенные реакцией амплификации, и/или естественные и/или искусственные аллельные различия), что и продукт амплификации, получаемый амплифицированием геномной ДНК Zea mays с определенным набором олигонуклеотидов. В некоторых вариантах выполнения изобретения амплифицирование проводят способом ПЦР, и олигонуклеотиды представляют собой ПЦР-праймеры, которые предназначены для гибридизации противоположных нитей геномной ДНК Zea mays для того, чтобы амплифицировать последовательность геномной ДНК Zea mays, присутствующую между последовательностями, к которым гибридизуются ПЦР-праймеры в геномной ДНК Zea mays. Амплифицированный фрагмент, полученный в результате одного или более циклов амплификации с использованием такого расположения праймеров, является двухцепочечной нуклеиновой кислотой, одна нить которой имеет нуклеотидную последовательность, которая содержит в направлении от 5' к 3' последовательность одного из праймеров, последовательность геномной ДНК Zea mays, расположенную между праймерами, и последовательность, обратно комплементарную второму праймеру. Типично, "прямым" праймером считается праймер, который имеет такую же последовательность, что и подпоследовательность (произвольно назначенной) "верхней" нити двухцепочечной нуклеиновой кислоты, которая должна быть амплифицирована, так что "верхняя" нить амплифицированного фрагмента включает в себя нуклеотидную последовательность, которая в направлении от 5' к 3' эквивалентна последовательности прямого праймера-последовательности, расположенной между прямым и обратным праймерами верхней нити геномного фрагмента-последовательности, обратно комплементарной возвратному праймеру. Таким образом, маркер, который "соответствует" амплифицированному фрагменту, является маркером, который имеет ту же последовательность, что и одна из нитей амплифицированного фрагмента.

Маркеры, соответствующие генетическим полиморфизмам между членами популяции, можно обнаружить способами, хорошо установленными в данной области техники. К ним относятся, например, секвенирование нуклеиновой кислоты, способы гибридизации, способы амплификации (например, способы специфической амплификации последовательности на основе ПЦР), обнаружение полиморфизма длин рестрикционных фрагментов (RFLP), обнаружение маркеров изоферментов, обнаружение полинуклеотидных полиморфизмов аллель-специфической гибридизацией (ASH), обнаружение амплифицированных вариабельных последовательностей генома растений, обнаружение самостоятельной репликации последовательности, обнаружение простых повторяющихся последовательностей (SSR), обнаружение однонуклеотидного полиморфизма (SNP) и/или обнаружение полиморфизма длины амплифицированного фрагмента (AFLP) Хорошо установленные способы известны также для определения меток экспрессированных последовательностей (EST) и маркеров SSR, происходящих из последовательностей EST, и произвольно амплифицированной полиморфной ДНК (RAPD).

"Аллель маркера", также описанная как "аллель маркерного локуса," может относиться к одной из множества полиморфных нуклеотидных последовательностей, найденной в локусе маркера в популяции, которая является полиморфной для маркерного локуса.

Выражение "маркерный анализ", как применяется здесь, относится к способу определения полиморфизма в обнаруженном локусе с применением обнаруженного способа, такого как, но не ограничиваясь ими, измерение по меньшей мере одного фенотипа (такого как цвет семян, содержание масла или визуально обнаруживаемый признак), анализы на основе нуклеиновой кислоты, включая, но не ограничиваясь ими, полиморфизм длины рестрикционных фрагментов (RFLP), однонуклеотидное удлинение, электрофорез, выравнивание последовательности, аллель-специфичная олигонуклеотидная гибридизация (ASO), анализ произвольно амплифицированной полиморфной ДНК (RAPD), технологии на основе микрочипов, анализы TaqMan®, анализ Illumina® GoldenGate® Assay, технологии секвенирования нуклеиновой кислоты, пептидные и/или полипептидные анализы или любой другой способ, который может быть применен для определения полиморфизма в организме в локусе, представляющем интерес.

"Селекция с использованием маркера " (MAS) представляет собой процесс, при котором фенотипы отбираются на основе генотипов маркеров.

"Контр-селекция с помощью маркеров" представляет собой процесс, при котором генотипы маркеров применяются для идентификации растений, которые не будут отобраны, что позволяет удалять их из программы разведения или посадки. Применяемые здесь термины "маркерный локус" и "маркерные локусы" относятся к обнаруженному расположению или расположениям хромосомы в геноме организма, где может быть найден конкретный маркер или маркеры. Маркерный локус может быть применен для отслеживания присутствия второго сцепленного локуса, например, сцепленного локуса, кодирующего или способствующего экспрессии фенотипического признака. Например, маркерный локус может быть применен для мониторинга сегрегации аллелей в локусе, таких как QTL или один ген, которые генетически и физически сцеплены с маркерным локусом.

Применяемые здесь термины "маркерный зонд" и "зонд" относятся к нуклеотидной последовательности или молекуле нуклеиновой кислоты, которая может быть применена для обнаружения присутствия одной или более определенных аллелей в маркерном локусе (например, зонд нуклеиновой кислоты, который является комплементарным всему маркеру или его участку или маркерному локусу через гибридизацию нуклеиновой кислоты). Маркерные зонды, содержащие около 8, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100 или более последовательных нуклеотидов, могут быть применены для гибридизации нуклеиновой кислоты. Кроме того, в некоторых объектах изобретения маркерный зонд относится к зонду любого типа, который способен различить (то есть генотипировать) определенную аллель, которая присутствует в маркерном локусе.

Применяемый здесь термин "молекулярный маркер" может быть применен по отношению к генетическому маркеру, как определено выше, или им кодированному продукту (например, белку), применяемому в качестве «точки отсчета» при идентифицировании сцепленного локуса. Молекулярный маркер может быть производным геномных нуклеотидных последовательностей или экспрессированных нуклеотидных последовательностей (например, из сплайсированной РНК, кДНК и т.д.). Данный термин также относится к нуклеотидным последовательностям, комплементарным маркерным последовательностям или фланкирующим маркерные последовательности, таким как нуклеотидные последовательности, применяемые в качестве зондов и/или праймеров, способных амплифицировать маркерные последовательности. Нуклеотидные последовательности являются "комплементарными", когда они специфично гибридизуются в растворе, например, по правилам спаривания оснований Уотсона и Крика. Некоторые из данных маркеров, описанные здесь, также называют маркерами гибридизации, если они находятся в области INDEL. Это происходит потому, что область инсерции представляет собой, по определению, полиморфизм по отношению к растению без инсерции. Таким образом, маркер нужен только для указания, присутствует ли область INDEL или отсутствует. Любая подходящая технология определения маркеров может быть применена для идентификации такого маркера гибридизации, например, SNP-технология применяется в примерах, приведенных в настоящем документе.

Раскрытый здесь объект изобретения относится в некоторых вариантах выполнения изобретения к маркерам определения присутствия генетических полиморфизмов в кукурузных локусах, описанных здесь. Локусы, которые могут быть проанализированы с помощью композиций и способов раскрытого в настоящем документе объекта изобретения, включают в себя, но не ограничиваются ими, локусы, упомянутые в настоящем документе как "ZmAdh1-s", "ZmBglcn", "ZmCat1", "ZmDhn1", "ZmDhn2", "ZmDr1", "ZmDr2", "ZmDr3", "ZmDr3","ZmDr4", "ZmDr5", "ZmDr6", "ZmDr7", "ZmDr8", "ZmDr9", "ZmDr10", "ZmDr12" "ZmDr16", "ZmDr17", "ZmH2B1", "ZmHsp70", "Zmlga4", "ZmLOC100276591", "ZmMa3", "ZmPK4", "ZmRIC1", "ZmZCN6", "Zpu1", "ZmDrA", "ZmDrB", "ZmDrC", "ZmDrD", "ZmDrE", "ZmDrF", "ZmDrG", "ZmDrH", "ZmDrI", "ZmDrj", "ZmDrk", "ZmDrL" и „ZmDr", названия которых, таким образом, относятся к геномным областям и/или генетическим локусам, которые сцеплены с признаками, ассоциированными с оптимизацией водопотребления, присутствующими на хромосомах Zea mays, и как описано более подробно ниже. Примеры геномных нуклеотидных последовательностей, которые происходят из данных локусов, приведены здесь выше.

Термин "ZmAdh1-1" относится к локусу на хромосоме 1 Zea mays, который кодирует ген алкогольдегидрогеназы 1 (Dennis et al., 1984). Примеры генных продуктов, полученных из локуса ZmAdh1-1, можно найти в номерах доступа GenBank® X04049 и P00333.

Термин "ZmBglcn" относится к локусу на хромосоме 3 Zea mays, который кодирует полипептид 1,3-β-глюканазу кукурузы (Wu et al., 1994). Примеры генных продуктов, полученных из локуса ZmBglcn, можно найти в номерах доступа GenBank® M95407 и AAA74320.

Термин "ZmCat1" относится к локусу на хромосоме 5 Zea mays, который кодирует полипептид каталазу-1 кукурузы (Guan & Scandalios, 1993). Примеры генных продуктов, полученных из локуса ZmCat1, можно найти в номерах доступа GenBank® X60135 и CAA42720.

Термин "ZmDhn1" относится к локусу на хромосоме 6 Zea mays, который кодирует полипептид дегидрин-1 (dhn1) кукурузы (Close et al., 1989). Примеры генных продуктов, полученных из локуса ZmDhnI, можно найти в номерах доступа GenBank® X15290 и CAA33364.

Термин "ZmDhn2" относится к локусу на хромосоме 4 Zea mays, который кодирует полипептид дегидрин-2 (dhn2) кукурузы. Примеры генных продуктов, полученных из локуса ZmDhn2, можно найти в номерах доступа GenBank® L35913 и AA33480.

Термин "ZmDr1" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AY105200.

Термин "ZmDr2" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AF043347.

Термин "ZmDr3" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует нуклеотидам 120,959-121,302 из GenBank® Accession No AC206638.3 и в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AF043347.

Термин "ZmDr4" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AY103545.

Термин "ZmDr5" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AY109606.

Термин "ZmDr6" относится к локусу Zea mays, который кодирует кальмодулин-связывающий белок кукурузы. Примеры генных продуктов, полученных из локуса ZmDr6, можно найти в номерах доступа GenBank® L01497, NM_001158968, AAA33447 и NP_001152440.

Термин "ZmDr7" относится к локусу Zea mays, который кодирует белок транспортер сахарозы кукурузы. Примеры генных продуктов, полученных из локуса ZmDr7, можно найти в номерах доступа GenBank® AB008464, NM_001111370, BAA83501. И NP_001104840.

Термин "ZmDr8" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No EU976286. Термин "ZmDr9" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует нуклеотидам 75,481-76,499 из GenBank® Accession No AC 196196.4.

Термин "ZmDr10" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No DQ245017.

Термин "ZmDr12" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AI770817.

Термин "ZmDr16" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No NM_001156978.

Термин "ZmDrl7" относится к локусу Zea mays, который в некоторых вариантах выполнения изобретения соответствует нуклеотидам 60,463-60,838 из GenBank® Accession No AC231410.4.

Термин "ZmDrA" относится к локусу на хромосоме 7 Zea mays, который кодирует зависящий от напряжения анионный канальный белок. Пример генного продукта, полученного из локуса ZmDrA, можно найти в GenBank® Accession No BT018647.

Термин "ZmDrB" относится к локусу Zea mays, который кодирует белок ксилан-эндогидролазу. Пример генного продукта, полученного из локуса ZmDrB, можно найти в GenBank® Accession No AI691894.

Термин "ZmDrC" относится к локусу Zea mays, который кодирует белок трегалозо-P-синтазу. Пример генного продукта, полученного из локуса ZmDrC, можно найти в GenBank® Accession No AY110270.

Термин "ZmDrD" относится к локусу на хромосоме 5 Zea mays, который кодирует белок ингибитор 2 субтилизина-химотрипсина. Пример генного продукта, полученного из локуса ZmDrD, можно найти в GenBank® Accession No BT066886.

Термин "ZmDrE" относится к локусу на хромосоме 8 Zea mays, который кодирует белок легумин-подобный белок (Cl2-1). Примеры генных продуктов, полученных из локуса ZmDrE, можно найти в ® Accession Nos. NM_001111592 и NP_001105062.

Термин "ZmDrF" относится к локусу на хромосоме 9 Zea mays, который кодирует белок предполагаемую целлюлозосинтазу. Примеры генных продуктов, полученных из локуса ZmDrF, можно найти в номерах доступа GenBank® BT067558 и ACN34455.

Термин "ZmDrG" относится к локусу на хромосоме 5 Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AI691276.

Термин "ZmDrH" относится к локусу на хромосоме 5 Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AI665888.

Термин "ZmDrI" относится к локусу на хромосоме 3 Zea mays, который в некоторых вариантах выполнения изобретения соответствует GenBank® Accession No AI737958.

Термин "ZmDrJ" относится к локусу на хромосоме 5 Zea mays, который кодирует белок фактор репликации ДНК mcm5. Примеры генных продуктов, полученных из локуса ZmDrJ, можно найти в GenBank® Accession No AI666237.

Термин "ZmDrK" относится к локусу Zea mays, который кодирует белок пирофосфатазу, который в некоторых вариантах выполнения изобретения соответствует нуклеотидам 28,345-29,279 из GenBank® Accession No AC191554.3.

Термин "ZmDrL" относится к локусу на хромосоме 9 Zea mays, который кодирует белок, подобный белку позднего эмбрионального развития. Пример генного продукта, полученного из локуса ZmDrL, можно найти в GenBank® Accession No AY105938.

Термин "ZmDrM" относится к локусу на хромосоме Zea mays 7, который кодирует белок гексозный транспортер. Примеры генных продуктов, полученных из локуса ZmDrM, можно найти в номерах доступа GenBank® NM_001154535 и NP_001148007.

Термин "ZmH2B1" относится к локусу на хромосоме 4 Zea mays, который кодирует гистон 2B1 Zea mays. Пример генного продукта, полученного из локуса ZmDr6, можно найти в GenBank® Accession No AI737900.

Термин "ZmHsp70" относится к локусу на хромосоме 1 Zea mays, который кодирует белок теплового шока кукурузы, родственный белку 70 кДа белок 2. Примеры генных продуктов, полученных из локуса ZmDr7, можно найти в номерах доступа GenBank® EU971059, NM_001154726 и NP_001148198.

Термин "Zmlga4" относится к локусу на хромосоме 8 Zea mays, который кодирует белок, связанный с мутацией liguleless4 (lg4). Примеры генных продуктов, полученных из локуса Zmlga4, можно найти в номерах доступа GenBank® AF457121, NM_001111614, ААМ27190 и NP_001105084.

Термин "ZmLOC100276591" относится к локусу, который в некоторых вариантах выполнения изобретения соответствует Номера доступа GenBank® NM_001150343 и NP_001143815.

Термин "ZmMa3" относится к локусу на хромосоме 2 Zea mays, который кодирует кукурузный белок апоптоза ма-3, подобный топоизомеразе. Примеры генных продуктов, полученных из локуса ZmMa3, можно найти в номерах доступа GenBank® NM_001154442 и NP_001147914.

Термин "ZmPK4" относится к локусу на хромосоме 8 Zea mays, который кодирует белок кукурузы протеинкиназу PK4. Примеры генных продуктов, происходящих из локуса ZmPK4, можно найти в номерах доступа GenBank® AF141378, NM_001111470, AAF22219 HNP_001104940.

Термин "ZmRIC1" относится к локусу на хромосоме 8 Zea mays, который кодирует белок кукурузы RIC1, родственный белку ras. Примеры генных продуктов, происходящих из локуса ZmRIC1, можно найти в номерах доступа GenBank® EU952511, NM_001137272, ACG24629 и NP_001130744.

Термин "ZmZCN6" относится к локусу на хромосоме Zea mays 4, который кодирует белок кукурузы ZCN6. Примеры генных продуктов, происходящих из локуса ZmZCN6, можно найти в номерах доступа GenBank® EU241897, NM_001112774, АВХ11008 и NP_001106245.

Термин "Zpu1" относится к локусу на хромосоме Zea mays 2, который кодирует белок фермент zpu1, гидролизующий крахмал по типу пуллуланазы. Примеры генных продуктов, полученных из локуса Zpu1, можно найти в номерах доступа GenBank® AF080567, NM_001111450, AAD11599 и NP_001104920.

Применяемое здесь выражение "нативный признак" относится к любому существующему моногенному или олигогенному признаку в зародышевой плазме некоторых культур. При идентификации через молекулярный(е) маркер(ы) полученная информация может быть использована для улучшения зародышевой плазмы с помощью скрещивания с использованием маркеров ассоциированных с оптимизацией водопотребления признаков, раскрытых в настоящем документе.

"Не встречающийся в природе сорт кукурузы" представляет собой любой сорт кукурузы, который не существует естественно в природе. "Не встречающийся в природе сорт кукурузы" может быть получен любым способом, известным в данной области техники, включая, но не ограничиваясь ими, трансформацию кукурузы или зародышевой плазмы, трансфекцию кукурузы или зародышевой плазмы и скрещивание природного сорта кукурузы с не встречающимся в природе сортом кукурузы. В некоторых вариантах выполнения изобретения "не встречающийся в природе сорт кукурузы" может содержать одну или более гетерологичных нуклеотидных последовательностей. В некоторых вариантах выполнения изобретения "не встречающийся в природе сорт кукурузы" может содержать одну или более не встречающихся в природе копий природной нуклеотидной последовательности (например, посторонние копии гена, который встречается в кукурузе в природных условиях).

Гетерозисная группа "Non-Stiff Stalk" представляет собой крупную гетерозисную группу в регионах выращивания кукурузы северной части США и Канады. Она также может называться гетерозисной группой "Lancaster" или "Lancaster Sure Crop".

Применяемые здесь термины "нуклеотидная последовательность", "полинуклеотид", "последовательность нуклеиновой кислоты", "молекула нуклеиновой кислоты" и "фрагмент нуклеиновой кислоты" относятся к полимеру РНК или ДНК, который является одно- или двухцепочечным, необязательно содержащим синтетические, неприродные и/или измененные нуклеотидные основания. "Нуклеотид" представляет собой мономерную единицу, из которой построены полимеры ДНК или РНК, и состоит из пуринового или пиримидинового основания, пентозы и остатка фосфорной кислоты. Нуклеотиды (обычно встречаемые в форме 5'-монофосфата) называются согласно их однобуквенным обозначениям следующим образом: "А" для аденилата или дезоксиаденилата (для РНК или ДНК, соответственно), "С" для цитидилата или дезоксицитидилата, "G" для гуанилата или дезоксигуанилата, "U" для уридилата, "Т" для дезокситимидилата, "R" для пуринов (А или G), "Y" для пиримидинов (С или Т), "K" для G или Т, "Н" для А или С или Т, "I" для инозина и "N" для любого нуклеотида.

Применяемый здесь термин "идентичность нуклеотидной последовательности" означает присутствие идентичных нуклеотидов в соответствующих позициях двух полинуклеотидов. Полинуклеотиды имеют "идентичные" последовательности, если последовательность нуклеотидов в двух полинуклеотидах является одной и той же при выравнивании для максимального соответствия (например, в окне сравнения). Сравнение последовательности между двумя или более полинуклеотидами обычно выполняется сравнением участков двух последовательностей на протяжении окна сравнения для идентификации и сравнения локальных областей сходства последовательности. Окно сравнения обычно составляет от 20 до 200 последовательных нуклеотидов. "Процент идентичности последовательности" для полинуклеотидов, такой как 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 98, 99 или 100 процентов идентичности последовательности, можно определить сравнением двух оптимально выровненных последовательностей на протяжении окна сравнения, причем участок полинуклеотидной последовательности в окне сравнения может включать в себя добавления или делеции (например, пробелы), по сравнению с референсной последовательностью, для оптимального выравнивания двух последовательностей. Процент рассчитывается: (а) определением числа позиций, в которых идентичное основание нуклеиновой кислоты встречается в обеих последовательностях, (b) делением числа соответствующих позиций на общее количество позиций в окне сравнения и (в) умножением результата на 100. Оптимальное выравнивание последовательностей для сравнения можно проводить с помощью компьютеризированных реализации известных алгоритмов или просмотром. Легко доступными алгоритмами для сравнения последовательностей и множественного выравнивания последовательностей являются, соответственно. Basic Local Alignment Search Tool (BLAST) и ClustalW, доступные в Интернете. Другие подходящие программы включают, но не ограничиваются ими, GAP, BestFit, Plot Similarity и FASTA, которые являются частью пакета GCG Accelrys, доступного от Accelrys, Inc. of San Diego, Калифорния, США. В некоторых вариантах выполнения изобретения процент идентичности последовательности указывает на идентичность последовательности по всей длине одной из сравниваемых последовательностей. В некоторых вариантах выполнения изобретения расчет определения процента идентичности последовательности не включает в расчет любые нуклеотидные позиции, в которых одна из сравниваемых нуклеиновых кислот содержит "N" (то есть когда любой нуклеотид может присутствовать в данной позиции).

Применяемый здесь термин "процент бесплодных растений" (PB) означает процент растений на обнаруженной территории (например, участок) без зерна. Данное понятие обычно выражается в терминах процента растений на участок и может быть рассчитано как:

к о л и ч е с т в о р а с т е н и й н а у ч а с т к е б е з з е р н а о б щ е е к о л и ч е с т в о р а с т е н и й н а у ч а с т к е × 100

Применяемый здесь термин "процент выхода урожайности" (PYREC) отражает влияние аллелей и/или комбинации аллелей на урожайность растения, выращенного в условиях засухи по сравнению с таковой растения, которое является генетически идентичным, за исключением того, что ему не хватает аллели и/или комбинации аллелей. PYREC рассчитывается как:

1 у р о ж а й н о с т ь п р и п о л н о м о р о ш е н и и ( с и н т е р е с у ю щ е й ( и м и ) а л л е л ь ю ( я м и ) ) у р о ж а й н о с т ь в у с л о в и я х з а с у х и ( с и н т е р е с у ю щ е й ( и м и ) а л л е л ь ю ( я м и ) ) у р о ж а й н о с т ь п р и п о л н о м о р о ш е н и и ( б е з и н т е р е с у ю щ е й ( и х ) а л л е л и ( е й ) у р о ж а й н о с т ь в у с л о в и я х з а с у х и ( б е з и н т е р е с у ю щ е й ( и х ) а л л е л и ( е й ) × 100

В качестве примера, а не ограничения, если контрольное растение дает 200 бушелей в условиях полного орошения, но дает только 100 бушелей в условиях засухи, то его процент потери урожая будет рассчитываться, равным 50%. Если иной генетически идентичный гибрид, который содержит представляющую интерес аллель(и), дает 125 бушелей в условиях засухи и 200 бушелей в условиях полного орошения, то процент потери урожая будет рассчитываться, равным 37,5%, и PYREC будет рассчитываться как 25% [1,00-(200-125)/(200-100)×100)].

Применяемое здесь выражение "урожайность зерна - хорошее орошение" относится к урожаю с области с достаточным орошением для предотвращения дефицита воды у растений во время цикла роста. В некоторых вариантах выполнения изобретения данный признак выражается в бушелях с акра.

Применяемое здесь выражение "сокращение урожайности - гибрид" относится к рассчитанному признаку, полученному из исследования урожайности гибрида, выросшего в условиях стресса и без стресса. Для данного гибрида данный признак равен:

у р о ж а й н о с т ь в у с л о в и я х б е з с т р е с с а у р о ж а й н о с т ь в у с л о в и я х с т р е с с а у р о ж а й н о с т ь в у с л о в и я х б е з с т р е с с а × 100.

В некоторых вариантах выполнения изобретения данный признак выражается в процентах бушелей с акра.

Применяемое здесь выражение "сокращение урожайности - инбред" относится к рассчитанному признаку, полученному из исследования урожайности инбреда, выросшего в условиях стресса и без стресса. Для данного инбреда данный признак равен:

у р о ж а й н о с т ь в у с л о в и я х б е з с т р е с с а у р о ж а й н о с т ь в у с л о в и я х с т р е с с а у р о ж а й н о с т ь в у с л о в и я х б е з с т р е с с а × 100.

В некоторых вариантах выполнения изобретения данный признак выражается в процентах бушелей с акра.

Применяемое здесь выражение "интервал времени между пылением и фазой выметывания пестичных столбиков" (ASI) относится к разнице (в некоторых вариантах выполнения изобретения выраженной в днях) между тем, когда растение начинает сбрасывать пыльцу (пыление), и когда у него начинается фаза выметывания пестичных столбиков (женские особи). Данные по пылению и выметыванию пестичных столбиков собираются в расчете на участок, и разница рассчитывается.

Применяемое здесь выражение "процент бесплодных растений" относится к проценту растений на данной территории (участке) без зерна. Оно обычно выражается в терминах процента растений на участке и может быть рассчитано как:

к о л и ч е с т в о р а с т е н и й н а у ч а с т к е б е з з е р н а о б щ е е к о л и ч е с т в о р а с т е н и й н а у ч а с т к е × 100.

Применяемые здесь термины "фенотип", "фенотипический признак" или "признак", относятся к одному или нескольким признакам организма. Фенотип можно наблюдать невооруженным глазом или любым другим способом оценки, известным в данной области техники, например, микроскопия, биохимический анализ или электромеханический анализ. В некоторых случаях фенотип непосредственно контролируется одним геном или генетическим локусом, то есть представляет собой "одногенный признак". В других случаях фенотип является результатом нескольких генов. Следует отметить, что, как он применен здесь, термин "фенотип оптимизации водопотребления" учитывает экологические условия, которые могут повлиять на оптимизацию водопотребления, так что эффект оптимизации водопотребления является реальным и воспроизводимым.

Применяемый здесь термин "растение" может относиться к целому растению, любой его части или к клетке или культуре ткани, полученных из растения. Таким образом, термин "растение" может относиться к любому из: целые растения, компоненты или органы растения (например, листья, стебли, корни и т.д.), ткани растения, семена и/или растительные клетки.

Растительная клетка представляет собой клетку растения, взятую из растения или происходящую через культуру из клетки, взятой из растения. Таким образом, термин "растительная клетка" включает без ограничения клетки в семенах, суспензионных культурах, эмбрионах, меристематических областях, тканях каллюса, листьях, побегах, гаметофитах, спорофитах, пыльце и микроспорах. Выражение "часть растения" относится к части растения, включая отдельные клетки и клеточные ткани, такие как растительные клетки, которые являются интактными в растениях, клеточные скопления и тканевые культуры, из которых растения могут быть регенерированы. Примеры частей растений включают в себя, но не ограничиваются ими, отдельные клетки и ткани из пыльцы, яйцеклеток, листьев, эмбрионов, корней, кончиков корней, пыльников, цветов, плодов, стеблей, побегов и семян, а также черенков, корневищ, протопластов, каллюсов и тому подобное.

Применяемый здесь термин "полиморфизм" означает изменение в нуклеотидной последовательности в локусе, где упомянутое изменение происходит слишком часто, чтобы быть связанным просто со спонтанной мутацией. Полиморфизм должен иметь частоту, составляющую по меньшей мере около 1% в популяции. Полиморфизм может представлять собой однонуклеотидный полиморфизм (SNP) или полиморфизм вставки/делеции, также известный здесь как "indel". Дополнительно, изменение может иметь место в профиле транскрипции или паттерне метилирования. Полиморфный сайт или сайты нуклеотидной последовательности может быть определен сравнением нуклеотидных последовательностей в одном или более локусах в двух или более элементах зародышевой плазмы.

Применяемый здесь термин "популяция" относится к генетически гетерогенной коллекции растений, имеющих общее генетическое происхождение.

Применяемый здесь термин "праймер" относится к олигонуклеотиду, который способен к отжигу с целевой нуклеиновой кислотой (в некоторых вариантах выполнения изобретения специфический отжиг с целевой нуклеиновой кислотой), что позволяет прикрепиться ДНК-полимеразе, тем самым служа точкой инициации синтеза ДНК в условиях, в которых индуцируется синтез продукта удлинения праймера (например, в присутствии нуклеотидов и агента полимеризации, такого как ДНК-полимераза, и при подходящей температуре и рН). В некоторых вариантах выполнения изобретения для амплификации нуклеиновых кислот Zea mays применяют множество праймеров (например, с помощью полимеразной цепной реакции, ПЦР).

Применяемый здесь термин "зонд" относится к нуклеиновой кислоте (например, одноцепочечная нуклеиновая кислота или нить двухцепочечной или более высокого порядка нуклеиновой кислоты или их подпоследовательность), которая может образовывать с помощью водородных связей дуплекс с комплементарной последовательностью в целевой последовательности нуклеиновой кислоты. Типично, зонд имеет достаточную длину, чтобы образовывать со своим комплементом стабильную, имеющую специфичную последовательность дуплексную молекулу, и как таковой может быть использован в некоторых вариантах выполнения изобретения для определения представляющей интерес последовательности, присутствующей в большом количестве нуклеиновых кислот.

Применяемые здесь термины "потомство" и "растение-потомок" относятся к растению, полученному вегетативным или половым размножением от одного или более родительских растений. Растение-потомок может быть получено клонированном или самооопылением одного родительского растения или скрещиванием двух родительских растений. Таким образом, выражение "растение-потомок" означает любое растение, получаемое как потомство в результате растительного или полового размножения от одного или более родительских растений, или его потомков. Например, растение-потомок может быть получено клонированием или самооопылением родительского растения или скрещиванием двух родительских растений и включает в себя селфинги, а также F1 или F2, а также следующие поколения. F1 представляет собой потомство первого поколения, получаемое из родителей, по меньшей мере один из которых применяется в первый раз в качестве донора признака, в то время как потомство второго поколения (F2) или последующих поколений (F3, F4 и тому подобное) являются образцами, полученными из самооопылений, перекрестных скрещиваний, возвратных скрещиваний или других скрещиваний поколений F1, F2 и тому подобное. F1 может, таким образом, быть (и в некоторых вариантах выполнения изобретения является) гибридом, полученным в результате скрещивания между двумя принадлежащим к чистым линиям родителями (например, каждый из родителей, которые принадлежит к чистой линии, является гомозиготным по представляющему интерес признаку или его аллели), тогда как F2 может быть (и в некоторых вариантах выполнения изобретения является) потомком, полученным в результате самооопыления гибридов F1.

Применяемое здесь выражение "локус количественного признака" (QTL; локусы количественных признаков - QTL) относится к генетическому локусу (или локусам), контролирующие в той или иной степени количественный признак, который в некоторых вариантах выполнения изобретения характеризуется непрерывным распределением. В некоторых вариантах выполнения изобретения QTL содержит локус, ассоциированный с оптимизацией водопотребления. Применяемое здесь выражение "локус, ассоциированный с оптимизацией водопотребления" применяется здесь для обозначения хромосомной области, содержащей аллели (например, в виде генов или регуляторных последовательностей), ассоциированные с экспрессией признака, ассоциированного с оптимизацией водопотребления. Таким образом, локус, "ассоциированный с" признаком оптимизации водопотребления, относится к одной или более области, расположенной на одной или более хромосоме, которая включает в себя по меньшей мере один ген, экспрессия которого влияет на оптимизацию водопотребления и/или по меньшей мере одну регуляторную область, которая управляет экспрессией одного или более генов, участвующих в одном или более признаке оптимизации водопотребления. Локусы могут быть определены указанием их генетического расположения в геноме данного растения Zea mays с применением одного или более молекулярных геномных маркеров. Один или более маркеров, в свою очередь, указывают на конкретный локус. Расстояния между локусами обычно измеряют частотой кроссоверов между локусами на одной и той же хромосоме. Чем дальше друг от друга расположены два локуса, тем больше вероятность, что между ними будет происходить кроссовер. С другой стороны, если два локуса находятся близко друг к другу, менее вероятно, что между ними произойдет кроссовер. Как правило, одна сантиморганида (сМ) равна 1% рекомбинации между локусами. Когда QTL может быть идентифицирован несколькими маркерами, генетическое расстояние между крайними маркерами свидетельствует о размере QTL.

Применяемое здесь выражение "рекомбинация" означает обмен фрагментами ДНК между двумя молекулами ДНК или хроматидами парных хромосом ("кроссовер") в пределах области гомологичных или идентичных нуклеотидных последовательностей. "Рекомбинационное событие" понимается здесь как обозначающее мейотический кроссовер.

Применяемый здесь термин "референсная последовательность" относится к определенной нуклеотидной последовательности, применяемой в качестве основы для сравнения нуклеотидных последовательностей. Например, референсную последовательность для маркера получают генотипированием количества строк в представляющем интерес локусе или локусах, выравниванием нуклеотидных последовательностей с помощью программы выравнивания последовательностей и последующим получением консенсусной последовательности из выравнивания. Таким образом, референсная последовательность выявляет полиморфизмы аллелей в локусе. Референсная последовательность может не быть копией фактической последовательности нуклеиновой кислоты из любого определенного организма, однако, данная последовательность применима для проектирования праймеров и зондов для фактических полиморфизмов в локусе или локусах.

Применяемый здесь термин "регенерировать" и его грамматические варианты относится к продукции растения из тканевой культуры.

Применяемые здесь выражения "выбранная аллель", "желаемая аллель" и "аллель, представляющая интерес," применяются взаимозаменяемо для обозначения последовательности нуклеиновой кислоты, которая включает в себя полиморфную аллель, ассоциированную с желаемым признаком. Следует отметить, что "выбранная аллель", "желаемая аллель" и/или "аллель, представляющая интерес," может быть ассоциирована как с увеличением желаемого признака, так и с уменьшением желаемого признака, в зависимости от характера фенотипа, который стремятся получить в интрогрессированном растении.

Применяемое здесь выражение "однонуклеотидный полиморфизм" или "SNP" относится к полиморфизму, который представляет собой различие в одну пару оснований между двумя нуклеотидными последовательностями. Применяемый здесь термин "SNP" также относится к различиям между двумя нуклеотидными последовательностями, которые возникают в результате простых изменений одной последовательности по отношению к другой, происходящих в одном сайте в последовательности. Например, термин "SNP" предназначен для обозначения не только последовательностей, которые отличаются одним нуклеотидом в результате замены в нуклеиновой кислоте одной последовательности по сравнению с другой, но также предназначен для обозначения последовательностей, которые отличаются одним, двумя, тремя или более нуклеотидами в результате делеции 1-го, 2-х, 3-х или более нуклеотидов в одном сайте одной из последовательностей по сравнению с другой. Понятно, что в случае двух последовательностей, которые отличаются друг от друга лишь в силу делеции 1-го, 2-х, 3-х или более нуклеотидов в одном сайте в одной из последовательностей по сравнению с другой, тот же самый сценарий можно рассматривать как добавление 1-го, 2-х, 3-х или более нуклеотидов в одном сайте одной из последовательностей по сравнению с другой, в зависимости от того, какая из двух последовательностей считается референсной последовательностью. Таким образом, считается, что инсерции и/или делеции в одном сайте также охватываются термином "SNP".

Гетерозисная группа "Stiff Stalk" представляет собой крупную гетерозисную группу в регионах выращивания кукурузы северной части США и Канады. Она также может называться гетерозисной группой "Iowa Stiff Stalk Synthetic" или "BSSS".

Применяемое здесь выражение "строгие условия гибридизации" относится к условиям, при которых полинуклеотид гибридизуется со своей целевой последовательностью, как правило, в сложной смеси нуклеиновых кислот, но ни с какими другими последовательностями. Строгие условия зависят от последовательности и могут меняться в различных обстоятельствах.

Более длинные последовательности обычно гибридизуются специфично при более высоких температурах. Обширное руководство по гибридизации нуклеиновых кислот можно найти в Tijssen, 1993. В общем случае строгие условия гибридизации выбирают таким образом, чтобы они были на приблизительно 5-10°С ниже температуры плавления (Тт) специфической последовательности при определенной ионной силе и величине рН. Tm представляет собой температуру (при заданной ионной силе, рН и концентрации нуклеиновой кислоты), при которой 50% зондов, комплементарных целевой последовательности, гибридизуются в равновесных условиях с целевой последовательностью (поскольку при Tm целевые последовательности присутствуют в избытке, то в равновесных условиях заняты 50% зондов). Примером строгих условий являются такие условия, при которых концентрация соли составляет менее чем около 1,0 М ионов натрия, обычно около от 0,01 до 1,0 М ионов натрия (или других солей) при величине рН от 7,0 до 8,3 и температуре по меньшей мере около 30°С для коротких зондов (например, содержащих от 10 до около 50 нуклеотидов) и по меньшей мере около 60°С для длинных зондов (например, содержащих более 50 нуклеотидов).

Строгие условия могут быть также обеспечены добавлением дестабилизующих агентов, таких как формамид. Дополнительный пример строгих условий гибридизации включает в себя инкубацию в буфере, содержащем 50% формамида, 5×SSC и 1% SDS при 42°С, или SSC, 1% SDS, с инкубацией при 65°С, с одной или более промывкой смесью 0,2×SSC и 0,1% SDS при 65°С. В случае ПЦР температура около 36°С является типичной для амплификации в условиях низкой строгости, хотя температуры отжига могут варьировать в пределах между около 32°С и 48°С (или выше), в зависимости от длины праймера. Дополнительные инструкции для определения параметров гибридизации представлены в многочисленных ссылках (см., например, Ausubel et al., 1999).

Применяемое здесь выражение "анализ TaqMan®" относится к обнаружению последовательности в режиме реального времени с помощью ПЦР, основанном на наборе для анализа TaqMan®, продаваемом Applied Biosystems, Inc. of Foster City Калифорния, США. Для идентифицируемого маркера анализ TaqMan® может быть отлажен для применения в программе разведения.

Применяемый здесь термин "тестер" относится к линии, используемой в испытательном скрещивании с одной или более другими линиями, причем испытываемые тестер и линия(и) являются генетически разнородными. Тестер может быть изогенной линией к скрещенной линии.

Применяемый здесь термин "признак" относится к представляющему интерес фенотипу, гену, который вносит свой вклад в фенотип, представляющий интерес, а также последовательности нуклеиновых кислот, ассоциированной с геном, который вносит свой вклад в фенотип, представляющий интерес. Например, "признак оптимизации водопотребления" относится к фенотипу оптимизации водопотребления, а также к гену, который вносит свой вклад в фенотип оптимизации водопотребления и к последовательности нуклеиновых кислот (например, SNP или другой маркер), которая является ассоциированной с фенотипом оптимизации водопотребления.

Применяемый здесь термин "трансген" относится к молекуле нуклеиновой кислоты, вводимой в организм или его предкам той или иной формой способа искусственного переноса. Способ искусственного переноса создает, таким образом, "трансгенный организм" или "трансгенную клетку". Понятно, что способ искусственного переноса может осуществляться в организме предка (или в клетке в нем и/или в клетке, которая может развиться в организм предка), и, тем не менее, любой индивид-потомок, который имеет искусственно перенесенную молекулу нуклеиновой кислоты или ее фрагмент, по-прежнему считается трансгенным, даже если присутствие искусственно перенесенной молекуле нуклеиновой кислоты в индивиде-потомке является результатом одно или более природных и/или принудительных разведений.

"Неблагоприятная аллель" маркера представляет собой аллель маркера, которая сегрегирует с неблагоприятным фенотипом растения, тем самым давая возможность выявления растений, которые могут быть удалены из программы разведения или посадки. Применяемый здесь термин "оптимизация водопотребления" означает любую параметр растения, его частей или его структуры, который можно измерить и/или оценить количественно с тем, чтобы оценить степень и скорость роста и развития растений в условиях достаточного присутствия воды по сравнению с условиями неоптимального присутствия воды (например, засуха). Как таковой, "признак оптимизации водопотребления" представляет собой любой признак, который, как можно показать, влияет на урожайность растения при различных сочетаниях условий выращивания, связанных с доступностью воды.

Аналогичным образом, "оптимизация водопотребления" может рассматриваться как "фенотип", который, как он используется здесь, относится к обнаруживаемой, наблюдаемой и/или измеримой характерной черте клетки или организма. В некоторых вариантах выполнения изобретения фенотип основан, по меньшей мере, частично на генетическом составе клетки или организма (далее по тексту "генотип" клетки или организма). Примеры фенотипов оптимизации водопотребления представляют собой урожайность зерна при стандартном проценте влажности (YGSMN), влажность зерна в период сбора урожая (GMSTP), вес зерна на участок (GWTPN), процент выхода урожайности (PYREC). Следует отметить, что, как он используется здесь, термин "фенотип" принимает во внимание, как окружающая среда (например, условия окружающей среды) может повлиять на оптимизацию водопотребления, так что эффект оптимизации водопотребления является реальным и воспроизводимым. Применяемый здесь термин "сокращение урожайности" (YD) относится к степени, до которой урожайность снижается в растениях, выращенных в условиях стресса. YD рассчитывается по формуле:

у р о ж а й н о с т ь в у с л о в и я х б е з с т р е с с а у р о ж а й н о с т ь в у с л о в и я х с т р е с с а у р о ж а й н о с т ь в у с л о в и я х б е з с т р е с с а × 100

II. Молекулярные маркеры, локусы, ассоциированные с оптимизацией водопотребления, и композиции для анализирующих последовательностей нуклеиновой кислоты

Молекулярные маркеры применяются для визуализации различий в последовательностях нуклеиновых кислот. Данная визуализация может быть обусловлена методиками гибридизации ДНК-ДНК после расщепления рестрикционным ферментом (например, RFLP) и/или обусловлена методиками с применением полимеразной цепной реакции (например, STS, SSR/микросателлиты, AFLP и тому подобное). В некоторых вариантах выполнения изобретения все различия между двумя родительскими генотипами разделяются в картируемой популяции на основании скрещивания данных родительских генотипов. Можно сравнить сегрегацию различных маркеров, и можно вычислить частоты рекомбинации. Способы картирования маркеров растений описаны, например, в Glick & Thompson, 1993; Zietkiewicz et al., 1994. Частоты рекомбинации молекулярных маркеров на разных хромосомах составляют обычно 50%. Частота рекомбинации между молекулярный маркерами, расположенными на одной хромосоме, в целом зависит от расстояния между маркерами. Низкая частота рекомбинации обычно соответствует небольшому генетическому расстоянию между маркерами на хромосоме. Сравнение всех частот рекомбинации позволяет определить наиболее логичный порядок молекулярных маркеров на хромосомах. Данный наиболее логичный порядок можно изобразить на карте сцепления (Paterson, 1996). Группа соседних или последовательных маркеров на карте сцепления, которая ассоциирована с улучшенной оптимизацией водопотребления, может указывать на позицию MTL, ассоциированного с улучшенной оптимизацией водопотребления. Генетические локусы, коррелирующие с определенными фенотипами, такими, как засухоустойчивость, могут быть картированы в геноме организма. Идентифицируя маркер или кластер маркеров, которые сегрегируют совместно с признаком, представляющим интерес, селекционер может быстро выбрать желаемый фенотип селекцией правильного маркера (данный процесс называется селекция с использованием маркера или MAS). Такие маркеры могут также применяться селекционерами для разработки генотипов in silico и для практической селекции целого генома.

Раскрытый в настоящем документе объект изобретения относится в некоторых вариантах выполнения изобретения к маркерам, ассоциированным с повышенной засухоустойчивостью/оптимизацией водопотребления. Обнаружение данных маркеров и/или других сцепленных маркеров может быть применено для идентификации, селекции и/или получения засухоустойчивых растений и/или удаления растений, которые не являются засухоустойчивыми, из программ разведения или посадки.

Раскрытый в настоящем документе объект изобретения относится к маркерам, ассоциированным с улучшенными признаками оптимизации водопотребления. Маркер раскрытого в настоящем документе объекта изобретения может содержать одну аллель или комбинацию аллелей в одном или более генетических локусах. В некоторых вариантах выполнения изобретения одна или более аллелей характеризуется одним или более локусами, выбранными из, но не ограничиваясь ими, локусов, представленных последовательностями SEQ ID NO: 1-117, 400 и 401, которые расположены в геноме Zea mays следующим образом:

(I) SEQ ID NO: 1 происходит от локуса Zea mays Zmlga4 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 1, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 118, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 119; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются однонуклеотидным полиморфизмом в нуклеотидных позициях 115, 270, 301 и 483, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 1 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(II) SEQ ID NO: 2 происходит от локуса оптимизации водопотребления и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 2, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 120, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 121; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются однонуклеотидным полиморфизмом в нуклеотидных позициях 100 и 264-271, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 2 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(III) SEQ ID NO: 3 происходит от локуса Zea mays ZmDr1 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 2, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 122, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 123; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются однонуклеотидным полиморфизмом в нуклеотидной позиции 216 SEQ ID NO: 3, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 3 в геноме Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(IV) SEQ ID NO: 4 происходит от локуса Zea mays ZmDrA и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 4 полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 124, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 125; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются однонуклеотидным полиморфизмом в нуклеотидной позиции 503 последовательности SEQ ID NO: 4, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 4 на хромосоме 7 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(V) SEQ ID NO: 5 происходит от локуса Zea mays ZmDr2 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 4, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 126, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 127; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидных позициях 818-821 последовательности SEQ ID NO: 5, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 5 на хромосоме 2 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(VI) SEQ ID NO: 6 происходит от локуса Zea mays ZmDr3 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 6, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 128, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 129; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 254 последовательности SEQ ID NO: 6, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 6 на хромосоме 2 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(VII) SEQ ID NO: 7 происходит от локуса Zea mays ZmDr4 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 7, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 130, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 131; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидных позициях 4497-4498, 4505, 4609, 4641, 4792, 4836, 4844, 4969 и 4979-4981 последовательности SEQ ID NO: 7, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 7 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(VIII) SEQ ID NO: 8 происходит от локуса Zea mays ZmMa3 и определяется первьм олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 8, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 132, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 133; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмами в нуклеотидных позициях 217, 390 и 477 последовательности SEQ ID NO: 8, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 8 на хромосоме 2 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(IX) SEQ ID NO: 9 происходит из генома Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 9, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 134, и вторьм олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 135; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 292 последовательности SEQ ID NO: 9, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 9 на хромосоме 4 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(X) SEQ ID NO: 10 происходит от локуса Zea mays ZmBglcn и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 10, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 136, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 137; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 166 последовательности SEQ ID NO: 10, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 10 на хромосоме 3 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XI) SEQ ID NO: 11 происходит от локуса Zea mays ZmLOC 100276591 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 11, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 138, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 139; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 148 последовательности SEQ ID NO: 11, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 11 в геноме Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XII) SEQ ID NO: 12 происходит от локуса Zea mays ZmDr7 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 12, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 140, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 141; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидных позициях 94 последовательности SEQ ID NO: 12, и содержит любую часть последовательности ДНК в пределах 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 12 на хромосоме 1 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XIII) SEQ ID NO: 13 происходит от локуса Zea mays ZmDr7 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 13, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 140, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 141; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 35, 86 и/или 89 последовательности SEQ ID NO: 13, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 13 на хромосоме 1 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XIV) SEQ ID NO: 14 происходит от локуса Zea mays ZmDr8 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 14, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 142, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 143; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 432 последовательности SEQ ID NO: 14, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 14 в геноме Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XV) SEQ ID NO: 15 происходит от локуса Zea mays ZmHsp70 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 15, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 144, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 145; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 753 последовательности SEQ ID NO: 15, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 15 на хромосоме 1 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XVI) SEQ ID NO: 16 происходит от локуса Zea mays ZmDr9 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 16, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 146, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 147; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 755 последовательности SEQ ID NO: 16, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 16 на хромосоме 4 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XVII) SEQ ID NO: 17 происходит от локуса Zea mays ZmDrB и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 17, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 148, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 149; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 431 последовательности SEQ ID NO: 17, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 17 в геноме Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XVIII) SEQ ID NO: 18 происходит от локуса Zea mays ZmAdh1-1 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 18, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 150, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 151; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 518 последовательности SEQ ID NO: 18, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 18 на хромосоме 1 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XIX) SEQ ID NO: 19 происходит от локуса Zea mays ZmDr10 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 19, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 152, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 153; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 182, 309, 330 и 463 последовательности SEQ ID NO: 19, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 19, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XX) SEQ ID NO: 20 происходит от локуса Zea mays ZmDrC и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 20, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 154, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 155; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидных позициях 773-776 последовательности SEQ ID NO: 20, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 20 в геноме Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXI) SEQ ID NO: 21 происходит от локуса Zea mays ZmDr5 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 21, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 156, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 157; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 61, 200 и 316-324 последовательности SEQ ID NO: 21, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 21 на хромосоме 5 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXII) SEQ ID NO: 22 происходит от локуса Zea mays ZmDrD и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 22, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 158, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID N0: 159; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 211 последовательности SEQ ID NO: 22, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 22 на хромосоме 5 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXIII) SEQ ID NO: 23, происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 23, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 160, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 161; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 116 и 217 последовательности SEQ ID NO: 21, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 23 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXIV) SEQ ID NO: 24, происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 24, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 162, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 163; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 746 последовательности SEQ ID NO: 24, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 24 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXV) SEQ ID NO: 25 происходит от локуса Zea mays ZmDr12 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 25, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 164, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 165; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 562 последовательности SEQ ID NO: 25, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 25 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXVI) SEQ ID NO: 26, происходит от локуса оптимизации недопотребления Zea mays и определяется первым олигонуклеотидом и вторьм олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 26, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 166, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 167; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 1271 последовательности SEQ ID NO: 26, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 26 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXVII) SEQ ID NO: 27 происходит от локуса Zea mays ZmDrE и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 27, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 168, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 169; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 64 и/или 254 последовательности SEQ ID NO: 27, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 27 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXVIII) SEQ ID NO: 28 происходит от локуса Zea mays ZmDrF и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 28, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 170, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 171; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидных позициях 98, 147, 224 и/или 496 последовательности SEQ ID NO: 28, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 28 на хромосоме 9 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXIX) SEQ ID NO: 29, происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 29, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 172, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 173; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 258 последовательности SEQ ID NO: 29, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 29 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXX) SEQ ID NO: 30 происходит от локуса Zea mays ZmDhn2 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 30, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 174, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 175; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 259, 296, 398 и/или 1057 последовательности SEQ ID NO: 30, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 30 на хромосоме 4 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXI) SEQ ID NO: 31 происходит от локуса Zea mays ZmDr16 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 31, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 176, и вторьм олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 177; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 239 последовательности SEQ ID NO: 31, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 31 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXII) SEQ ID NO: 32 происходит от локуса Zea mays ZmDr17 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 32, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 178, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 179; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидной позиции 208 последовательности SEQ ID NO: 32, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 32 в геноме Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXIII) SEQ ID NO: 33 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 33, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 180, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 181; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 391 последовательности SEQ ID NO: 33, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 33 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXIV) SEQ ID NO: 34 происходит от локуса Zea mays ZmZCN6 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 34, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 182, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 183; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидных позициях 144-145, 169 и/или 537 последовательности SEQ ID NO: 34, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 34 на хромосоме 4 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXV) SEQ ID NO: 35 происходит от локуса Zea mays ZmDrG и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 35, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 184, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 185; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 76 последовательности SEQ ID NO: 35, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 35 на хромосоме 5 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXVI) SEQ ID NO: 36 происходит от локуса Zea mays ZmDhn1 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 36, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 186, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 187; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 500, 568 и/или 698 последовательности SEQ ID NO: 36, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 36 на хромосоме 6 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXVII) SEQ ID NO: 37 происходит от локуса Zea mays ZmDrH и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 37, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 188, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 189; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 375 и/или 386 последовательности SEQ ID NO: 37, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 37 на хромосоме 5 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXVIII) SEQ ID NO: 38 происходит от локуса Zea mays ZmDrI и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 38, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 190, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 191; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 309 и/или 342 последовательности SEQ ID NO: 38, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 38 на хромосоме 3 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XXXIX) SEQ ID NO: 39 происходит от локуса Zea mays ZmDrJ и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 39, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 192, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 193; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 445 последовательности SEQ ID NO: 39, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 39 на хромосоме 5 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XL) SEQ ID NO: 40 происходит от локуса Zea mays ZmH2B1 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 40, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 194, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 195; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 602 последовательности SEQ ID NO: 40, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 40 на хромосоме 4 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLI) SEQ ID NO: 41 происходит от локуса Zea mays ZmDr3 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 41, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 196, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 198; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 190 и/или 580 последовательности SEQ ID NO: 41, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 41 на хромосоме 2 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLII) SEQ ID NO: 42 происходит от локуса Zea mays ZmDrK. и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 42, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 198, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 199; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидных позициях 238, 266-267 и 808 последовательности SEQ ID NO: 42, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 42 в геноме Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLIII) SEQ ID NO: 43 происходит от локуса Zea mays ZmCat1 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 43, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 200, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 201; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 708 последовательности SEQ ID NO: 43, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 43 на хромосоме 5 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLIV) SEQ ID NO: 44 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 44, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 202, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 203; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 266 последовательности SEQ ID NO: 44, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 44 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLV) SEQ ID NO: 45 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 45, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 202, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 203; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 475 последовательности SEQ ID NO: 45, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 45 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLVI) SEQ ID NO: 46 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 46, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 204, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 205, и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 386 последовательности SEQ ID NO: 46, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 46 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLVII) SEQ ID NO: 47 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 47, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 206, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 207; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 87 последовательности SEQ ID NO: 47, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 47 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLVIII) SEQ ID NO: 48 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 48, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 208, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 209; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 472 последовательности SEQ ID NO: 48, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 48 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(XLIX) SEQ ID NO: 49 происходит от локуса Zea mays ZmRIC1 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 49, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 210, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 211; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 166, 224, 650 и/или 892 последовательности SEQ ID NO: 49, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 49 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(L) SEQ ID NO: 50 происходит от локуса Zea mays ZmPK4 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 50, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 212, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 213; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 541 последовательности SEQ ID NO: 50, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 50 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LI) SEQ ID NO: 51 происходит от локуса Zea mays ZmPK4 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 51, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 212, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 213; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 111 последовательности SEQ ID NO: 51, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 51 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LII) SEQ ID NO: 52 происходит от локуса Zea mays Zpu1 и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 52, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 214, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 215; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 442 последовательности SEQ ID NO: 52, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 52 на хромосоме 2 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LIII) SEQ ID NO: 53 происходит от локуса Zea mays ZmDrL и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 53, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 216, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 217; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 83, 428, 491 и/или 548 последовательности SEQ ID NO: 53, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 53 на хромосоме 9 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LIV) SEQ ID NO: 54 происходит от локуса Zea mays ZmDrM и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 54, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 218, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 219; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 126 последовательности SEQ ID NO: 54, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 54 на хромосоме 7 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LV) SEQ ID NO: 55 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 55, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 220, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 221; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 193 последовательности SEQ ID NO: 55, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 55 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LVI) SEQ ID NO: 56 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 56, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 222, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 223; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются одним или более полиморфизмами в нуклеотидных позициях 237 и/или 516 последовательности SEQ ID NO: 56, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 56 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LVII) SEQ ID NO: 57 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 57, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 224, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 225; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 173 последовательности SEQ ID NO: 57, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 57 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LVIII) SEQ ID NO: 58 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 58, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 226, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 227; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 486 последовательности SEQ ID NO: 58, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 58 на хромосоме 8 Zea mays, что дает улучшенный признак, ассоциированный с оптимизацией водопотребления;

(LIX) SEQ ID NO: 59 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 59, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 228, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 229; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 729 последовательности SEQ ID NO: 59, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 59 на хромосоме 8 Zea mays, что дает улучшение оптимизации водопотребления ассоциированных признаки; и

(LX) SEQ ID NO: 60 происходит от локуса оптимизации водопотребления Zea mays и определяется первым олигонуклеотидом и вторым олигонуклеотидом, причем упомянутые олигонуклеотиды могут быть использованы для того, чтобы амплифицировать подпоследовательность последовательности SEQ ID NO: 60, полученную амплификацией нуклеиновой кислоты Zea mays с первым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 230, и вторым олигонуклеотидом, содержащим нуклеотидную последовательность, как указано последовательности SEQ ID NO: 231; и причем дополнительно данный локус содержит аллели признака, ассоциированного с оптимизацией водопотребления, причем данные аллели характеризуются полиморфизмом в нуклеотидной позиции 267 последовательности SEQ ID NO: 60, и содержит любую часть последовательности ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности SEQ ID NO: 60 на хромосоме 8 Zea mays, что дает улучшение оптимизации водопотребления ассоциированных признаки; и

в некоторых вариантах выполнения изобретения последовательность ДНК в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или 25 сМ последовательности маркера раскрытого в настоящем документе объекта изобретения отображает частоту генетической рекомбинации, равную менее чем около 25%, 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% или 1%, с маркером раскрытого в настоящем документе объекта изобретения. В некоторых вариантах выполнения изобретения зародышевая плазма представляет собой линию или сорт Zea mays.

Фрагменты ДНК, ассоциированные с присутствием признака, аллелей и/или гаплотипов, ассоциированных с оптимизацией водопотребления, включая, но не ограничиваясь ими, последовательности SEQ ID NO: 1-117, 400 и 401, также относятся к настоящему изобретению. В некоторых вариантах выполнения изобретения фрагменты ДНК, ассоциированные с присутствием признака, ассоциированного с оптимизацией водопотребления, имеют предсказанную длину и/или последовательность нуклеиновой кислоты, и обнаружение фрагмента ДНК с предсказанной длиной и/или предсказанной последовательностью нуклеиновой кислоты осуществляется таким образом, что амплифицированный фрагмент ДНК имеет длину, которая соответствует (плюс или минус несколько оснований, например, длина, составляющая более или менее одно, два или три основания) предсказанной длине. В некоторых вариантах выполнения изобретения фрагмент ДНК представляет собой амплифицированный фрагмент, и амплифицированный фрагмент имеет такую же предсказанную длину и/или последовательность нуклеиновой кислоты, что и амплифицированный фрагмент, полученный аналогичной реакцией с теми же праймерами ДНК из растения, в котором был впервые обнаружен маркер или последовательность нуклеиновой кислоты, которая соответствует (то есть как идентичность нуклеотидной последовательности, составляющая более чем 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) ожидаемой последовательности на основе последовательности маркера, ассоциированного с тем ассоциированным с оптимизацией водопотребления признаком в растении, в котором маркер был впервые обнаружен. При рассмотрении настоящего раскрытия специалисту в данной области техники будет понятно, что маркеры, которые отсутствуют в растениях, в то время как они были представлены по меньшей мере в одном родительском растении (так называемые трансмаркеры), также могут быть применимы в анализах на обнаружение желаемого признака в растении-потомке, хотя тестирование на отсутствие маркера для обнаружения присутствия специфического признака не является оптимальным. Обнаружение амплифицированного фрагмента ДНК с предсказанной длиной или предсказанной последовательностью нуклеиновой кислоты может быть выполнено любым из множества способов, включая, но не ограничиваясь ими, стандартные способы гель-электрофореза и/или с помощью автоматизированных секвенаторов ДНК. Данные способы здесь не описаны подробно, поскольку они хорошо известны специалистам.

Праймер (в некоторых вариантах выполнения изобретения праймер удлинения и в некоторых вариантах выполнения изобретения праймер амплификации) является в некоторых вариантах выполнения изобретения одноцепочечным для достижения максимальной эффективности в удлинении и/или амплификации. В некоторых вариантах выполнения изобретения праймер представляет собой олигодезоксирибонуклеотид. Праймер бывает обычно достаточно длинным, чтобы начать синтез удлинения и/или продуктов амплификации в присутствии агента полимеризации. Минимальные длины праймеров могут зависеть от многих факторов, включая, но не ограничиваясь ими, температуру и композицию (содержание А/Т по сравнению с G/C) праймера.

В связи с амплификационным праймером, данные праймеры обычно предоставляется в виде одного или более наборов двунаправленных праймеров, которые включают в себя один или более прямых и один или более обратных праймеров, широко применяемых в области техники амплификации ДНК, таких как ПЦР-амплификация. Таким образом, следует понимать, что термин "праймер", применяемый здесь, может относиться к более чем одному праймеру, особенно в том случае, когда существует некоторая неопределенность в информации касательно терминальной(ых) последовательности(ей) целевой области, которую надо амплифицировать. Таким образом, "праймер" может включать в себя коллекцию праймерных олигонуклеотидов, содержащих последовательности, представляющие возможные изменения в последовательности, или включает в себя нуклеотиды, которые позволяют типичное спаривание оснований. Праймеры могут быть получены любым подходящим способом. Способы получения олигонуклеотидов конкретной последовательности известны в области техники и включают в себя, например, клонирование и рестрикцию соответствующих последовательностей и прямой химический синтез. Способы химического синтеза могут включать в себя, например, фосфоди- или три-эфирный способ, диэтилфосфоамидатный способ и способ на твердом носителе, раскрытый в патенте США №4458068.

Праймеры могут быть помечены, если желательно, включением обнаруживаемых фрагментов, например, спектроскопическими, флуоресцентными, фотохимическими, биохимическими, иммунохимическими или химическими остатками.

Матрица-зависимое удлинение олигонуклеотидного праймера катализируется полимеризующим агентом в присутствии достаточных количеств четырех дезоксирибонуклеотид-трифосфатов (дАТФ, дГТФ, дЦТФ и дТТФ, то есть дНТФ) или их аналогов в реакционной среде, которая содержит соответствующие соли, катионы металлов и pH-буферную систему. Подходящими полимеризующими агентами служат ферменты, о которых известно, что они катализируют праймер- и матрицезависимый синтез ДНК. К известным ДНК-полимеразам относятся, например, ДНК-полимераза Е. coli или ее фрагмент Кленова, T4 ДНК-полимераза и Taq ДНК-полимераза, а также их различные модификации. Условия реакции катализирования синтеза ДНК такими ДНК-полимеразами известны в данной области техники. Продукты синтеза представляют собой дуплексные молекулы, состоящие из нитей матрицы и нитей удлинения праймера, которые включают в себя искомую последовательность. Данные продукты, в свою очередь, могут служить в качестве матрицы для очередного цикла репликации. Во втором цикле репликации нить удлинения праймера первого цикла отжигают с комплементарным праймером; синтез дает "короткий" продукт, который связан как на 5'-, так и на 3'-концах праймерными последовательностями или им комплементарными последовательностями. Повторные циклы денатурации, отжиг праймера и удлинение могут привести к экспоненциальному накоплению целевой области, определяемой праймерами. Для достижения желаемого количества полинуклеотида, содержащего целевую область нуклеиновой кислоты, выполняют достаточное количество циклов. Желаемое количество может варьировать и определяется функцией, которой служит произведенный полинуклеотид.

Способ ПЦР хорошо описан в справочниках и известен специалистам. После амплификации с помощью ПЦР целевые полинуклеотиды могут быть обнаружены гибридизацией с зондом-полинуклеотидом, который образует стабильный гибрид с такой целевой последовательностью в условиях жесткой и умеренно жесткой гибридизации и промывки. Если ожидается, что зонды будут практически полностью комплементарными (то есть около 99% или больше) целевой последовательности, то могут быть применены жесткие условия. Если ожидаются некоторые несовпадения, например, если ожидаются вариантные штаммы, в результате чего зонд не будет полностью комплементарным, то строгость гибридизации может быть уменьшена. В некоторых вариантах выполнения изобретения выбирают условия, чтобы исключить неспецифическое/случайное связывание. Условия, которые влияют на гибридизацию и которые предотвращают неспецифическое связывание, известны в данной области техники и описаны, например, в Sambrook & Russell, 2001. Как правило, более низкая концентрация соли и высокая температура увеличивают строгость условий гибридизации.

Для того чтобы определить присутствие двух аллелей, ассоциированных с оптимизацией водопотребления, на одной хромосоме в растении, могут быть также применены способы «росписи» хромосом. При использовании таких способов по меньшей мере первая аллель, ассоциированная с оптимизацией водопотребления, и по меньшей мере вторая аллель, ассоциированная с оптимизацией водопотребления, могут быть обнаружены в одной хромосоме гибридизацией in situ или способами ПЦР in situ. Более удобно факт присутствия двух аллелей, ассоциированные с оптимизацией водопотребления, на одной хромосоме подтверждать определением степени их сцепления: то есть что данные признаки показывают пониженную сегрегацию при сравнении с генами, находящимися на отдельных хромосомах.

Идентифицированные в данном документе аллели, ассоциированные с оптимизацией водопотребления, расположены на множестве различных хромосом или в группах сцепления, и их расположения могут быть охарактеризованы рядом в других отношениях независимых маркеров. В настоящих исследованиях были применены однонуклеотидные полиморфизмы (SNP), хотя могли быть также применены и действительно могут быть применены маркеры на основе полиморфизма длин рестрикционных фрагментов (RFLP), маркеры на основе полиморфизма длины амплифицированного фрагмента (AFLP), микросателлитные маркеры (например, SSR), маркеры введения мутаций, маркеры на основе амплифицированной области с известной последовательностью (SCAR), маркеры на основе расщепленных амплифицированных полиморфных последовательностей (CAPS), маркеры-изоферменты, технологии на основе микрочипов, анализы TaqMan®, анализ Illumina® GoldenGate® Assay, технологии секвенирования нуклеиновой кислоты или комбинации данных маркеров.

В общем случае, предоставление информации о полной последовательности ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа не является необходимым, так как путь, использованный для первого обнаружения ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа - позволяет отследить среди популяции потомков-растений те растения, которые имеют генетический потенциал для демонстрирования определенного фенотипического признака. Предлагая неограничивающий список маркеров, раскрытый в настоящем документе объект изобретения, таким образом, относится к эффективному применению раскрытых здесь ассоциированных с оптимизацией водопотребления аллелей и/или гаплотипов в программах разведения. В некоторых вариантах выполнения изобретения маркер является специфическим для определенной линии потомства. Таким образом, конкретный признак может быть ассоциирован с определенным маркером.

Маркеры, как раскрыто здесь, не только указывают расположение аллелей, ассоциированных с оптимизацией водопотребления, они также коррелируют с присутствием конкретного фенотипического признака в растении. Следует отметить, что однонуклеотидные полиморфизмы, которые указывают, где в геноме присутствует аллель, ассоциированная с оптимизацией водопотребления, не являются ограничением. В целом, расположение аллели, ассоциированной с оптимизацией водопотребления, указывается набором однонуклеотидных полиморфизмов, которые демонстрируют статистическую корреляцию с фенотипическим признаком. После того, как за пределами однонуклеотидного полиморфизма найден маркер (то есть маркер, который имеет LOD-балл ниже определенного порога, указывая, что данный маркер находится так далеко, что рекомбинация в области между таким маркером и аллелью, ассоциированной с оптимизацией водопотребления, встречается настолько часто, что присутствие маркера не коррелирует статистически значимым образом с присутствием фенотипа), границы аллели, ассоциированной с оптимизацией водопотребления, можно считать установленными. Таким образом, также возможно указать расположение ассоциированной с оптимизацией водопотребления аллели используя другие маркеры, которые расположены внутри такой указанной области. Дополнительно следует отметить, что однонуклеотидный полиморфизм также может быть применен для индикации присутствия ассоциированной с оптимизацией водопотребления аллели (и, следовательно, фенотипа) в отдельном растении, что в некоторых вариантах выполнения изобретения означает, что он может быть применен в процедурах селекции с использованием маркера (MAS).

В принципе, число потенциально применимых маркеров может быть очень большим. Любой маркер, сцепленный с аллелью, ассоциированной с оптимизацией водопотребления, (например, попадающий внутри физических границ геномной области между маркерами, имеющими установленные LOD-баллы выше определенного порога, тем самым показывая, что рекомбинация между маркером и ассоциированной с оптимизацией водопотребления аллелью не проявляется или проявляется очень мало в скрещиваниях, а также любой маркер, неравновесно сцепленный с аллелью, ассоциированной с оптимизацией водопотребления, а также маркеры, которые представляют собой вызывающие изменения мутации внутри аллели, ассоциированной с оптимизацией водопотребления) может быть применен в раскрытых здесь способах и композициях, и такие маркеры находятся в объеме раскрытого в настоящем документе объекта изобретения. Данный факт означает, что маркеры, указанные в заявке в качестве ассоциированных с аллелью, ассоциированной с оптимизацией водопотребления, (например, маркеры, которые присутствуют в или содержат любую из последовательностей SEQ ID NO: 1-24), представляют собой неограничивающие примеры маркеров, подходящих для применения в раскрытых здесь способах и композициях. Более того, когда аллель, ассоциированная с оптимизацией водопотребления, или ее конкретная часть, несущая данный признак, является интрогрессированной в другой генетический фон (то есть в геном другого кукурузного или иного растения), тогда возможно, что некоторые маркеры больше не будут найдены в потомке, несмотря на присутствующий в нем признак, указывая на то, что такие маркеры находятся вне геномной области, которая представляет специфическую, несущую данный признак часть ассоциированной с оптимизацией водопотребления аллели в исходной родительской линии, и что новый генетический фон имеет другую геномную организацию. Такие маркеры, отсутствие которых указывает на успешное введение генетического элемента в потомство, называются "транс-маркеры" и могут быть в равной степени подходящими в отношении к раскрытому в настоящем документе объекту изобретения.

При идентификации ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа эффект ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа (например, признак) может быть подтвержден, например, при оценке признака в потомстве, сегрегируемом по ассоциированным с оптимизацией водопотребления аллелям и/или гаплотипам. Оценка признака может быть выполнена соответствующим образом с помощью фенотипической оценки, как известно в данной области техники для признаков оптимизации водопотребления. Например, для оценки признаков гибридной и/или инбредной кукурузы могут быть проведены (полевые) исследования в естественных и/или орошаемых условиях.

Маркеры, относящиеся к раскрытому в настоящем документе объекту изобретения, могут быть применены для обнаружения присутствия одной или более аллелей и/или гаплотипов признака оптимизации водопотребления в локусах, относящихся к раскрытому в настоящем документе объекту изобретения, в кукурузном растении, подозреваемом в присутствии интрогрессированного признака оптимизации водопотребления, и, следовательно, могут применяться в способах, включающих маркерное скрещивание и маркерную селекцию таких кукурузных растений, несущих признак оптимизации водопотребления. В некоторых вариантах выполнения изобретения обнаружение присутствия ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа раскрытого в настоящем документе объекта изобретения выполняется по меньшей мере с одним из маркеров ассоциированной с оптимизацией водопотребления аллели и/или гаплотипа, как определено в настоящем документе. Другая задача раскрытого в настоящем документе объекта изобретения, следовательно, относится к способу обнаружения присутствия ассоциированный с оптимизацией водопотребления аллели и/или гаплотипа по меньшей мере для одного из раскрытых здесь признаков оптимизации водопотребления и включает обнаружение присутствия последовательности нуклеиновой кислоты ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа в кукурузном растении, несущем признак оптимизации водопотребления, присутствие которого может быть обнаружено с помощью раскрытых маркеров.

В некоторых вариантах выполнения изобретения обнаружение содержит определение нуклеотидной последовательности нуклеиновой кислоты Zea mays, которая ассоциирована с признаком, аллелью и/или гаплотипом, ассоциированным с оптимизацией водопотребления. Задача определения нуклеотидной последовательности ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа раскрытого в настоящем документе объекта изобретения может быть разрешена, например, определением нуклеотидной последовательности одного или. более маркеров, ассоциированных с аллелью и/или гаплотипом, ассоциированных с оптимизацией водопотребления, и конструированием внутренних праймеров для маркерных последовательностей, которые могут быть тогда применены для дальнейшего определения последовательности ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа за пределами маркерных последовательностей.

Например, нуклеотидная последовательность маркеров SNP, раскрытая здесь, может быть получена изолированием маркеров из электрофорезного геля, применяемого в определении присутствия маркеров в геноме растения объекта изобретения, и определением нуклеотидной последовательности маркеров, например, способами дидезокси-секвенирования с обрывом цепи, которые хорошо известны в данной области техники. В некоторых вариантах выполнения изобретения, относящимся к таким способам обнаружения присутствия ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа в несущем признак кукурузном растении, данный способ может также содержать предоставление олигонуклеотида или полинуклеотида, способного к гибридизации в жестких условиях гибридизации с последовательностью нуклеиновой кислоты маркера, сцепленного с ассоциированными с оптимизацией водопотребления аллелью и/или гаплотипом, который в некоторых вариантах выполнения изобретения выбран из маркеров, раскрытых здесь, связывание олигонуклеотида или полинуклеотида с переваренной геномной нуклеиновой кислотой кукурузного растения, несущего данный признак, и определение наличия специфической гибридизации олигонуклеотида или полинуклеотида с переваренной геномной нуклеиновой кислотой. В некоторых вариантах выполнения изобретения способ осуществляют на образце нуклеиновой кислоты, полученном от кукурузного растения, несущего данный признак, хотя также можно применять способы гибридизации in situ. Альтернативно, после того, как нуклеотидная последовательность ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа была определена, специалист в данной области техники может сконструировать конкретные гибридизационные зонды или олигонуклеотиды, способные к гибридизации в жестких условиях гибридизации с последовательностью нуклеиновой кислоты ассоциированной с оптимизацией водопотребления аллели и/или гаплотипа, и может применять такие гибридизационные зонды в раскрытых здесь способах обнаружения присутствия ассоциированных с оптимизацией водопотребления аллели и/или гаплотипа в несущем признак кукурузном растении.

В некоторых вариантах выполнения изобретения маркеры могут содержать, состоять в основном из или состоять из:

1) гаплотип, содержащий аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7, аллель А в позиции 472 последовательности SEQ ID NO: 48, аллель G в позиции 237 последовательности SEQ ID NO: 56, аллель Т в позиции 173 последовательности SEQ ID N0: 57, аллель А в позиции 391 последовательности SEQ ID NO: 33, аллель G в позиции 116 последовательности SEQ ID NO: 23, аллель G в позиции 100 последовательности SEQ ID NO: 2 и аллель G в позиции 267 последовательности SEQ ID NO: 60;

2) гаплотип, содержащий аллель С в позиции 386 последовательности SEQ ID NO: 46, аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7, аллель А в позиции 472 последовательности SEQ ID NO: 48, аллель А в позиции 266 последовательности SEQ ID NO: 44, аллель Т в позиции 309 последовательности SEQ ID NO: 19, аллель G в позиции 111 последовательности SEQ ID NO: 51, аллель G в позиции 562 последовательности SEQ ID NO: 25 и аллель С в позиции 1271 последовательности SEQ ID NO: 26;

3) гаплотип, содержащий аллель G в позиции 87 последовательности SEQ ID NO: 47, аллель в позиции 4641 последовательности SEQ ID NO: 7, аллель G в позиции 472 последовательности SEQ ID NO: 48, аллель А в позиции 266 последовательности SEQ ID NO: 44, аллель С в позиции 746 последовательности SEQ ID NO: 24, аллель С в позиции 258 последовательности SEQ ID NO: 29, аллель А в позиции 217 последовательности SEQ ID NO: 23, аллель G в позиции 100 последовательности SEQ ID NO: 2, аллель С в позиции 486 последовательности SEQ ID NO: 58 и аллель G в позиции 193 последовательности SEQ ID NO: 55;

4) гаплотип, содержащий аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель G в позиции 237 последовательности SEQ ID NO: 56, аллель А в позиции 391 последовательности SEQ ID NO: 33, аллель Т в позиции 309 последовательности SEQ ID NO: 19, делецию в позициях 264-271 последовательности SEQ ID NO: 2 и аллель С в позиции 486 последовательности SEQ ID NO: 58;

5) гаплотип, содержащий аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7 аллель С в позиции 516 последовательности SEQ ID NO: 56, аллель Т в позиции 475 последовательности SEQ ID NO: 45, аллель А в позиции 391 последовательности SEQ ID N0: 33, аллель G в позиции 463 последовательности SEQ ID NO: 19, аллель G в позиции 254 последовательности SEQ ID NO: 27, аллель G в позиции 729 последовательности SEQ ID NO: 59, аллель G в позиции 267 последовательности SEQ ID NO: 60 и аллель G в позиции 193 последовательности SEQ ID NO: 55; или

6) гаплотип, содержащий аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель G в позиции 237 последовательности SEQ ID NO: 56, аллель С в позиции 258 последовательности SEQ ID NO: 29, аллель G в позиции 463 последовательности SEQ ID NO: 19 и аллель G в позиции 193 последовательности SEQ ID NO: 55.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) гаплотип, содержащий аллель А в позициях 4979-4981 последовательности SEQ ID NO:

7, аллель А в позиции 472 последовательности SEQ ID NO: 48 и аллель Т в позиции 173 последовательности SEQ ID NO: 57;

2) гаплотип, содержащий аллель С в позиции 386 последовательности SEQ ID NO: 46, аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7, аллель А в позиции 472 последовательности SEQ ID NO: 48, аллель А в позиции 266 последовательности SEQ ID NO: 44, аллель Т в позиции 309 последовательности SEQ ID NO: 19 и аллель G;

3) гаплотип, содержащий аллель G в позиции 87 последовательности SEQ ID NO: 47, аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель G в позиции 472 последовательности SEQ ID NO: 48, аллель А в позиции 266 последовательности SEQ ID NO: 44, аллель С в позиции 258 последовательности SEQ ID NO: 29 и аллель G в позиции 193 последовательности SEQ ID NO: 55;

4) гаплотип, содержащий аллель А в позиции 4641 последовательности SEQ ID NO: 7 и аллель Т в позиции 309 последовательности SEQ ID NO: 19;

5) гаплотип, содержащий аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7, аллель Т в позиции 475 последовательности SEQ ID NO: 45, аллель G в позиции 463 последовательности SEQ ID NO: 19 и аллель G в позиции 193 последовательности SEQ ID NO: 55; или

6) гаплотип, содержащий аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель С в позиции 258 последовательности SEQ ID NO: 29, аллель G в позиции 463 последовательности SEQ ID NO: 19 и аллель G в позиции 193 последовательности SEQ ID NO: 55.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7;

2) аллель А в позиции 4641 последовательности SEQ ID NO: 7;

3) гаплотип, содержащий аллель С в позиции 386 последовательности SEQ ID NO: 46 и аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7; или

4) гаплотип, содержащий аллель А в позиции 4641 последовательности SEQ ID NO: 7 и аллель G в позиции 472 последовательности SEQ ID NO: 48.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) гаплотип, содержащий последовательности SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 16, SEQ ID NO: 20 и SEQ ID NO: 25;

2) гаплотип, содержащий последовательности SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26 и SEQ ID NO: 27;

3) гаплотип, содержащий последовательности SEQ ID NO: 1, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 20, SEQ ID NO: 21 и SEQ ID NO: 28;

4) гаплотип, содержащий последовательности SEQ ID NO: 4, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO: 18, SEQ ID NO: 19 и SEQ ID NO: 21;

5) гаплотип, содержащий последовательности SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 13, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25 и SEQ ID NO: 28; или

6) гаплотип, содержащий последовательности SEQ ID NO: 4, SEQ ID NO: 7, SEQ ID NO: 14, SEQ ID NO: 17 и SEQ ID NO: 28.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) гаплотип, содержащий последовательности SEQ ID NO: 3, SEQ ID NO: 5 и SEQ ID NO: 11;

2) гаплотип, содержащий последовательности SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 18 и SEQ ID NO: 22;

3) гаплотип, содержащий последовательности SEQ ID NO: 1, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 9, SEQ ID NO: 14 и SEQ ID NO: 28;

4) гаплотип, содержащий последовательности SEQ ID NO: 4, SEQ ID NO: 9 и SEQ ID NO: 18;

5) гаплотип, содержащий последовательности SEQ ID NO: 3, SEQ ID NO: 10, SEQ ID NO: 17 и SEQ ID NO: 28; или

6) гаплотип, содержащий последовательности SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 17 и SEQ ID NO: 28.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) последовательность SEQ ID NO: 3;

2) последовательность SEQ ID NO: 4;

3) гаплотип, содержащий последовательности SEQ ID NO: 2 и SEQ ID NO: 3 или

4) гаплотип, содержащий последовательности SEQ ID NO: 4, SEQ ID NO: 6.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) гаплотип, содержащий последовательности SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 91, SEQ ID NO: 95, SEQ ID NO: 97, SEQ ID NO: 100, SEQ ID NO: 104 и SEQ ID NO: 109;

2) гаплотип, содержащий последовательности SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 93, SEQ ID NO: 102, SEQ ID NO: 106, SEQ ID NO: 110 и SEQ ID NO: 111;

3) гаплотип, содержащий последовательности SEQ ID NO: 85, SEQ ID NO: 88, SEQ ID NO: 90, SEQ ID NO: 93, SEQ ID NO: 96, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 105 и SEQ ID NO: 112;

4) гаплотип, содержащий последовательности SEQ ID NO: 88, SEQ ID NO: 91, SEQ ID NO: 93, SEQ ID NO: 97, SEQ ID NO: 102, SEQ ID NO: 103 и SEQ ID NO: 105;

5) гаплотип, содержащий последовательности SEQ ID NO: 87, SEQ ID NO: 92, SEQ ID NO: 94, SEQ ID NO: 97, SEQ ID NO: 101 SEQ ID NO: 107, SEQ ID NO: 108 SEQ ID NO: 109 и SEQ ID NO: 112 или

6) гаплотип, содержащий последовательности SEQ ID NO: 88, SEQ ID NO: 91, SEQ ID NO: 98, SEQ ID NO: 101 и SEQ ID NO: 112.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) гаплотип, содержащий последовательности SEQ ID NO: 87, SEQ ID NO: 89 и SEQ ID NO: 95;

2) гаплотип, содержащий последовательности SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 93, SEQ ID NO: 102 и SEQ ID NO: 106;

3) гаплотип, содержащий последовательности SEQ ID NO: 85, SEQ ID NO: 88, SEQ ID NO: 90, SEQ ID NO: 93, SEQ ID NO: 98 и SEQ ID NO: 112;

4) гаплотип, содержащий последовательности SEQ ID NO: 88, SEQ ID NO: 93 и SEQ ID NO:102;

5) гаплотип, содержащий последовательности SEQ ID NO: 87, SEQ ID NO: 94, SEQ ID NO: 101 и SEQ ID NO: 112 или

6) гаплотип, содержащий последовательности SEQ ID NO: 88, SEQ ID NO: 98, SEQ ID NO: 101 и SEQ ID NO: 112.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из:

1) последовательность SEQ ID NO: 87;

2) последовательность SEQ ID NO: 88;

3) гаплотип, содержащий последовательности SEQ ID NO: 86 и SEQ ID NO: 87; или

4) гаплотип, содержащий последовательности SEQ ID NO: 88 и SEQ ID NO: 90.

Определенные нуклеотиды, которые присутствуют в определенных местах в маркерах, и нуклеиновые кислоты, раскрытые здесь, могут быть определены с применением стандартных способов молекулярной биологии, включая, но не ограничиваясь ими, амплификацию геномной ДНК из растений и последующее секвенирование. В дополнение, могут быть разработаны олигонуклеотидные праймеры, от которых можно ожидать специфичной гибридизации с определенными последовательностями, которые включают в себя полиморфизмы, раскрытые здесь. Например, можно разработать олигонуклеотиды, которые различают аллель "А" и аллель "G" в нуклеотидной позиции, которая соответствует позиции 270 последовательности SEQ ID NO: 1 с помощью олигонуклеотидов, содержащих, состоящих в основном или состоящих из последовательностей SEQ ID NO: 232 и 233. Соответствующая разница между последовательностями SEQ ID NO: 232 и 233 состоит в том, что первая последовательность имеет нуклеотид G в позиции 19 и вторая последовательность имеет нуклеотид Т в позиции 19. Таким образом, могут быть разработаны условия гибридизации последовательности SEQ ID NO: 232, которые позволили бы SEQ ID NO: 232 специфично гибридизоваться с аллелью "G", если она присутствует, но не гибридизоваться с аллелью "А", если присутствует аллель "А". Таким образом, гибридизация с помощью данных двух праймеров, которые отличаются только одним нуклеотидом, может быть применена для анализа на наличие той или иной аллели в нуклеотидной позиции, соответствующей позиции 270 последовательности SEQ ID NO: 1.

В некоторых вариантах выполнения изобретения аллели, содержащие маркер, ассоциированный с повышенной засухоустойчивостью, обнаруживают, применяя множество зондов, выбранных из группы, состоящей из:

(I) SEQ ID NO: 348 и 349; SEQ ID NO: 350 и 351; SEQ ID NO: 360 и 361; SEQ ID NO: 372 и 373; SEQ ID NO: 382 и 383; SEQ ID NO: 388 и 389; SEQ ID NO: 382 и 383; и SEQ ID NO: 398 и 399;

(II) SEQ ID NO: 350 и251; SEQ ID NO: 356 и 357; SEQ ID NO: 364 и 365; SEQ ID NO: 366 и 367; SEQ ID NO: 374 и 375; SEQ ID NO: 378 и 379; SEQ ID NO: 382 и 383; и SEQ ID NO: 384 и 385;

(III) SEQ ID NO: 348 и 349; SEQ ID NO: 352 и 353; SEQ ID NO: 358 и 359; SEQ ID NO: 362 и 363; SEQ ID NO: 370 и 371; SEQ ID NO: 374 и 375; SEQ ID NO: 382 и 383; SEQ ID NO: 386 и 387; и SEQ ID NO: 394 и 395;

(IV) SEQ ID NO: 346 и 347; SEQ ID NO: 352 и 353; SEQ ID NO: 356 и 357; SEQ ID NO: 372 и 373; SEQ ID NO: 388 и 389; и SEQ ID NO: 394 395;

(V) SEQ ID NO: 351 и 351; SEQ ID NO: 354 и 355; SEQ ID NO: 368 и 369; SEQ ID NO: 372 и 373; SEQ ID NO: 376 и 377; SEQ ID NO: 386 и 387; SEQ ID NO: 390 и 391; SEQ ID NO: 396 и 397; и SEQ ID NO: 398 и 399;

(VI) SEQ ID NO: 352 и 353; SEQ ID NO: 354 и 355; SEQ ID NO: 370 и 371; SEQ ID NO: 386 и 387; SEQ ID NO: 388 и 389;

(VII) SEQ ID NO: 350 и 351; SEQ ID NO: 382 и 383; SEQ ID NO: 388 и 389; и SEQ ID NO: 392 и 393;

(VIII) SEQ ID NO: 350 и 351; SEQ ID NO: 366 и 367; SEQ ID NO: 374 и 375; SEQ ID NO: 378 и 379; SEQ ID NO: 382 и 383; и SEQ ID NO: 384 и 385;

(IX) SEQ ID NO: 352 и 353; SEQ ID NO: 370 и 371; SEQ ID NO: 380 и 381; SEQ ID NO: 382 и 383; и SEQ ID NO: 386 и 387;

(X) SEQ ID NO: 352 и 353; SEQ ID NO: 356 и 357; и SEQ ID NO: 388 и 389;

(XI) SEQ ID NO: 350 и 351; SEQ ID NO: 354 и 355; SEQ ID NO: 376 и 377; и SEQ ID NO: 386 и 387;

(XII) SEQ ID NO: 350 и 351;

(XIII) SEQ ID NO: 352 и 353;

(XIV) SEQ ID NO: 350 и 351 и SEQ ID NO: 378 и 379; и

(XV) SEQ ID NO: 352 и 353 и SEQ ID NO: 382 и 383.

В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из обратного комплемента любого из вышеперечисленных маркеров. В некоторых вариантах выполнения изобретения одна или более аллелей, которые составляют гаплотип маркера, присутствует как описано выше, в то время как одна или более других аллелей, которые составляют гаплотип маркера, присутствует в качестве обратного комплемента аллели(ей), описанной выше. В некоторых вариантах выполнения изобретения каждая из аллелей, которые составляют гаплотип маркера, присутствует в качестве обратного комплемента аллели(ей), описанной выше. В некоторых вариантах выполнения изобретения маркер может содержать, состоять в основном из или состоять из информативного фрагмента любого из вышеперечисленных маркеров, обратного комплемента любого из вышеперечисленных маркеров или информативного фрагмента обратного комплемента любого из вышеперечисленных маркеров. В некоторых вариантах выполнения изобретения одна или более аллелей/последовательностей, которые составляют гаплотип маркера, присутствует, как описано выше, в то время как одна или более других аллелей/последовательностей, которые составляют гаплотип маркера, присутствует в виде обратного комплемента информативных фрагментов аллелей/последовательностей, описанных выше. В некоторых вариантах выполнения изобретения одна или более аллелей/последовательностей, которые составляют гаплотип маркера, присутствует, как описано выше, в то время как одна или более других аллелей/последовательностей, которые составляют гаплотип маркера, присутствует в качестве информативного фрагмента аллелей/последовательностей, описанных выше. В некоторых вариантах выполнения изобретения одна или более аллелей/последовательностей, которые составляют гаплотип маркера, присутствует, как описано выше, в то время как одна или более других аллелей/последовательностей, которые составляют гаплотип маркера, присутствует в качестве информативного фрагмента обратного комплемента аллелей/последовательностей, описанных выше. В некоторых вариантах выполнения изобретения каждая из аллелей/последовательностей, которые составляют гаплотип маркера, присутствует в качестве информативного фрагмента аллелей/последовательностей, описанных выше, обратного комплемента аллелей/последовательностей, описанных выше, или информативного фрагмента обратного комплемента аллелей/последовательностей, описанных выше.

В некоторых вариантах выполнения изобретения маркер может содержать, состоят в основном или состоять из любых маркеров, сцепленных с вышеупомянутыми маркерами. То есть любые аллель и/или гаплотип, которые неравновесно сцеплены с любым из вышеупомянутых маркеров, могут быть применены для идентификации, селекции и/или получения кукурузного растения с повышенной засухоустойчивостью. Сцепленные маркеры могут быть определены, например, с помощью ресурсов, имеющихся на сайте MaizeGDB.

Изолированные и очищенные маркеры, ассоциированные с повышенной засухоустойчивостью, также относятся к настоящему изобретению. Такие маркеры могут содержать, состоять в основном из или состоять из нуклеотидной последовательности, изложенной в любой из последовательностей SEQ ID NO: 1-117, 400 и 401, их обратного комплемента или их информативного фрагмента. В некоторых вариантах выполнения изобретения маркер содержит детектируемый фрагмент. В некоторых вариантах выполнения изобретения маркер позволяет обнаружить одну или более аллелей маркера, указанных в данном документе.

Композиции, содержащие пару праймеров, способных амплифицировать образец нуклеиновой кислоты, изолированной из кукурузного растения или зародышевой плазмы для генерации маркера, ассоциированного с повышенной засухоустойчивостью, также относятся к настоящему изобретению. В некоторых вариантах выполнения изобретения маркер содержит нуклеотидную последовательность, как изложено здесь, ее обратный комплемент или информативный фрагмент. В некоторых вариантах выполнения изобретения маркер содержит нуклеотидную последовательность, которая по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 97%, 99% или 100% идентична нуклеотидной последовательности, изложенной здесь, ее обратного комплемента или информативного фрагмента. В некоторых вариантах выполнения изобретения пара праймеров представляет собой одну из пар праймеров амплификации, приведенных выше в таблице 1. Специалисту в данной области техники будет понятно, как выбирать альтернативные пары праймеров в соответствии со способами, хорошо известными в данной области техники.

В таблице 5 приводится сводка благоприятных аллелей и однолокусных гаплотипов, которые сцеплены с оптимизацией водопотребления.

Таблица 5
Иллюстративная сводка аллелей и однолокусных гаплотипов
SEQ ID NO: Позиция Благоприятная* HAPL** HAPL CODE
1 115 G A
270 A (Y) A
301 Т
483 A
2 100 G
264-271 DEL
3 216 G (Y)
4 503 A (Y)
5 818-821 INS (Y)
6 254 G (Y); A (P)
7 4497-4498 GA (Y) DEL В
4505 G
4609 Т
4641 A (Y); A A
4792 C (Y); T (Y) Т
4836 T (Y) Т
SEQ ID NO: Позиция Благоприятная* HAPL** HAPL CODE
4844 С
4969 G
4979-4981 A (Y); G (Y) TCC
8 217 A P) A
390 G С
477 A
9 292 С (Y); С (P)
10 166 A (Y); A (P)
11 148 G (P)
12 94 C (Y); C
13 35 A (P)
86 C (Y); C
89 G (Y)
14 432 G (P)
15 753 A (Y)
16 755 G (Y)
17 431 G (Y)
18 518 G (P); T (W)
19 182 A (P) G D
309 A (Y); A A
330 G
463 G; C (P) G
20 773-776 C (Y); C (P)
21 61 С
200 С E
316-324 T (Y) DEL
22 211 G (P)
23 116 G
217 A
SEQ ID NO: Позиция Благоприятная* HAPL** HAPL CODE
24 746 С
25 562 G (Y); G (P); G
26 1271 С
27 64 G F
254 C; T (Y); C (P) Т
28 98 С G
147 Т
224 с
496 T (Y) т
29 258 С
30 259 T (R) т Н
296 т
398 G (Y) А
1057 С
31 239 G (Y); G (P)
32 208 G (Y)
33 391 A
34 144-145 C (Y); C (P)
169 T (Y)
537 A (P)
35 76 G (Y)
36 500 С
568 G I
698 T (Y) Т
37 375 A
386 A (P); G (Y); A (Y)
38 309 C (P)
342 A (P)
39 445 G (Y); С (P)
SEQ ID NO: Позиция Благоприятная* HAPL** HAPL CODE
40 602 A (Y)
41 190 G (Y); A (P)
580 C (Y)
42 238 A
266-268 INS (Y) DEL J
808 С
43 708 С (P); A (Y)
44 266 A
45 475 Т
46 386 С
47 87 G
48 472 A; G
49 166 С K
224 A
650 G (Y); G (P) G
892 G
50 541 Т (Y); A (Y)
51 111 G
52 442 C; G
53 83 С L
428 C (P); T (Y) С
491 С (Y); С (P) С
548 С
54 126 A (Y)
55 193 G
56 237 G
516 С
57 173 Т
58 486 С
59 729 G
SEQ ID NO: Позиция Благоприятная* HAPL** HAPL CODE
60 267 G
400 83 С С
119 А А М
601 Т Т
* (Y): YGSMN; (Р): GMSTP, (W): GWTPN
** HAPL относится к однолокусным гаплотипам (то есть гаплотипам, которые содержат благоприятные аллели, присутствующие вместе, специфически сгруппированы).

Применяемое здесь выражение "гаплотипный код" означает набор SNP, присутствующих в растении, причем каждая благоприятная аллель, перечисленная в колонке однолокусных гаплотипов таблицы 5, присутствует в растении. Например, говорят, что растение имеет "гаплотип А", когда по меньшей мере один локус, соответствующий последовательности SEQ ID NO: 1, в растении имеет G в нуклеотидной позиции 115, А в позиции 270 последовательности SEQ ID NO: 1, Т в нуклеотидной позиции 301 и А в позиции 483. Гаплотип А может альтернативно называться "GATA" в отношении данных конкретных нуклеотидных позиций. Аналогичным образом, говорят, что растение имеет "гаплотип С", если по меньшей мере один локус, соответствующий последовательности SEQ ID NO: 8, в растении имеет А в нуклеотидной позиции 217, G в нуклеотидной позиции 290 и А в нуклеотидной позиции 477 последовательности SEQ ID NO: 8. Гаплотип С, таким образом, может альтернативно называться "AGA" в отношении данных конкретных нуклеотидных позиций.

Идентификация растений с различными аллелями и/или гаплотипами, представляющими интерес, может предоставить стартовый материал для объединения аллелей и/или гаплотипов в растениях-потомках, используя стратегии скрещивания, направленные на то, чтобы "суммировать" аллели и/или гаплотипы. Применяемый здесь термин "суммирование" и его грамматические варианты относится к намеренному накоплению в растениях скрещиванием (включая, но не ограничиваясь ими, скрещивание двух растений, самооопыление одного растения и/или создание двойного гаплоида из одного растения) благоприятных гаплотипов оптимизации водопотребления, так что геном растений имеет по меньшей мере один дополнительный благоприятный гаплотип оптимизации водопотребления, по сравнению с его непосредственным(и) предшественником(ами).

Суммирование включает в себя в некоторых вариантах выполнения изобретения перенос одного или более признаков, аллелей и/или гаплотипов оптимизации водопотребления в кукурузное растение-потомок, так что кукурузное растение-потомок включает в себя большее количество признаков, аллелей и/или гаплотипов оптимизации водопотребления, чем любой из родителей, из которых оно было получено. В качестве примера, но не ограничения, если родитель 1 имеет гаплотипы А, В и С и родитель 2 имеет гаплотипы D, Е и F, то "суммирование" относится к продукции растения, которое имеет любой из А, В и С с любой комбинацией D, Е и F. В частности, в некоторых вариантах выполнения изобретения "суммирование" относится к производству растения, которое имеет А, В и С, а также один или более D, Е, F, или производству растения, которое имеет D, Е, F, а также один или более А, В и С. В некоторых вариантах выполнения изобретения "суммирование" относится к продукции растения из скрещивания двух родителей, которое содержит все ассоциированные с оптимизацией водопотребления гаплотипы, которыми обладает любой из родителей.

В некоторых вариантах выполнения изобретения признак оптимизации водопотребления представляет собой урожайность зерна - засуха, и благоприятный гаплотип содержит нуклеотидную последовательность, содержащую Т в нуклеотидной позиции 301, G в нуклеотидной позиции 115, А в нуклеотидной позиции 483 и А в нуклеотидной позиции 270 последовательности SEQ ID NO: 1; тринуклеотид ТСС в нуклеотидных позициях 4979-4981, G в нуклеотидной позиции 4969, А в нуклеотидной позиции 4641, Т в нуклеотидной позиции 4609, делецию нуклеотидных позиций 4497-4498, Т в нуклеотидной позиции 4792, Т в нуклеотидной позиции 4836, G в нуклеотидной позиции 4505 и С в нуклеотидной позиции 4844 последовательности SEQ ID NO: 7; А в нуклеотидной позиции 217, G в нуклеотидной позиции 390 и А в нуклеотидной позиции 477 последовательности SEQ ID NO: 8, G в нуклеотидной позиции 463, G в нуклеотидной позиции 330, G в нуклеотидной позиции 182 и А в в нуклеотидной позиции 309 последовательности SEQ ID NO: 19; G в нуклеотидной позиции 64 и А в нуклеотидной позиции 254 последовательности SEQ ID NO: 27; С в нуклеотидной позиции 98, Т в нуклеотидной позиции 147, С в нуклеотидной позиции 224 и Т в нуклеотидной позиции 496 последовательности SEQ ID NO: 28; С в нуклеотидной позиции 500, G в нуклеотидной позиции 568 и Т в нуклеотидной позиции 698 последовательности SEQ ID NO: 36; делецию нуклеотидных позиций 266-267, С в нуклеотидной позиции 808 и А в нуклеотидной позиции 238 последовательности SEQ ID NO: 42; и/или С в нуклеотидной позиции 166, А в нуклеотидной позиции 224, G в нуклеотидной позиции 650 и G в нуклеотидной позиции 892 последовательности SEQ ID NO: 49.

В некоторых вариантах выполнения изобретения признак оптимизации водопотребления представляет собой "урожайность зерна - хорошее орошение", и благоприятный гаплотип содержит нуклеотидную последовательность, содержащую А в нуклеотидной позиции 217, G в нуклеотидной позиции 390 и А в нуклеотидной позиции 477 последовательности SEQ ID NO: 8, С в нуклеотидной позиции 500, G в нуклеотидной позиции 568 и Т в нуклеотидной позиции 698 последовательности SEQ ID NO: 36; и/или С в нуклеотидной позиции 83, С в нуклеотидной позиции 548, С в нуклеотидной позиции 491 и С в нуклеотидной позиции 428 последовательности SEQ ID NO: 53.

В некоторых вариантах выполнения изобретения признак оптимизации водопотребления представляет собой "сокращение урожайности - гибрид", и благоприятный гаплотип содержит нуклеотидную последовательность, содержащую С в нуклеотидной позиции 98, Т в нуклеотидной позиции 147, С в нуклеотидной позиции 224 и Т в нуклеотидной позиции 496 последовательности SEQ ID NO: 28.

В некоторых вариантах выполнения изобретения признак оптимизации водопотребления представляет собой снижения урожайности - инбред, и благоприятный гаплотип содержит нуклеотидную последовательность, содержащую тринуклеотид ТСС в нуклеотидных позициях 4979-4981, G в нуклеотидной позиции 4969, А в нуклеотидной позиции 4641, Т в нуклеотидной позиции 4609, делецию нуклеотидных позиций 4497-4498, Т в нуклеотидной позиции 4792, Т в нуклеотидной позиции 4836, G в нуклеотидной позиции 4505 и С в нуклеотидной позиции 4844 последовательности SEQ ID NO: 7; А в нуклеотидной позиции 217, G в нуклеотидной позиции 390 и А в нуклеотидной позиции 477 последовательности SEQ ID NO: 8, G в нуклеотидной позиции 64 и А в нуклеотидной позиции 254 последовательности SEQ ID NO: 27; и/или С в нуклеотидной позиции 83, С в нуклеотидной позиции 548, С в нуклеотидной позиции 491 и С в нуклеотидной позиции 428 последовательности SEQ ID NO: 53.

В некоторых вариантах выполнения изобретения признак оптимизации водопотребления представляет собой ASI, и благоприятный гаплотип содержит нуклеотидную последовательность, содержащую тринуклеотид ТСС в нуклеотидных позициях 4979-4981, G в нуклеотидной позиции 4969, А в нуклеотидной позиции 4641, Т в нуклеотидной позиции 4609, делецию нуклеотидных позиций 4497-4498, Т в нуклеотидной позиции 4792, Т в нуклеотидной позиции 4836, G в нуклеотидной позиции 4505 и С в нуклеотидной позиции 4844 последовательности SEQ ID NO: 7.

В некоторых вариантах выполнения изобретения признак оптимизации водопотребления представляет собой процент бесплодных растений, и благоприятный гаплотип содержит нуклеотидную последовательность, содержащую тринуклеотид ТСС в нуклеотидных позициях 4979-4981, G в нуклеотидной позиции 4969, А в нуклеотидной позиции 4641, Т в нуклеотидной позиции 4609, делецию нуклеотидных позиций 4497-4498, Т в нуклеотидной позиции 4792, Т в нуклеотидной позиции 4836, G в нуклеотидной позиции 4505 и С в нуклеотидной позиции 4844 последовательности SEQ ID NO: 7; G в нуклеотидной позиции 463, G в нуклеотидной позиции 330, G в нуклеотидной позиции 182 и А в нуклеотидной позиции 309 последовательности SEQ ID NO: 19; С в нуклеотидной позиции 61, С в нуклеотидной позиции 200 и делецию нуклеотидных позиций 316-324 последовательности SEQ ID NO: 21; и/или А в нуклеотидной позиции 398, Т в нуклеотидной позиции 296, Т в нуклеотидной позиции 259 и С в нуклеотидной позиции 1057 последовательности SEQ ID NO: 30.

В некоторых вариантах выполнения раскрытого в настоящем документе объекта изобретения геномы инбредных или гибридных растений Zea mays содержат по меньшей мере три, четыре, пять, шесть, семь, восемь или девять гаплотипов А-М, причем гаплотипы А-М ассоциированы с оптимизацией водопотребления и определены в настоящем документе. В некоторых вариантах выполнения изобретения инбредное или гибридное растение Zea mays содержит геном, содержащий гаплотипы С, D и G; гаплотипы С, D и L, гаплотипы С, G, Н; гаплотипы С, G и I; гаплотипы С, I и L; гаплотипы Е, G и I, гаплотипы F, G и Н; гаплотипы А, С, F и G; гаплотипы С, Е, Н и I; гаплотипы С, G, Н и I; гаплотипы С, Н, I и K; гаплотипы С, Н, I и L; гаплотипы Е, F, G и Н; гаплотипы А, С, G, Н и I; гаплотипы В, С, D, G и L; гаплотипы С, Е, G, Н и I; гаплотипы С, G, Н, I и L; гаплотипы А, С, G, Н, I и K; гаплотипы С, Е, F, G, Н, I, J, K и L, гаплотипы С, D, G и М; гаплотипы С, D, L и М; гаплотипы С, G, Н и М; гаплотипы С, G, I и М; гаплотипы С, I, L, М; гаплотипы Е, G, I и М; гаплотипы F, G, Н и М; гаплотипы А, С, F, G и М; гаплотипы С, Е, Н, I и М; гаплотипы С, G, Н, I и М; гаплотипы С, Н, I, K и М; гаплотипы С, Н, I, L и М; гаплотипы Е, F, G, Н и М; гаплотипы А, С, G, Н, I и М; гаплотипы В, С, D, G, L и М; гаплотипы С, Е, G, Н, I и М; гаплотипы С, G, Н, I, L и М; гаплотипы А, С, G, Н, I, K, М; и гаплотипы С, Е, F, G, Н, I, J, K, L и М. В некоторых вариантах выполнения изобретения инбредное или гибридное растение Zea mays представляет собой гибридное растение, которое является гомозиготным по меньшей мере по одному из гаплотипов А-М.

В некоторых вариантах выполнения изобретения инбредное или гибридное растение Zea mays содержит геном, содержащий гаплотипы А, С, Е, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, F, G, Н и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, G, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, Е, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, F, G и Н, необязательно дополнительно содержащий гаплотип М; гаплотипы D, Е, F, G и Н, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, G, Н, I и K, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, Е, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, G, Н, I и K, необязательно дополнительно содержащий гаплотип М; гаплотипы С, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н, I и K, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, Е, F, G, Н, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н и I, необязательно дополнительно содержащий гаплотип М; гаплотипы А, С, Е, F, G, Н, I и K, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; гаплотипы В, С, D, Е, F, G, Н и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, H, I, J, K и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, D, G, Н и L, необязательно дополнительно содержащий гаплотип М; гаплотипы С, Е, F, G, Н, I и L, необязательно дополнительно содержащий гаплотип М; и/или гаплотипы В, С, D, Е, G, I и L, необязательно дополнительно содержащий гаплотип М.

Как применяется здесь, растение, которое содержит несколько гаплотипов, может быть обозначено кодом, обозначающим имеющиеся у него гаплотипы. Так, например, растение, которое содержит в своем геноме по меньшей мере одну копию гаплотипов С, D, Е, F, G, Н, I, J, K и L, может быть обозначено как "CDEFGHIJKL"; растение, которое содержит в своем геноме по меньшей мере одну копию гаплотипов В, С, D, Е, F, G, Н, I, J, K и L, может быть обозначено как "BCDEFGHIJKL" и т.д. В некоторых вариантах выполнения изобретения применяют прописные и строчные буквы, чтобы дополнительно определить данные гаплотипы, по которым растение (или его клетка) является или гомозиготным (например, прописные буквы) или гетерозиготным (например, строчные буквы). В качестве примера, а не ограничения, растение или клетка, которое называют CDEFGHIJKL, имеет по меньшей мере один из гаплотипов С, D, Е, F, G, Н, I, J, K и L. В некоторых вариантах выполнения изобретения данное обозначение будет указывать на то, что растение или клетка является гомозиготным по каждому из данных гаплотипов. Аналогичным образом, обозначение cdefghijkl указывает на то, что растение или клетка является гетерозиготным по гаплотипам С, D, Е, F, G, Н, I, J, K и L. И, наконец, обозначение CdeFGhijKL указывает на то, что растение или клетка является гомозиготным по гаплотипам С, F, G, К и L, I и является гетерозиготным по гаплотипам D, Е, Н, I и J. В некоторых вариантах выполнения изобретения данное обозначение дополнительно указывает на то, что растению или клетке не хватает гаплотипов А и В, хотя в некоторых вариантах выполнения изобретения данное обозначение указывает на то, что статус растения или клетки по отношению к данным гаплотипам неизвестен или не тестировался.

III. Способы интрогрессии аллелей, представляющих интерес, и определения растений, содержащих такие аллели

III.A. Общие принципы маркерной селекции

Маркеры могут применяться в различных приложениях скрещивания растений. См., например, Staub et al., Hortscience 31: 729 (1996); Tanksley, Plant Molecular Biology Reporter 1: 3 (1983). Одной из основных представляющих интерес областей является повышение эффективности возвратного скрещивания и интрогрессии генов с помощью маркерной селекции (MAS). Обычно MAS использует преимущества генетических маркеров, которые были идентифицированы как отделяющиеся с большой долей вероятности совместно с желаемым признаком. Предполагается, что такие маркеры находятся в гене(ах)/около гена(ов), которые приводят к желаемому фенотипу, и их присутствие указывает на то, что растение будет иметь желаемый признак. Ожидается, что растения, обладающие маркером, передают желаемый фенотип своему потомству.

Маркер, который демонстрирует сцепление с локусом, влияющим на желаемый фенотипический признак, представляет собой применимый инструмент для селекции признака в популяции растений. Это особенно верно, когда фенотип трудно анализировать или он возникает на поздней стадии развития растений. С тех пор как анализы ДНК маркеров стали менее трудоемкими и требуют меньше физического пространства, чем полевое фенотипирование, могут быть проанализированы гораздо более многочисленные популяции, увеличивая шансы нахождения рекомбинанта с целевьм сегментом из донорной линии, перемещенной в реципиентную линию. Чем выше степень сцепления, тем более применимым является маркер, так как рекомбинация, между маркером и геном, вызываемым или обеспечивающим признак, является менее вероятной. Присутствие фланкирующих маркеров уменьшает вероятность того, что произойдет ложная положительная селекция. В идеале маркер находится в самом гене, так что между маркером и геном не может произойти рекомбинация. Такой маркер называется "идеальный маркер".

Когда ген интрогрессирован с помощью MAS, вводится не только ген, но и фланкирующие области. Gepts, Crop Sci 42: 1780 (2002). Данное явление называется "сопротивление, обусловленное сцеплением генов" (linkage drag). В случае, когда донорное растение и реципиентное растение являются очень далекими по родству, данные фланкирующие области несут дополнительные гены, которые могут кодировать агрономически нежелательные признаки. Данное "сопротивление, обусловленное сцеплением генов" также может привести к снижению урожайности или других негативным агрономическим признакам даже после многократных циклов возвратного скрещивания для получения элитной линии кукурузы. Данное явление также иногда называется "обусловленным сцеплением генов падением урожая (yield drag)". Размер фланкирующей области может быть уменьшен дополнительным возвратным скрещиванием, хотя оно не всегда бывает успешным, так как селекционеры не контролируют размер данной области или контрольные точки рекомбинации. Young et al., Genetics 120: 579 (1998). Рекомбинации, которые способствуют уменьшению размера донорного сегмента, обычно отбираются в классической селекции только случайным образом. Tanksley et al., Biotechnology 7: 257 (1989). Даже после 20-ти возвратных скрещиваний можно ожидать, что будет найден значительный участок донорной хромосомы, все еще сцепленный с геном, который должен быть выбран. Однако, используя маркеры, возможно выделить те редкие индивиды, у которых рекомбинация произошла рядом с генами, представляющими интерес. Для 150 беккроссных растений существует вероятность, равная 95%, что по меньшей мере в одном растении произойдет кроссовер в пределах 1 сМ гена, на основе расстояния на карте после одного мейоза. Маркеры позволяют провести однозначную идентификацию таких отдельных растений. С одним дополнительным возвратным скрещиванием 300 растений существовала бы вероятность кроссовера, равная 95%, в пределах 1 сМ расстояния на карте после одного мейоза с другой стороны гена, дающий сегмент вокруг целевого гена, равный менее чем 2 сМ, на основе расстояния на карте после одного мейоза. Такой результат может быть достигнут с маркерами через два поколения, тогда как без маркеров потребовалось бы в среднем 100 поколений. Смотрите Tanksley et al., выше. Когда известно точное расположение генов, фланкирующие маркеры, окружающие ген, могут быть применены для селекции рекомбинаций в популяциях различных размеров. Например, можно ожидать, что в популяциях меньших размеров рекомбинации ожидаются еще дальше от гена, так что потребуется больше дистальных фланкирующих маркеров, чтобы обнаружить рекомбинацию.

Наличие интегрированных карт сцепления кукурузного генома, содержащих повышенные плотности общедоступных маркеров кукурузы, способствовало генетическому картированию кукурузы и MAS. См., например, карты IBM2 Neighbors, которые доступны в Интернете на веб-сайте MaizeGDB.

Из всех типов молекулярных маркеров SNP являются наиболее распространенными и имеют потенциал, чтобы обеспечить наиболее высокое разрешение генетической карты. Bhattramakki et al., Plant Molec. Biol. 48: 539 (2002). SNP могут быть проанализированы в режиме так называемой "сверх-высокой производительности", потому что они не требуют большого количества нуклеиновых кислот, и автоматизация анализа является простой. SNP также имеют преимущество использования относительно недорогих систем. Данные три фактора вместе делают SNP весьма привлекательными для применения в MAS. Имеется несколько способов генотипирования SNP, включая, но не ограничиваясь ими, гибридизацию, удлинение праймера, дотирование олигонуклеотидов, нуклеазное расщепление, минисеквенирование и кодированные сферы. Такие способы были рассмотрены в различных публикациях: Gut, Hum. Mutat. 17: 475 (2001); Shi, Clin. Chem. 47: 164 (2001); Kwok, Pharmacogenomics 1:95 (2000); Bhattramakki and Rafalski, Discovery and application of single nucleotide polymorphism markers in plants, in PLANT GENOTYPING: the DNA FINGERPRINTING OF PLANTS, CABI Publishing, Wallingford (2001). Широкий спектр коммерчески доступных технологий использует данные и другие способы анализа SNP, в том Masscode™ (Qiagen, Germantown, MD), Invader® (Hologic, Madison, WI), Snapshot® (Applied Biosystems, Foster City, CA), Taqman® (Applied Biosystems, Foster City, CA) and Beadarrays™ (Illumina, San Diego, CA).

Набор SNP внутри последовательности или охватывающий сцепленные последовательности может быть применен, чтобы описать гаплотип для любого конкретного генотипа. Ching et al., BMC Genet. 3: 19 (2002); Gupta et al., (2001), Rafalski, Plant Sci. 162: 329 (2002b). Гаплотипы могут быть более информативными, чем одиночные SNP, и могут лучше описывать любой определенный генотип. Например, одиночный SNP может быть аллелью "Т" для конкретной засухоустойчивой линии или сорта, но аллель "Т" также может встречаться в популяции кукурузы, взятой для разведения, будучи используемой для рекуррентных родителей. В данном случае комбинация аллелей на сцепленных SNP может быть более информативной. После того, как области донорной хромосомы был присвоено обозначение уникального гаплотипа, данный гаплотип может быть применен в такой популяции или ее подмножестве, чтобы определить, обладает ли индивида обнаруженным геном. Применение автоматизированных платформ определения маркеров с высокой пропускной способностью, известных специалистам в данной области техники, делает данный процесс очень эффективным и действенным.

Маркеры раскрытого в настоящем документе объекта изобретения могут быть применены в протоколах маркерной селекции для идентификации и/или селекции потомства с повышенной засухоустойчивостью. Такие способы могут содержать, состоять в основном из или состоять из скрещивания первого кукурузного растения или зародышевой плазмы со вторым кукурузным растением или зародышевой плазмой, причем первое кукурузное растение или зародышевая плазма содержит маркер, ассоциированный с повышенной засухоустойчивостью, и селекция потомков-растений, обладающих данным маркером. Любое из первого и второго кукурузных растений или оба растения могут представлять собой не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения первое кукурузное растение или зародышевая плазма представляет собой CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения геном первого кукурузного растения или зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения второе кукурузное растение или зародышевая плазма представляет собой элитный сорт кукурузы. В некоторых вариантах выполнения изобретения геном второго кукурузного растения или зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения второе кукурузное растение представляет собой сорт NP2391. В некоторых вариантах выполнения изобретения геном второго кукурузного растения является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391.

III.B. Способы интрогрессии аллелей и/или гаплотипов, представляющих интерес

Таким образом, в некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения относится к способам интрогрессии аллели, ассоциированной с повышенной засухоустойчивостью, в генетический фон, в котором отсутствует упомянутая аллель. В некоторых вариантах выполнения изобретения способы содержат скрещивание донора, содержащего упомянутую аллель, с рекуррентным родителем, которому не хватает упомянутой аллели, и повторное возвратное скрещивание потомка, содержащего упомянутую аллель, с рекуррентным родителем, причем упомянутые потомки идентифицируются обнаружением в их геномах присутствия гаплотипа, ассоциированного с повышенной засухоустойчивостью, причем упомянутый гаплотип выбирается из группы, состоящей из:

нуклеотида G в позиции, которая соответствует позиции 100 последовательности SEQ ID NO: 2, тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 116 последовательности SEQ ID NO: 23, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида G в позиции, которая соответствует позиции 562 последовательности SEQ ID NO: 25, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида G в позиции, которая соответствует позиции 100, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 23, нуклеотида С в позиции, которая соответствует позиции 746 последовательности SEQ ID NO: 24, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58; делеции нуклеотида в позиции, которая соответствует позициям 264-271 последовательности SEQ ID NO: 2, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, нуклеотида С в позиции, которая соответствует позиции 516 последовательности SEQ ID NO: 56, нуклеотида G в позиции, которая соответствует позиции 729 последовательности SEQ ID NO: 59, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60; нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 87 последовательности SEQ ID NO: 47, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, и нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, и нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48,

и их комбинаций,

тем самым продуцируя засухоустойчивое кукурузное растение или зародышевую плазму, содержащее упомянутую аллель, ассоциированную с повышенной засухоустойчивостью, в генетическом фоне рекуррентных родителей, тем самым интрогрессируя аллель, ассоциированную с повышенной засухоустойчивостью, в генетический фон, в котором отсутствует упомянутая аллель. В некоторых вариантах выполнения изобретения геном упомянутого засухоустойчивого кукурузного растения или зародышевой плазмы, содержащий упомянутую аллель, ассоциированную с повышенной засухоустойчивостью, является по меньшей мере на около 95% идентичным таковому рекуррентных родителей. В некоторых вариантах выполнения изобретения или донор, или рекуррентный родитель или оба представляет собой не встречающийся в природе сорт кукурузы.

В некоторых вариантах выполнения изобретения, относящихся к раскрытым здесь способам, геном упомянутого донора является по меньшей мере на 95% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения упомянутый донор выбран из группы, состоящей из CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 и Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения геном упомянутого рекуррентного родительского растения или зародышевой плазмы является по меньшей мере на 95% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения упомянутый рекуррентный родитель представляет собой элитный сорт кукурузы. В некоторых вариантах выполнения изобретения 23. способ по п.21 или п.22, причем упомянутый элитный сорт кукурузы является NP2391.

III.D. Способы укладки аллелей и/или гаплотипов, представляющих интерес

Раскрытый в настоящем документе объект изобретения относится в некоторых вариантах выполнения изобретения к "укладке" гаплотипов, ассоциированных с оптимизацией водопотребления, для получения растений (и их частей), которые имеют многочисленные благоприятные гаплотипы оптимизации водопотребления. В качестве примера, но не ограничения, раскрытый в настоящем документе объект изобретения относится в некоторых вариантах выполнения изобретения к идентификации и характеристике локусов Zea mays, каждый из которых ассоциирован с одним или более признаками оптимизации водопотребления. Такие локусы соответствуют последовательностям SEQ ID NO: 1-413.

Для каждого из данных локусов были идентифицированы благоприятные гаплотипы, которые являются ассоциированными с признаками оптимизации водопотребления. Данные благоприятные гаплотипы приведены в настоящем документе. Раскрытый здесь объект изобретения относится к иллюстративным гаплотипам, которые являются ассоциированными с увеличением и уменьшением различных признаков оптимизации водопотребления, как определено в настоящем документе. Выражение "благоприятный гаплотип" означает гаплотип, который приводит к количественно повышенной оптимизации водопотребления, по сравнению со случаем, когда присутствует "неблагоприятный гаплотип". Следует отметить, однако, что в случае, когда желательна более низкая оптимизация водопотребления, гаплотипы, раскрытые здесь как "благоприятные", могут быть неблагоприятными гаплотипами. Таким образом, как применяется здесь, "благоприятный" используется в контексте повышенной оптимизации водопотребления и будет пересмотрено в контексте сниженной оптимизации водопотребления.

III.E. Способы идентификации растений, содержащих аллели и/или гаплотипы, представляющие интерес

Способы идентификации засухоустойчивого кукурузного растения или зародышевой плазмы могут содержать обнаружение присутствия маркера, ассоциированного с повышенной засухоустойчивостью. Маркер может быть обнаружен в любом образце, взятом из растения или зародышевой плазмы, включая, но не ограничиваясь ими, целое растение или зародышевую плазму, участок упомянутого растения или зародышевой плазмы (например, клетка из упомянутого растения или зародышевой плазмы) или нуклеотидную последовательность из упомянутого растения или зародышевой плазмы. Кукурузное растение может представлять собой не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения геном кукурузного растения или зародышевая плазма является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения геном кукурузного растения является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 97%, 99% или 100% идентичным таковому NP2391.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения относится к способам интрогрессии представляющей интерес аллели локуса, ассоциированного с признаком оптимизации водопотребления, в зародышевую плазму Zea mays. В некоторых вариантах выполнения изобретения способы содержат:

(а) селекция растения Zea mays, которое содержит представляющую интерес аллель локуса, ассоциированного с признаком оптимизации водопотребления, причем аллель определяется по меньшей мере одной аллелью маркера, содержащей полиморфный сайт, идентифицируемый ПЦР-амплификацией нуклеиновой кислоты Zea mays с парой олигонуклеотидных праймеров, выбранных из пары праймеров 1, представленной праймером, содержащим последовательность SEQ ID NO: 118, и праймером, содержащим последовательность SEQ ID NO: 119; пары праймеров 2, представленной праймером, содержащим последовательность SEQ ID NO: 120, и праймером, содержащим последовательность SEQ ID NO: 121, пары праймеров 3, представленной праймером, содержащим последовательность SEQ ID NO: 122, и праймером, содержащим последовательность SEQ ID NO: 123; пары праймеров 4, представленной праймером, содержащим последовательность SEQ ID NO: 124, и праймером, содержащим последовательность SEQ ID NO: 125, пары праймеров 5, представленной праймером, содержащим последовательность SEQ ID NO: 126, и праймером, содержащим последовательность SEQ ID NO: 127; пары праймеров 6, представленной праймером, содержащим последовательность SEQ ID NO: 128, и праймером, содержащим последовательность SEQ ID NO: 129; пары праймеров 7, представленной праймером, содержащим последовательность SEQ ID NO: 130, и праймером, содержащим последовательность SEQ ID NO: 131; пары праймеров 8, представленной праймером, содержащим последовательность SEQ ID NO: 132, и праймером, содержащим последовательность SEQ ID NO: 133; пары праймеров 9, представленной праймером, содержащим последовательность SEQ ID NO: 134, и праймером, содержащим последовательность SEQ ID NO: 135; пары праймеров 10, представленной праймером, содержащим последовательность SEQ ID NO: 136, и праймером, содержащим последовательность SEQ ID NO: 137; пары праймеров 11, представленной праймером, содержащим последовательность SEQ ID NO: 138, и праймером, содержащим последовательность SEQ ID NO: 139; пары праймеров 12, представленной праймером, содержащим последовательность SEQ ID NO: 140, и праймером, содержащим последовательность SEQ ID NO: 141; пары праймеров 13, представленной праймером, содержащим последовательность SEQ ID NO: 142, и праймером, содержащим последовательность SEQ ID NO: 143; пары праймеров 14, представленной праймером, содержащим последовательность SEQ ID NO: 144, и праймером, содержащим последовательность SEQ ID NO: 145; пары праймеров 15, представленной праймером, содержащим последовательность SEQ ID NO: 146, и праймером, содержащим последовательность SEQ ID NO: 147; пары праймеров 16, представленной праймером, содержащим последовательность SEQ ID NO: 148, и праймером, содержащим последовательность SEQ ID NO: 149; пары праймеров 17, представленной праймером, содержащим последовательность SEQ ID NO: 150, и праймером, содержащим последовательность SEQ ID NO: 151; пары праймеров 18, представленной праймером, содержащим последовательность SEQ ID NO: 152, и праймером, содержащим последовательность SEQ ID NO: 153, пары праймеров 19, представленной праймером, содержащим последовательность SEQ ID NO: 154, и праймером, содержащим последовательность SEQ ID NO: 155; пары праймеров 20, представленной праймером, содержащим последовательность SEQ ID NO: 156, и праймером, содержащим последовательность SEQ ID NO: 157; пары праймеров 21, представленной праймером, содержащим последовательность SEQ ID NO: 158, и праймером, содержащим последовательность SEQ ID NO: 159, пары праймеров 22, представленной праймером, содержащим последовательность SEQ ID NO: 160, и праймером, содержащим последовательность SEQ ID NO: 161; пары праймеров 23, представленной праймером, содержащим последовательность SEQ ID NO: 162, и праймером, содержащим последовательность SEQ ID NO: 163; пары праймеров 24, представленной праймером, содержащим последовательность SEQ ID NO: 164, и праймером, содержащим последовательность SEQ ID NO: 165; пары праймеров 25, представленной праймером, содержащим последовательность SEQ ID NO: 166, и праймером, содержащим последовательность SEQ ID NO: 167; пары праймеров 26, представленной праймером, содержащим последовательность SEQ ID NO: 168, и праймером, содержащим последовательность SEQ ID NO: 169; пары праймеров 27, представленной праймером, содержащим последовательность SEQ ID NO: 170, и праймером, содержащим последовательность SEQ ID NO: 171; пары праймеров 28, представленной праймером, содержащим последовательность SEQ ID NO: 172, и праймером, содержащим последовательность SEQ ID NO: 173, пары праймеров 29, представленной праймером, содержащим последовательность SEQ ID NO: 174, и праймером, содержащим последовательность SEQ ID NO: 175; пары праймеров 30, представленной праймером, содержащим последовательность SEQ ID NO: 176, и праймером, содержащим последовательность SEQ ID NO: 177; пары праймеров 31, представленной праймером, содержащим последовательность SEQ ID NO: 178, и праймером, содержащим последовательность SEQ ID NO: 179; пары праймеров 32, представленной праймером, содержащим последовательность SEQ ID NO: 180, и праймером, содержащим последовательность SEQ ID NO: 181; пары праймеров 33, представленной праймером, содержащим последовательность SEQ ID NO: 182, и праймером, содержащим последовательность SEQ ID NO: 183; пары праймеров 34, представленной праймером, содержащим последовательность SEQ ID NO: 184, и праймером, содержащим последовательность SEQ ID NO: 185; пары праймеров 35, представленной праймером, содержащим последовательность SEQ ID NO: 186, и праймером, содержащим последовательность SEQ ID NO: 187; пары праймеров 36, представленной праймером, содержащим последовательность SEQ ID NO: 188, и праймером, содержащим последовательность SEQ ID NO: 189; пары праймеров 37, представленной праймером, содержащим последовательность SEQ ID NO: 190, и праймером, содержащим последовательность SEQ ID NO: 191; пары праймеров 38, представленной праймером, содержащим последовательность SEQ ID NO: 192, и праймером, содержащим последовательность SEQ ID NO: 193; пары праймеров 39, представленной праймером, содержащим последовательность SEQ ID NO: 194, и праймером, содержащим последовательность SEQ ID NO: 195; пары праймеров 40, представленной праймером, содержащим последовательность SEQ ID NO: 196, и праймером, содержащим последовательность SEQ ID NO: 197; пары праймеров 41, представленной праймером, содержащим последовательность SEQ ID NO: 198, и праймером, содержащим последовательность SEQ ID NO: 199; пары праймеров 42, представленной праймером, содержащим последовательность SEQ ID NO: 200, и праймером, содержащим последовательность SEQ ID NO: 201; пары праймеров 43, представленной праймером, содержащим последовательность SEQ ID NO: 202, и праймером, содержащим последовательность SEQ ID NO: 203; пары праймеров 44, представленной праймером, содержащим последовательность SEQ последовательность SEQ ID NO: 204, и праймером, содержащим последовательность SEQ ID NO: 205, пары праймеров 45, представленной праймером, содержащим последовательность SEQ ID NO: 206, и праймером, содержащим последовательность SEQ ID NO: 207; пары праймеров 46, представленной праймером, содержащим последовательность SEQ ID NO: 208, и праймером, содержащим последовательность SEQ ID NO: 209; пары праймеров 47, представленной праймером, содержащим последовательность SEQ ID NO: 210, и праймером, содержащим последовательность SEQ ID NO: 211; пары праймеров 48, представленной праймером, содержащим последовательность SEQ ID NO: 212, и праймером, содержащим последовательность SEQ ID NO: 213; пары праймеров 49, представленной праймером, содержащим последовательность SEQ ID NO: 214, и праймером, содержащим последовательность SEQ ID NO: 215; пары праймеров 50, представленной праймером, содержащим последовательность SEQ ID NO: 216, и праймером, содержащим последовательность SEQ ID NO: 217; пары праймеров 51, представленной праймером, содержащим последовательность SEQ ID NO: 218, и праймером, содержащим последовательность SEQ ID NO: 219; пары праймеров 52, представленной праймером, содержащим последовательность SEQ ID NO: 220, и праймером, содержащим последовательность SEQ ID NO: 221, пары праймеров 53, представленной праймером, содержащим последовательность SEQ ID NO: 222, и праймером, содержащим последовательность SEQ ID NO: 223; пары праймеров 54, представленной праймером, содержащим последовательность SEQ ID NO: 224, и праймером, содержащим последовательность SEQ ID NO: 225, пары праймеров 55, представленной праймером, содержащим последовательность SEQ ID NO: 226, и праймером, содержащим последовательность SEQ ID NO: 227; пары праймеров 56, представленной праймером, содержащим последовательность SEQ ID NO: 228, и праймером, содержащим последовательность SEQ ID NO: 229; и пары праймеров 57, представленной праймером, содержащим последовательность SEQ ID NO: 230, и праймером, содержащим последовательность SEQ ID NO: 231; и

(b) интрогрессию аллели, представляющей интерес, в зародышевую плазму Zea mays, в которой отсутствует данная аллель. В некоторых вариантах выполнения изобретения аллель, представляющая интерес, содержит одну из последовательностей SEQ ID NO: l-117, 400, 401 или нуклеотидную последовательность, которая по меньшей мере на 85%, 90% или на 95% идентична по всей ее длине одной из последовательностей SEQ ID NO: l-117, 400 и 401. В некоторых вариантах выполнения изобретения представляющая интерес аллель является благоприятной аллелью и/или благоприятным гаплотипом, которая положительно коррелирует с признаком оптимизации водопотребления.

В некоторых вариантах выполнения изобретения благоприятная аллель содержит нуклеотидную последовательность, по меньшей мере на 90% идентичную одной или более последовательностей SEQ ID NO: 1-117, 400 и 401, и дополнительно содержит один или более определенных нуклеотидов и комбинаций позиций, раскрытых здесь. В качестве примера, но не ограничения, в некоторых вариантах выполнения изобретения благоприятная аллель содержит нуклеотидную последовательность, по меньшей мере на 90% идентичную:

SEQ ID NO: 1, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 115 последовательности SEQ ID NO: 1, нуклеотид А в позиции, которая соответствует позиции 270 последовательности SEQ ID NO: 1, нуклеотид Т в позиции, которая соответствует позиции 301 последовательности SEQ ID NO: 1, нуклеотид А в позиции, которая соответствует позиции 483 последовательности SEQ ID NO: 1, или любую их комбинацию;

SEQ ID NO: 2, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 100 и делецию в позиции, которая соответствует позиции 264-271 последовательности SEQ ID NO: 2, или их комбинацию;

SEQ ID NO: 3, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 216 последовательности SEQ ID NO: 3;

SEQ ID NO: 4, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 503 последовательности SEQ ID NO: 4;

SEQ ID NO: 5, и дополнительно содержит тетрануклеотид CGCG в позиции, которая соответствует позиции 818-821 последовательности SEQ ID NO: 5;

SEQ ID NO: 6, и дополнительно содержит нуклеотид G или А в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 6;

SEQ ID NO: 7, и дополнительно содержит динуклеотид GA в позиции, которая соответствует позициям 4497-4498 последовательности SEQ ID NO: 7, нуклеотид А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотид С или Т в позиции, которая соответствует позиции 4792 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4836 последовательности SEQ ID NO: 7, тринуклеотид ACT или ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7 или любую их комбинацию; или дополнительно содержит делецию в позициях 4497-4498 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4505 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4609 последовательности SEQ ID NO: 7, нуклеотид А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4792 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4836 последовательности SEQ ID NO: 7, нуклеотид С в позиции, которая соответствует позиции 4844 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4969 последовательности SEQ ID NO: 7, и тринуклеотид ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7;

SEQ ID NO: 8, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 8 и необязательно дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 390 последовательности SEQ ID NO: 8, и нуклеотид А в позиции, которая соответствует позиции 477 последовательности SEQ ID NO: 8, или любую их комбинацию;

SEQ ID NO: 9, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 292 последовательности SEQ ID NO: 9;

SEQ ID NO: 10, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 166 последовательности SEQ ID NO: 10;

SEQ ID NO: 11, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 148 последовательности SEQ ID NO: 11;

SEQ ID NO: 12, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 94 последовательности SEQ ID NO: 12;

SEQ ID NO: 13, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 35 последовательности SEQ ID NO: 13, нуклеотид С в позиции, которая соответствует позиции 148 последовательности SEQ ID NO: 1;3 или нуклеотид G в позиции, которая соответствует позиции 89 последовательности SEQ ID NO: 13, или любую их комбинацию;

SEQ ID NO: 14, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 432 последовательности SEQ ID NO: 14;

SEQ ID NO: 15, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 753 последовательности SEQ ID NO: 15;

SEQ ID NO: 16, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 755 последовательности SEQ ID NO: 16;

SEQ ID NO: 17, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 431 последовательности SEQ ID NO: 17;

SEQ ID NO: 18 и дополнительно содержит нуклеотид G или Т в позиции, которая соответствует позиции 518 последовательности SEQ ID NO: 18;

SEQ ID NO: 19, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 182 последовательности SEQ ID NO: 19, нуклеотид А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, или нуклеотид G или С в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, или любую их комбинацию, или последовательности, которая дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 182 последовательности SEQ ID N0: 19, нуклеотид А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотид G в позиции, которая соответствует позиции 330 последовательности SEQ ID NO: 19, и нуклеотид G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19;

SEQ ID NO: 20, и дополнительно содержит тетрануклеотид CTGG в позиции, которая соответствует позициям 773-776 последовательности SEQ ID NO: 20;

SEQ ID NO: 21, и дополнительно содержит делецию нуклеотида в позициях, которые соответствуют позициям 316-324 последовательности SEQ ID NO: 21, или последовательности, которая дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 61 последовательности SEQ ID NO: 21, нуклеотид С в позиции, которая соответствует позиции 200 последовательности SEQ ID NO: 21 и делецию в позиции, которая соответствуют позициям 316-324 последовательности SEQ ID NO: 21;

SEQ ID NO: 22, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 211 последовательности SEQ ID NO: 22,

SEQ ID NO: 23, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 116 последовательности SEQ ID NO: 23, нуклеотид А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 23, или их комбинацию;

SEQ ID NO: 24, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 746 последовательности SEQ ID NO: 24;

SEQ ID NO: 25, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 562 последовательности SEQ ID NO: 25;

SEQ ID NO: 26, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26;

SEQ ID NO: 27, и дополнительно содержит нуклеотид С или Т в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27, или которая необязательно дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 64 последовательности SEQ ID NO 27, и нуклеотид Т в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27;

SEQ ID NO: 28, и дополнительно содержит нуклеотид Т в позиции, которая соответствует позиции 496 последовательности SEQ ID NO: 28; или дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 98 последовательности SEQ ID NO: 28, нуклеотид Т в позиции, которая соответствует позиции 147 последовательности SEQ ID NO: 28, нуклеотид С в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 28, и нуклеотид Т в позиции, которая соответствует позиции 496 последовательности SEQ ID NO: 28;

SEQ ID NO: 29, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29;

SEQ ID NO: 30, и дополнительно содержит нуклеотид Т в позиции, которая соответствует позиции 259 последовательности SEQ ID NO: 30, нуклеотид G в позиции, которая соответствует позиции 398 последовательности SEQ ID NO: 30 или их комбинацию; или которая содержит нуклеотид Т в позиции, которая соответствует позиции 259 последовательности SEQ ID NO: 30, нуклеотид Т в позиции, которая соответствует позиции 296 последовательности SEQ ID NO: 30, нуклеотид А в позиции, которая соответствует позиции 398 последовательности SEQ ID NO: 30, и нуклеотид С в позиции, которая соответствует позиции 1057 последовательности SEQ ID NO: 30;

SEQ ID NO: 31, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 239 последовательности SEQ ID NO: 31;

SEQ ID NO: 32, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 208 последовательности SEQ ID NO: 32;

SEQ ID NO: 33, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33;

SEQ ID NO: 34, и дополнительно содержит динуклеотид СА в позиции, которая соответствует позиции 144-145 последовательности SEQ ID NO: 34, нуклеотид Т в позиции, которая соответствует позиции 169 последовательности SEQ ID NO: 34, нуклеотид А в позиции, которая соответствует позиции 537 последовательности SEQ ID NO: 34, или любую их комбинацию;

SEQ ID NO: 35, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 76 последовательности SEQ ID NO: 35;

SEQ ID NO: 36, и дополнительно содержит нуклеотид Т в позиции, которая соответствует позиции 698 последовательности SEQ ID NO: 36; или которая содержит нуклеотид С в позиции, которая соответствует позиции 500 последовательности SEQ ID NO: 36, нуклеотид G в позиции, которая соответствует позиции 568 последовательности SEQ ID NO: 36 и нуклеотид Т в позиции, которая соответствует позиции 698 последовательности SEQ ID NO: 36;

SEQ ID NO: 37, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 375 последовательности SEQ ID NO: 37, нуклеотид А или G в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 37, или их комбинацию;

SEQ ID NO: 38, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 38, нуклеотид А в позиции, которая соответствует позиции 342 последовательности SEQ ID NO: 38, или их комбинацию;

SEQ ID NO: 39, и дополнительно содержит нуклеотид G или С в позиции, которая соответствует позиции 445 последовательности SEQ ID NO: 39;

SEQ ID NO: 40, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 602 последовательности SEQ ID NO: 40;

SEQ ID NO: 41, и дополнительно содержит нуклеотид G или А в позиции, которая соответствует позиции 190 последовательности SEQ ID NO: 41, нуклеотид С в позиции, которая соответствует позиции 580 последовательности SEQ ID NO: 41, или их комбинацию;

SEQ ID NO: 42, и дополнительно содержит тринуклеотид ТТГ в позиции, которая соответствует позициям 266-268 последовательности SEQ ID NO: 42, или которая дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 238 последовательности SEQ ID NO: 42, делецию нуклеотидов, которая соответствует позициям 266-268 последовательности SEQ ID NO: 42, и нуклеотид С в позиции, которая соответствует позиции 808 последовательности SEQ ID NO: 42;

SEQ ID NO: 43, и дополнительно содержит нуклеотид С или А в позиции, которая соответствует позиции 708 последовательности SEQ ID NO: 43;

SEQ ID NO: 44, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44;

SEQ ID NO: 45, и дополнительно содержит нуклеотид Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45;

SEQ ID NO: 46, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46;

SEQ ID NO: 47, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 87 последовательности SEQ ID NO: 47;

SEQ ID NO: 48, и дополнительно содержит нуклеотид А или G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48;

SEQ ID NO: 49, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 650 последовательности SEQ ID NO: 49 и необязательно также дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 166 последовательности SEQ ID NO: 49, и нуклеотид А в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 49, и нуклеотид G в позиции, которая соответствует позиции 892 последовательности SEQ ID NO: 49;

SEQ ID NO: 50, и дополнительно содержит нуклеотид Т или А в позиции, которая соответствует позиции 541 последовательности SEQ ID NO: 50;

SEQ ID NO: 51, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

SEQ ID NO: 52 и дополнительно содержит нуклеотид С или G в позиции, которая соответствует позиции 442 последовательности SEQ ID NO: 52;

SEQ ID NO: 53 и дополнительно содержит нуклеотид С или Т в позиции, которая соответствует позиции 428 последовательности SEQ ID NO: 53, нуклеотид С в позиции, которая соответствует позиции 491 последовательности SEQ ID NO: 53, или их комбинацию; или которая дополнительно содержит нуклеотид С в позиции, которые соответствуют позициям 83,428,491 и 548 последовательности SEQ ID NO: 53;

SEQ ID NO: 54, и дополнительно содержит нуклеотид А в позиции, которая соответствует позиции 126 последовательности SEQ ID NO: 54;

SEQ ID NO: 55, и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 193 последовательности SEQ IDNO: 55;

SEQ ID NO: 56, и дополнительно содержит нуклеотид А или G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, нуклеотид С в позиции, которая соответствует позиции 516 последовательности SEQ ID NO: 56, или их комбинацию;

SEQ ID NO: 57 и дополнительно содержит нуклеотид Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57;

SEQ ID NO: 58, и дополнительно содержит нуклеотид С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

SEQ ID NO: 59 и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 729 последовательности SEQ ID NO: 59; и/или

SEQ ID NO: 60 и дополнительно содержит нуклеотид G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60.

Способы получения засухоустойчивого кукурузного растения могут содержать обнаружение в зародышевой плазме маркера, ассоциированного с повышенной засухоустойчивостью, и продуцирование кукурузного растения из упомянутой зародышевой плазмы. Зародышевая плазма может представлять собой не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения геном зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения геном зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391.

В некоторых вариантах выполнения изобретения аллели, содержащие маркер, ассоциированный с повышенной засухоустойчивостью, обнаруживают с применением множества зондов, выбранных из группы, состоящей из:

1) гаплотипа, содержащего последовательности SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 91, SEQ ID NO: 95, SEQ ID NO: 97, SEQ ID NO: 100, SEQ ID NO: 104 и SEQ ID NO: 109;

2) гаплотипа, содержащего последовательности SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 93, SEQ ID NO: 102, SEQ ID NO: 106, SEQ ID NO: 110 и SEQ ID NO: 111;

3) гаплотипа, содержащего последовательности SEQ ID NO: 85, SEQ ID NO: 88, SEQ ID NO: 90, SEQ ID NO: 93, SEQ ID NO: 96, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 105 и SEQ ID NO: 112;

4) гаплотипа, содержащего последовательности SEQ ID NO: 88, SEQ ID NO: 91, SEQ ID NO: 93, SEQ ID NO: 97, SEQ ID NO: 102, SEQ ID NO: 103 и SEQ ID NO: 105;

5) гаплотипа, содержащего последовательности SEQ ID NO: 87, SEQ ID NO: 92, SEQ ID NO: 94, SEQ ID NO: 97, SEQ ID NO: 101 SEQ ID NO: 107, SEQ ID NO: 108 SEQ ID NO: 109 и SEQ ID NO: 112; и

6) гаплотипа, содержащего последовательности SEQ ID NO: 88, SEQ ID NO: 91, SEQ ID NO: 98, SEQ ID NO: 101 и SEQ ID NO: 112.

В некоторых вариантах выполнения изобретения аллели, содержащие маркер, ассоциированный с повышенной засухоустойчивостью, обнаруживают с применением множества зондов, выбранных из группы, состоящей из:

1) гаплотипа, содержащего последовательности SEQ ID NO: 87, SEQ ID NO: 89 и SEQ ID NO: 95;

2) гаплотипа, содержащего последовательности SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 93, SEQ ID NO: 102 и SEQ ID NO: 106;

3) гаплотипа, содержащего последовательности SEQ ID NO: 85, SEQ ID NO: 88, SEQ ID NO: 90, SEQ ID NO: 93, SEQ ID NO: 98 и SEQ ID NO: 112;

4) гаплотипа, содержащего последовательности SEQ ID NO: 88, SEQ ID NO: 93 и SEQ ID NO:102;

5) гаплотипа, содержащего последовательности SEQ ID NO: 87, SEQ ID NO: 94, SEQ ID NO: 101 и SEQ ID NO: 112; и

6) гаплотипа, содержащего последовательности SEQ ID NO: 88, SEQ ID NO: 98, SEQ ID NO: 101 и SEQ ID NO: 112.

В некоторых вариантах выполнения изобретения аллель(и), содержащую маркер, ассоциированный с повышенной засухоустойчивостью, обнаруживают с помощью зонда или зондов, отобранного из группы, состоящей из:

1) последовательности SEQ ID NO: 87;

2) последовательности SEQ ID NO: 88;

3) гаплотипа, содержащего последовательности SEQ ID NO: 86 и SEQ ID NO: 87; и

4) гаплотипа, содержащего последовательности SEQ ID NO: 88 и SEQ ID NO: 90. В некоторых вариантах выполнения изобретения аллели, содержащие маркер, ассоциированный с повышенной засухоустойчивостью, обнаруживают в продуктах амплификации из образца нуклеиновой кислоты, изолированной из кукурузного растения или зародышевой плазмы, причем продукты амплификации продуцируют с применением пар праймеров амплификации, выбранных из группы, состоящей из последовательностей:

1) SEQ ID NO: 31 и SEQ ID NO: 59, SEQ ID NO: 33 и SEQ ID NO: 61, SEQ ID NO: 35 и SEQ ID NO: 63, SEQ ID NO: 39 и SEQ ID NO: 67, SEQ ID NO: 41 и SEQ ID NO: 69, SEQ ID NO: 44 и SEQ ID NO: 72, SEQ ID NO: 48 и SEQ ID NO: 76 и SEQ ID NO: 53 и SEQ ID NO: 81;

2) SEQ ID NO: 30 и SEQ ID NO: 58, SEQ ID NO: 31 и SEQ ID NO: 59, SEQ ID NO: 33 и SEQ ID NO: 61, SEQ ID NO: 37 и SEQ ID NO: 65, SEQ ID NO: 46 и SEQ ID NO: 74, SEQ ID NO: 50 SEQ ID NO: 78, SEQ ID NO: 54 и SEQ ID NO: 82, SEQ ID NO: 55 и SEQ ID NO: 83;

3) SEQ ID NO: 29 и SEQ ID NO: 57, SEQ ID NO: 32 и SEQ ID NO: 60, SEQ ID NO: 34 и SEQ ID NO: 62, SEQ ID NO: 37 и SEQ ID NO: 65, SEQ ID NO: 40 и SEQ ID NO: 68, SEQ ID NO: 42 и SEQ ID NO: 70, SEQ ID NO: 43 и SEQ ID NO: 71, SEQ ID NO: 48 и SEQ ID NO: 76, SEQ ID NO: 49 и SEQ ID NO: 77 и SEQ ID NO: 56 и SEQ ID NO: 84;

4) SEQ ID NO: 32 и SEQ ID NO: 60, SEQ ID NO: 35 и SEQ ID NO: 63, SEQ ID NO: 37 и SEQ ID NO: 65, SEQ ID NO: 41 и SEQ ID NO: 69, SEQ ID NO: 46 и SEQ ID NO: 74, SEQ ID NO: 47 и SEQ ID NO: 75 и SEQ ID NO: 49 и SEQ ID NO: 77;

5) SEQ ID NO: 31 и SEQ ID NO: 59, SEQ ID NO: 36 и SEQ ID NO: 64, SEQ ID NO: 38 и SEQ ID NO: 66, SEQ ID NO: 41 и SEQ ID NO: 69, SEQ ID NO: 45 и SEQ ID NO: 73, SEQ ID NO: 51 и SEQ ID NO: 79, SEQ ID NO: 52 и SEQ ID NO: 80, SEQ ID NO: 53 и SEQ ID NO: 81 и SEQ ID NO: 56 и SEQ ID NO: 84 и

6) SEQ ID NO: 32 и SEQ ID NO: 60, SEQ ID NO: 35 и SEQ ID NO: 63, SEQ ID NO: 42 и SEQ ID NO: 70, SEQ ID NO: 45 и SEQ ID NO: 73 и SEQ ID NO: 56 и SEQ ID NO: 84.

В некоторых вариантах выполнения изобретения аллели, содержащие маркер, ассоциированный с повышенной засухоустойчивостью, обнаруживают в продуктах амплификации из образца нуклеиновой кислоты, изолированной из кукурузного растения или зародышевой плазмы, причем продукты амплификации продуцируют с применением пар праймеров амплификации, выбранных из группы, состоящей из последовательностей:

1) SEQ ID NO: 31 и SEQ ID NO: 59, SEQ ID NO: 33 и SEQ ID NO: 61, и SEQ ID NO: 39 и SEQ ID NO: 67;

2) SEQ ID NO: 30 и SEQ ID NO: 58, SEQ ID NO: 31 и SEQ ID NO: 59, SEQ ID NO: 33 и SEQ ID NO: 61, SEQ ID NO: 37 и SEQ ID NO: 65, SEQ ID NO: 46 и SEQ ID NO: 74 и SEQ ID NO: 50 и SEQ ID NO: 78;

3) SEQ ID NO: 29 и SEQ ID NO: 57, SEQ ID NO: 32 и SEQ ID NO: 60, SEQ ID NO: 34 и SEQ ID NO: 62, SEQ ID NO: 37 и SEQ ID NO: 65, SEQ ID NO: 42 и SEQ ID NO: 70 и SEQ ID NO: 56 и SEQ ID NO: 84,

4) SEQ ID NO: 32 и SEQ ID NO: 60, SEQ ID NO: 37 и SEQ ID NO: 65 и SEQ ID NO: 46 и SEQ ID NO: 74;

5) SEQ ID NO: 31 и SEQ ID NO: 59, SEQ ID NO: 38 и SEQ ID NO: 66, SEQ ID NO: 45 и SEQ ID NO: 73 и SEQ ID NO: 56 и SEQ ID NO: 84; и

6) SEQ ID NO: 32 и SEQ ID NO: 60, SEQ ID NO: 42 и SEQ ID NO: 70, SEQ ID NO: 45 и SEQ ID NO: 73 и SEQ ID NO: 56 и SEQ ID NO: 84.

В некоторых вариантах выполнения изобретения аллель(и), содержащую маркер, ассоциированный с повышенной засухоустойчивостью, обнаруживают в продукте или продуктах амплификации из образца нуклеиновой кислоты, изолированной из кукурузного растения или зародышевой плазмы, причем продукты амплификации продуцируют с применением пар праймеров амплификации, выбранных из группы, состоящей из последовательностей:

1) SEQ ID NO: 31 и SEQ ID NO: 59;

2) SEQ ID NO: 32 и SEQ ID NO: 60;

3) SEQ ID NO: 30 и SEQ ID NO: 58 и SEQ ID NO: 31 и SEQ ID NO: 59; и

4) SEQ ID NO: 32 и SEQ ID NO: 60 и SEQ ID NO: 34 и SEQ ID NO: 62.

Способы интрогрессии аллели, ассоциированной с повышенной засухоустойчивостью, в кукурузное растение или зародышевую плазму могут содержать скрещивание первого кукурузного растения или зародышевой плазмы, содержащего упомянутую аллель (донор), со вторым кукурузным растением или зародышевой плазмой, у которого нет упомянутой аллели (рекуррентный родитель), и повторное возвратное скрещивание потомка, содержащего упомянутую аллель, с рекуррентным родителем. Потомки, содержащие упомянутую аллель, могут быть идентифицированы обнаружением в их геномах присутствия маркера, ассоциированного с повышенной засухоустойчивостью. Или донор или рекуррентный родитель или оба могут представлять собой не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения донор представляет собой CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno YEN 692. В некоторых вариантах выполнения изобретения геном донора является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения рекуррентный родитель представляет собой элитный сорт кукурузы. В некоторых вариантах выполнения изобретения геном рекуррентного родителя является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения рекуррентный родитель представляет собой сорт NP2391. В некоторых вариантах выполнения изобретения геном рекуррентного родителя является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к способам получения засухоустойчивого кукурузного растения. В некоторых вариантах выполнения изобретения раскрытые здесь способы содержат обнаружение в кукурузной зародышевой плазме присутствия маркера, ассоциированного с повышенной засухоустойчивостью, причем упомянутый маркер выбран из группы, состоящей из:

нуклеотида G в позиции, которая соответствует позиции 100 последовательности SEQ ID NO: 2, тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 116 последовательности SEQ ID NO: 23, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID N0: 57, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида G в позиции, которая соответствует позиции 562 последовательности SEQ ID NO: 25, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID N0: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида G в позиции, которая соответствует позиции 100, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 23, нуклеотида С в позиции, которая соответствует позиции 746 последовательности SEQ ID NO: 24, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

делеции нуклеотида в позиции, которая соответствует позициям 264-271 последовательности SEQ ID NO: 2, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, нуклеотида С в позиции, которая соответствует позиции 516 последовательности SEQ ID NO: 56, нуклеотида G в позиции, которая соответствует позиции 729 последовательности SEQ ID NO: 59, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 87 последовательности SEQ ID NO: 47, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, и нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, и нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48,

и их комбинаций, а также

продуцирование растения из упомянутой кукурузной зародышевой плазмы, тем самым продуцируя засухоустойчивое кукурузное растение.

Раскрытый в настоящем документе объект изобретения также относится к способам выявления и/или селекция засухоустойчивого кукурузного растения или зародышевой плазмы. Способы селекция засухоустойчивого кукурузного растения или зародышевой плазмы могут содержать скрещивание первого кукурузного растения или зародышевой плазмы со вторым кукурузным растением или зародышевой плазмой, причем упомянутое первое кукурузное растение или зародышевая плазма содержит маркер, ассоциированный с повышенной засухоустойчивостью, и селекция растения-потомка или зародышевой плазмы, содержащего упомянутый маркер, ассоциированный с повышенной засухоустойчивостью. Первое или второе кукурузное растение или зародышевая плазма или и кукурузное растение и зародышевая плазма могут представлять собой не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения первое кукурузное растение или зародышевая плазма представляет собой CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения геном первого кукурузного растения или зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения второе кукурузное растение или зародышевая плазма представляет собой элитный сорт кукурузы. В некоторых вариантах выполнения изобретения геном второго кукурузного растения или зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения второе кукурузное растение или зародышевая плазма представляет собой сорт NP2391. В некоторых вариантах выполнения изобретения геном второго кукурузного растения или зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391.

Таким образом, в некоторых вариантах выполнения изобретения способы содержат обнаружение в упомянутом кукурузном растении или зародышевой плазме присутствия маркера, ассоциированного с повышенной засухоустойчивостью, причем упомянутый маркер содержит множество аллелей, которые обнаруживают в продуктах амплификации из образца нуклеиновой кислоты, изолированной из упомянутого кукурузного растения или зародышевой плазмы, причем упомянутые продукты амплификации продуцировали с применением пар праймеров амплификации, выбранных из группы, состоящей из:

(I) SEQ ID NO: 120 и 121; SEQ ID NO: 130 и 131; SEQ ID NO: 160 и 161; SEQ ID NO: 180 и 181; SEQ ID NO: 208 и 209; SEQ ID NO: 222 и 223; SEQ ID NO: 224 и 225; и SEQ ID NO: 230 и 231;

(II) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 164 и 165; SEQ ID NO: 166 и 167; SEQ ID NO: 202 и 203; SEQ ID NO: 204 и 205; SEQ ID NO: 208 и 209; и SEQ ID NO: 212 и 213;

(III) SEQ ID NO: 120 и 121; SEQ ID NO: 130 и 131; SEQ ID NO: 160 и 161; SEQ ID NO: 162 и 163; SEQ ID NO: 172 и 173; SEQ ID NO: 202 и 203; SEQ ID NO: 206 и 207; SEQ ID NO: 208 и 209; SEQ ID NO: 220 и 221; и SEQ ID NO: 226 и 227;

(IV) SEQ ID NO: 120 и 121; SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 180 и 181; SEQ ID NO: 202 и 203; SEQ ID NO: 222 и 223; и SEQ ID NO: 226 и 227;

(V) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 168 и 169; SEQ ID NO: 180 и 181; SEQ ID NO: 202 и 203; SEQ ID NO: 220 и 221; SEQ ID NO: 222; и 223; SEQ ID NO: 228 и 229 и SEQ ID NO: 230 и 231;

(VI) SEQ IDNO: 130 и 131; SEQ IDNO: 152 и 153; SEQ IDNO: 172 и 173; SEQ IDNO: 220 и 221; и SEQ ID NO: 222 и 223;

(VII) SEQ ID NO: 130 и 131; SEQ ID NO: 208 и 209; SEQ ID NO: 222; и 223 и SEQ ID NO: 224 и 225;

(VIII) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 166 и 167; SEQ ID NO: 202 и 203; SEQ ID NO: 204 и 205; SEQ ID NO: 208 и 209; и SEQ ID NO: 212 и 213;

(IX) SEQ ID NO: 130 и 131; SEQ ID NO: 172 и 173; SEQ ID NO: 202 и 203; SEQ ID NO: 206 и 207; SEQ ID NO: 208 и 209; и SEQ ID NO: 220 и 221;

(X) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 202 и 203; и SEQ ID NO: 222 и 223;

(XI) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 202 и 203; и SEQ ID NO: 220 и 221;

(XII) SEQ ID NO: 130 и 131;

(XIII) SEQ ID NO: 130 и 131; и SEQ ID NO: 204 и 205; и

(XIV) SEQ ID NO: 130 и 131; и SEQ ID NO: 208 и 209,

таким образом выявляя и/или отбирая засухоустойчивое кукурузное растение или зародышевую плазму.

Раскрытый в настоящем документе объект изобретения также относится к способам получения засухоустойчивого кукурузного растения, содержащим обнаружение в кукурузной зародышевой плазме присутствия маркера, ассоциированного с повышенной засухоустойчивостью, причем упомянутый маркер содержит множество аллелей, которые обнаруживают в продуктах амплификации из образца нуклеиновой кислоты, изолированной из упомянутого кукурузного растения или зародышевой плазмы, причем упомянутый продукт амплификации продуцировали с применением пар праймеров амплификации, выбранных из группы, состоящей из:

(I) SEQ ID NO: 120 и 121; SEQ ID NO: 130 и 131; SEQ ID NO: 160 и 161; SEQ ID NO: 180 и 181; SEQ ID NO: 208 и 209; SEQ ID NO: 222 и 223; SEQ ID NO: 224 и 225; и SEQ ID NO: 230 и 231;

(II) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 164 и 165; SEQ ID NO: 166 и 167; SEQ ID NO: 202 и 203; SEQ ID NO: 204 и 205; SEQ ID NO: 208 и 209; и SEQ ID NO: 212 и 213;

(III) SEQ ID NO: 120 и 121; SEQ ID NO: 130 и 131; SEQ ID NO: 160 и 161; SEQ ID NO: 162 и 163; SEQ ID NO: 172 и 173; SEQ ID NO: 202 и 203; SEQ ID NO: 206 и 207; SEQ ID NO: 208 и 209; SEQ ID NO: 220 и 221; и SEQ ID NO: 226 и 227;

(IV) SEQ ID NO: 120 и 121; SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 180 и 181; SEQ ID NO: 202 и 203; SEQ ID NO: 222 и 223; и SEQ ID NO: 226 и 227;

(V) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 168 и 169; SEQ ID NO: 180 и 181; SEQ ID NO: 202 и 203; SEQ ID NO: 220 и 221; SEQ ID NO: 222 и 223; SEQ ID NO: 228 и 229; и SEQ ID NO: 230 и 231;

(VI) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 172 и 173; SEQ ID NO: 220 и 221; и SEQ ID NO: 222 и 223;

(VII) SEQ ID NO: 130 и 131; SEQ ID NO: 208 и 209; SEQ ID NO: 222 и 223; и SEQ ID NO: 224 и 225;

(VIII) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 166 и 167; SEQ ID NO: 202 и 203; SEQ ID NO: 204 и 205; SEQ ID NO: 208 и 209; и SEQ ID NO: 212 и 213;

(IX) SEQ ID NO: 130 и 131; SEQ ID NO: 172 и 173; SEQ ID NO: 202 и 203; SEQ ID NO: 206 и 207; SEQ ID NO: 208 и 209; и SEQ ID NO: 220 221;

(X) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 202 и 203; и SEQ ID NO: 222 и 223;

(XI) SEQ ID NO: 130 и 131; SEQ ID NO: 152 и 153; SEQ ID NO: 202 и 203; и SEQ ID NO: 220 и 221;

(XII) SEQ ID NO: 130 и 131;

(XIII) SEQ ID NO: 130 и 131; и SEQ ID NO: 204 и 205 и

(XIV) SEQ ID NO: 130 и 131; и SEQ ID NO: 208 и 209 и

продуцирование растения из упомянутой кукурузной зародышевой плазмы, тем самым продуцируя засухоустойчивое кукурузное растение.

Раскрытый в настоящем документе объект изобретения также относится к способам выявления и/или селекция засухоустойчивого кукурузного растения или зародышевой плазмы, содержащего обнаружение в упомянутом кукурузном растении или зародышевой плазме присутствия маркера, ассоциированного с повышенной засухоустойчивостью, причем упомянутый маркер содержит множество аллелей, которые обнаруживают с помощью множества зондов, выбранных из группы, состоящей из:

(I) SEQ ID NO: 348 и 349; SEQ ID NO: 350 и 351; SEQ ID NO: 360 и 361; SEQ ID NO: 372 и 373; SEQ ID NO: 382 и 383; SEQ ID NO: 388 и 389; SEQ ID NO: 382 и 383; и SEQ ID NO: 398 и 399;

(II) SEQ ID NO: 350 и 251; SEQ ID NO: 356 и 357; SEQ ID NO: 364 и 365; SEQ ID NO: 366 и 367; SEQ ID NO: 374 и 375; SEQ ID NO: 378 и 379; SEQ ID NO: 382 и 383; и SEQ ID NO: 384 и 385;

(III) SEQ ID NO: 348 и 349; SEQ ID NO: 352 и 353; SEQ ID NO: 358 и 359; SEQ ID NO: 362 и 363; SEQ ID NO: 370 и 371; SEQ ID NO: 374 и 375; SEQ ID NO: 382 и 383; SEQ ID NO: 386 и 387; и SEQ ID NO: 394 и 395;

(IV) SEQ ID NO: 346 и 347; SEQ ID NO: 352 и 353; SEQ ID NO: 356 и 357; SEQ ID NO: 372 и 373; SEQ ID NO: 388 и 389; и SEQ ID NO: 394 395;

(V) SEQ ID NO: 351 и 351; SEQ ID NO: 354 и 355; SEQ ID NO: 368 и 369; SEQ ID NO: 372 и 373; SEQ ID NO: 376 и 377; SEQ ID NO: 386 и 387; SEQ ID NO: 390 и 391; SEQ ID NO: 396 и 397; и SEQ ID NO: 398 и 399;

(VI) SEQ ID NO: 352 и 353; SEQ ID NO: 354 и 355; SEQ ID NO: 370 и 371; SEQ ID NO: 386 и 387; SEQ ID NO: 388 и 389;

(VII) SEQ ID NO: 350 и 351; SEQ ID NO: 382 и 383; SEQ ID NO: 388 и 389; и SEQ ID NO: 392 и 393;

(VIII) SEQ ID NO: 350 и 351; SEQ ID NO: 366 и 367; SEQ ID NO: 374 и 375; SEQ ID NO: 378 и 379; SEQ ID NO: 382 и 383; и SEQ ID NO: 384 и 385;

(IX) SEQ ID NO: 352 и 353; SEQ ID NO: 370 и 371; SEQ ID NO: 380 и 381; SEQ ID NO: 382 и 383; и SEQ ID NO: 386 и 387;

(X) SEQ ID NO: 352 и 353; SEQ ID NO: 356; и 357; и SEQ ID NO: 388 и 389;

(XI) SEQ ID NO: 350 и 351; SEQ ID NO: 354 и 355; SEQ ID NO: 376 и 377; и SEQ ID NO: 386 и 387;

(XII) SEQ ID NO: 350 и 351;

(XIII) SEQ ID NO: 352 и 353;

(XIV) SEQ ID NO: 350 и 351; и SEQ ID NO: 378 и 379 и

(XV) SEQ ID NO: 352 и 353; и SEQ ID NO: 382 и 383,

таким образом выявляя и/или отбирая засухоустойчивое кукурузное растение или зародышевую плазму.

Раскрытый в настоящем документе объект изобретения также относится к способам получения засухоустойчивого кукурузного растения, содержащего обнаружение в кукурузной зародышевой плазме присутствия маркера, ассоциированного с повышенной засухоустойчивостью, причем упомянутый маркер содержит множество аллелей, которые обнаруживают с помощью множества зондов, выбранных из группы, состоящей из:

(I) SEQ ID NO: 348 и 349; SEQ ID NO: 350 и 351; SEQ ID NO: 360 и 361; SEQ ID NO: 372 и 373; SEQ ID NO: 382 и 383; SEQ ID NO: 388 и 389; SEQ ID NO: 382 и 383; и SEQ ID NO: 398 и 399;

(II) SEQ ID NO: 350 и 251; SEQ ID NO: 356 и 357; SEQ ID NO: 364 и 365; SEQ ID NO: 366 и 367; SEQ ID NO: 374 и 375; SEQ ID NO: 378 и 379; SEQ ID NO: 382 и 383; и SEQ ID NO: 384 и 385;

(III) SEQ ID NO: 348 и 349; SEQ ID NO: 352 и 353; SEQ ID NO: 358 и 359; SEQ ID NO: 362 и 363; SEQ ID NO: 370 и 371; SEQ ID NO: 374 и 375; SEQ ID NO: 382 и 383; SEQ ID NO: 386 и 387; и SEQ ID NO: 394 и 395;

(IV) SEQ ID NO: 346 и 347; SEQ ID NO: 352 и 353; SEQ ID NO: 356 и 357; SEQ ID NO: 372 и 373; SEQ ID NO: 388 и 389; и SEQ ID NO: 394 395;

(V) SEQ ID NO: 351 и 351; SEQ ID NO: 354 и 355; SEQ ID NO: 368 и 369; SEQ ID NO: 372 и 373; SEQ ID NO: 376 и 377; SEQ ID NO: 386 и 387; SEQ ID NO: 390 и 391; SEQ ID NO: 396 и 397; и SEQ ID NO: 398 и 399;

(VI) SEQ ID NO: 352 и 353; SEQ ID NO: 354 и 355; SEQ ID NO: 370 и 371; SEQ ID NO: 386 и 387; SEQ ID NO: 388 и 389;

(VII) SEQ ID NO: 350 и 351; SEQ ID NO: 382 и 383; SEQ ID NO: 388 и 389; и SEQ ID NO: 392 и 393;

(VIII) SEQ ID NO: 350 и 351; SEQ ID NO: 366 и 367; SEQ ID NO: 374 и 375; SEQ ID NO: 378 и 379; SEQ ID NO: 382 и 383; и SEQ ID NO: 384 и 385;

(IX) SEQ ID NO: 352 и 353; SEQ ID NO: 370 и 371; SEQ ID NO: 380 и 381; SEQ ID NO: 382 и 383; и SEQ ID NO: 386 и 387;

(X) SEQ ID NO: 352 и 353; SEQ ID NO: 356; и 357; и SEQ ID NO: 388 и 389;

(XI) SEQ ID NO: 350 и 351; SEQ ID NO: 354 и 355; SEQ ID NO: 376 и 377; и SEQ ID NO: 386 и 387;

(XII) SEQ ID NO: 350 и 351;

(XIII) SEQ ID NO: 352 и 353;

(XIV) SEQ ID NO: 350 и 351; и SEQ ID NO: 378 и 379 и

(XV) SEQ ID NO: 352 и 353; и SEQ ID NO: 382 и 383, и

продуцирование растения из упомянутой кукурузной зародышевой плазмы, тем самым продуцируя засухоустойчивое кукурузное растение. В некоторых вариантах выполнения изобретения раскрытых здесь способов кукурузное растение или зародышевая плазма представляет собой не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения геном упомянутого кукурузного растения или зародышевой плазмы является по меньшей мере на 95% идентичным таковому NP2391.

Раскрытый в настоящем документе объект изобретения также относится в некоторых вариантах выполнения изобретения к способам селекция засухоустойчивого кукурузного растения или зародышевой плазмы. В некоторых вариантах выполнения изобретения способы содержат скрещивание первого кукурузного растения или зародышевой плазмы со вторым кукурузным растением или зародышевой плазмой, причем упомянутое первое кукурузное растение или зародышевая плазма содержит в своем геноме гаплотип, ассоциированный с повышенной засухоустойчивостью, причем упомянутый гаплотип выбран из группы, состоящей из:

нуклеотида G в позиции, которая соответствует позиции 100 последовательности SEQ ID NO: 2, тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 116 последовательности SEQ ID NO: 23, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида G в позиции, которая соответствует позиции 562 последовательности SEQ ID NO: 25, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида G в позиции, которая соответствует позиции 100, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 23, нуклеотида С в позиции, которая соответствует позиции 746 последовательности SEQ ID NO: 24, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

делеции нуклеотида в позиции, которая соответствует позициям 264-271 последовательности SEQ ID NO: 2, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, нуклеотида С в позиции, которая соответствует позиции 516 последовательности SEQ ID NO: 56, нуклеотида G в позиции, которая соответствует позиции 729 последовательности SEQ ID NO: 59, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 87 последовательности SEQ ID NO: 47, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, и нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, и нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48,

и их комбинаций, а также

селекция растения-потомка или зародышевой плазмы, который обладает упомянутым гаплотипом в своем геноме, тем самым отбирая засухоустойчивое кукурузное растение или зародышевую плазму. В некоторых вариантах выполнения изобретения или первое кукурузное растение или зародышевая плазма или второе кукурузное растение или зародышевая плазма или оба представляет собой не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения геном упомянутого первого кукурузного растения или зародышевой плазмы является по меньшей мере на 95% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения первое кукурузное растение или зародышевая плазма выбрана из группы, состоящей из CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 и Tuxpeno VEN 692.

В некоторых вариантах выполнения изобретения, относящихся к раскрытым здесь способам, геном упомянутого второго кукурузного растения или зародышевой плазмы является по меньшей мере на 95% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения второе кукурузное растение или зародышевая плазма представляет собой элитный сорт кукурузы. В некоторых вариантах выполнения изобретения элитный сорт кукурузы представляет собой NP2391.

IV. Продуцирование трансгенными способами кукурузных растений, несущих улучшенные признаки

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения относится к применению полиморфизмов (включая, но не ограничиваясь SNP) или частей, предоставляющих признак, для получения кукурузного растения, несущего признак, введением последовательности нуклеиновой кислоты, содержащей ассоциированную с признаком аллель и/или гаплотип полиморфизма, в реципиентное растение.

Донорное растение с последовательностью нуклеиновой кислоты, которая содержит аллель и/или гаплотип признака оптимизации водопотребления, может быть перенесено реципиентному растению, у которого отсутствует данная аллель и/или гаплотип. Последовательность нуклеиновой кислоты может быть перенесена скрещиванием донорного растения, несущего признак оптимизации водопотребления, с реципиентным растением, не несущим данный признак, (например, интрогрессией), трансформацией, трансформацией или слиянием протопластов, способом получения удвоенных гаплоидов, "спасением" зародыша или любой другой системой переноса нуклеиновой кислоты. Затем, при желании, могут быть отобраны потомки-растения, содержащие одну или более раскрытых в настоящем документе аллелей и/или гаплотипов признака оптимизации водопотребления. Последовательность нуклеиновой кислоты, содержащая аллель и/или гаплотип признака оптимизации водопотребления, может быть изолирована из донорного растения, применяя способы, известные в данной области техники, и изолированная последовательность нуклеиновой кислоты может трансформировать реципиентное растение трансгенными способами. Такое может произойти с вектором, в гамете или в другом подходящем элементе переноса, таком как баллистическая частица, покрытая последовательностью нуклеиновой кислоты.

Трансформация растений обычно предусматривает конструкцию вектора экспрессии, который будут функционировать в клетках растений, и включает в себя последовательность нуклеиновой кислоты, которая содержит аллель и/или гаплотип, ассоциированную с признаком оптимизации водопотребления, и данный вектор может содержать ген, предоставляющий признак оптимизации водопотребления. Данный ген обычно находится под контролем или функционально связан с одним или более регуляторным элементом, таким, как промотер. Экспрессионный вектор может содержать одну или более таких комбинаций функционально связанный ген/регуляторный элемент, при условии, что по меньшей мере один из генов, содержащихся в комбинациях, кодирует признак оптимизации водопотребления. Вектор(ы) может находиться в виде плазмиды и может быть применен отдельно или в комбинации с другими плазмидами, чтобы предоставить трансгенные растения, которые обладают лучшей оптимизацией водопотребления, применяя способы трансформации, известные в данной области техники, такие как система трансформации Agrobacterium.

Трансформированные клетки часто содержат селектируемый маркер, позволяющий идентифицировать трансформацию. Селектируемый маркер обычно приспособлен для выявления отрицательной селекцией (ингибированием роста клеток, которые не содержат ген селективного маркера) или положительной селекцией (при скрининге продукта, кодируемого геном селективного маркера). Множество обычно применяемых генов селективных маркеров для трансформации растений известны в данной области техники и включают в себя, например, гены, которые кодируют ферменты, метаболически обезвреживающие селектирующий химический агент, который может быть антибиотиком или гербицидом, или гены, которые кодируют измененную мишень, которая нечувствительна к ингибитору. Несколько способов позитивной селекции известны в данной области техники, такие, как селекция на маннозе. Альтернативно, для получения растений без вышеупомянутых маркерных генов может быть применена трансформация без маркера, способы которой также известны в данной области техники.

V. Засухоустойчивые кукурузные растения и зародышевые плазмы

Раскрытый в настоящем документе объект изобретения относится к засухоустойчивым кукурузным растениям и зародышевым плазмам. Как обсуждалось выше, способы раскрытого в настоящем документе объекта изобретения могут быть применены для того, чтобы выявлять, производить и/или отбирать засухоустойчивое кукурузное растение или зародышевую плазму. В дополнение к способам, описанным выше, засухоустойчивое кукурузное растение или зародышевая плазма может быть произведено любым способом, посредством которого маркер, ассоциированный с повышенной засухоустойчивостью, вводится в кукурузу или зародышевую плазму, включая, но не ограничиваясь ими, трансформацию, трансформацию или слияние протопластов, способ получения удвоенных гаплоидов, "спасение" зародыша или любую другую систему переноса нуклеиновой кислоты.

В некоторых вариантах выполнения изобретения кукурузное растение или зародышевая плазма содержит не встречающийся в природе сорт кукурузы. В некоторых вариантах выполнения изобретения кукурузное растение или зародышевая плазма является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения геном упомянутого кукурузного растения или зародышевой плазмы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391.

Кукурузное растение или зародышевая плазма может быть потомком скрещивания между элитным сортом кукурузы и сортом кукурузы, который содержит аллель, ассоциированную с повышенной засухоустойчивостью. В некоторых вариантах выполнения изобретения элитный сорт кукурузы представляет собой NP2391. В некоторых вариантах выполнения изобретения геном элитного сорта кукурузы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391. В некоторых вариантах выполнения изобретения сорт, содержащий аллель, ассоциированную с повышенной засухоустойчивостью, представляет собой CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения геном сорта, содержащего аллель, ассоциированную с повышенной засухоустойчивостью, является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692.

Кукурузное растение или зародышевая плазма может быть потомком интрогрессии, причем рекуррентный родитель представляет собой элитный сорт кукурузы и донор содержит аллель, ассоциированную с повышенной засухоустойчивостью. В некоторых вариантах выполнения изобретения рекуррентный родитель представляет собой NP2391. В некоторых вариантах выполнения изобретения геном рекуррентного родителя является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391. В некоторых вариантах выполнения изобретения донор представляет собой CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения геном донора является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692.

Кукурузное растение или зародышевая плазма может быть потомком скрещивания между первым элитным сортом кукурузы (например, испытательная линия) и потомком скрещивания между вторым элитным сортом кукурузы (например, рекуррентный родитель) и сортом кукурузы, который содержит аллель, ассоциированную с повышенной засухоустойчивостью (например, донор). В некоторых вариантах выполнения изобретения первый элитный сорт кукурузы представляет собой NP2460. В некоторых вариантах выполнения изобретения генома первого элитного сорт кукурузы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2460. В некоторых вариантах выполнения изобретения второй элитный сорт кукурузы представляет собой NP2391. В некоторых вариантах выполнения изобретения геном второго элитного сорта кукурузы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391. В некоторых вариантах выполнения изобретения сорт, содержащий аллель, ассоциированную с повышенной засухоустойчивостью, представляет собой CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения геном сорта, содержащего аллель, ассоциированную с повышенной засухоустойчивостью, является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692.

Кукурузное растение или зародышевая плазма может быть потомком скрещивания между первым элитным сортом кукурузы и потомком интрогрессии, причем рекуррентный родитель представляет собой второй элитный сорт кукурузы и донор содержит аллель, ассоциированную с повышенной засухоустойчивостью. В некоторых вариантах выполнения изобретения первый элитный сорт кукурузы представляет собой NP2460. В некоторых вариантах выполнения изобретения геном первого элитного сорт кукурузы является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2460. В некоторых вариантах выполнения изобретения рекуррентный родитель представляет собой NP2391. В некоторых вариантах выполнения изобретения геном рекуррентного родителя является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому NP2391. В некоторых вариантах выполнения изобретения донор представляет собой CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения геном донора является по меньшей мере на около 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% или 100% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692.

Таким образом, раскрытый в настоящем документе объект изобретения относится в некоторых вариантах выполнения изобретения к инбредным растениям Zea mays, содержащим одну или более аллелей, ассоциированных с желаемым признаком оптимизации водопотребления. В некоторых вариантах выполнения изобретения:

(I) признак оптимизации водопотребления представляет собой урожайность зерна при стандартном проценте влажности (YGSMN), и благоприятная аллель содержит нуклеотидную последовательность, содержащую А в нуклеотидной позиции 270 последовательности SEQ ID NO: I, G в нуклеотидной позиции 216 последовательности SEQ ID NO: 3; А в нуклеотидной позиции 503 последовательности SEQ ID NO: 4; тетрануклеотид CGCG в нуклеотидных позициях 818-821 последовательности SEQ ID NO: 5; G в нуклеотидной позиции 254 последовательности SEQ ID NO: 6; динуклеотид GA в нуклеотидных позициях 4497-4498 в последовательности SEQ ID NO: 7; А в нуклеотидной позиции 4641 последовательности SEQ ID NO: 7; С или Т в нуклеотидной позиции 4792 последовательности SEQ ID NO: 7; Т в нуклеотидной позиции 4836 последовательности SEQ ID NO: 7; тринуклеотид ACT или ТСС в нуклеотидных позициях 4979-4981 последовательности SEQ ID NO: 7; С в нуклеотидной позиции 292 последовательности SEQ ID NO: 9; А в нуклеотидной позиции 166 последовательности SEQ ID NO: 10; С в нуклеотидной позиции 94 последовательности SEQ ID NO: 12; С в нуклеотидной позиции 86 последовательности SEQ ID NO: 13; G в нуклеотидной позиции 89 последовательности SEQ ID NO: 13; А в нуклеотидной позиции 753 последовательности SEQ ID NO: 15; G в нуклеотидной позиции 755 последовательности SEQ ID NO: 16; G в нуклеотидной позиции 431 последовательности SEQ ID NO: 17; А в нуклеотидной позиции 309 последовательности SEQ ID NO: 19; тетрануклеотид CTGG в нуклеотидных позициях 773-776 последовательности SEQ ID NO: 20; делецию нуклеотидных позиций 316-324 последовательности SEQ ID NO: 21; G в нуклеотидной позиции 562 последовательности SEQ ID NO: 25; Т в нуклеотидной позиции 254 последовательности SEQ ID NO: 27; Т в нуклеотидной позиции 496 последовательности SEQ ID NO: 28; G в нуклеотидной позиции 398 последовательности SEQ ID NO: 30; G в нуклеотидной позиции 239 последовательности SEQ ID NO: 31; G в нуклеотидной позиции 208 в последовательности SEQ ID NO: 32, динуклеотид СА в позиции, которая соответствует позициям 144-145 последовательности SEQ ID NO: 34, нуклеотид Т в позиции, которая соответствует позиции 169 последовательности SEQ ID NO: 34; нуклеотид G в позиции, которая соответствует позиции 76 последовательности SEQ ID NO: 35, нуклеотид Т в позиции, которая соответствует позиции 698 SEQ ID NO: 36; нуклеотид А или G в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 37; нуклеотид G в позиции, которая соответствует позиции 445 последовательности SEQ ID NO: 39; нуклеотид А в позиции, которая соответствует позиции 602 последовательности SEQ ID NO: 40; нуклеотид G в позиции, которая соответствует позиции 190 последовательности SEQ ID NO: 41; нуклеотид С в позиции, которая соответствует позиции 580 последовательности SEQ ID NO: 41; тринуклеотид TTG в позиции, которая соответствует позициям 266-268 последовательности SEQ ID NO: 42; нуклеотид А в позиции, которая соответствует позиции 708 последовательности SEQ ID NO: 43; нуклеотид G в позиции, которая соответствует позиции 650 последовательности SEQ ID NO: 49; нуклеотид А или Т в позиции, которая соответствует позиции 541 последовательности SEQ ID NO: 50; нуклеотид Т в позиции, которая соответствует позиции 428 последовательности SEQ ID NO: 53; нуклеотид С в позиции, которая соответствует позиции 491 последовательности SEQ ID NO: 53; и/или нуклеотид А в позиции, которая соответствует позиции 126 последовательности SEQ ID NO: 54; и/или

(II) признак оптимизации водопотребления представляет собой влажность зерна в период сбора урожая (GMSTP), и благоприятная аллель содержит нуклеотидную последовательность, содержащую нуклеотид А в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 6; нуклеотид А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 8; нуклеотид С в позиции, которая соответствует позиции 292 последовательности SEQ ID NO: 9; нуклеотид А в позиции, которая соответствует позиции 166 последовательности SEQ ID NO: 10; нуклеотид G в позиции, которая соответствует позиции 148 последовательности SEQ ID NO: 11; нуклеотид А в позиции, которая соответствует позиции 35 последовательности SEQ ID N0: 13; нуклеотид G в позиции, которая соответствует позиции 432 последовательности SEQ ID NO: 14; нуклеотид G в позиции, которая соответствует позиции 518 последовательности SEQ ID NO: 18; нуклеотид А в позиции, которая соответствует позиции 182 последовательности SEQ ID NO: 19; нуклеотид С в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19; тетрануклеотид CTGG в позиции, которая соответствует позициям 773-776 последовательности SEQ ID NO: 20; нуклеотид G в позиции, которая соответствует позиции 211 последовательности SEQ ID NO: 22; нуклеотид G в позиции, которая соответствует позиции 562 последовательности SEQ ID NO: 25; нуклеотид С в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27; нуклеотид G в позиции, которая соответствует позиции 239 последовательности SEQ ID NO: 31; динуклеотид СА в позиции, которая соответствует позиции 144-145 последовательности SEQ ID NO: 34; нуклеотид А в позиции, которая соответствует позиции 537 последовательности SEQ ID NO: 34; нуклеотид А в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 37; нуклеотид С в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 38; нуклеотид А в позиции, которая соответствует позиции 342 последовательности SEQ ID NO: 38; нуклеотид С в позиции, которая соответствует позиции 445 последовательности SEQ ID NO: 39; нуклеотид А в позиции, которая соответствует позиции 190 последовательности SEQ ID NO: 41; нуклеотид С в позиции, которая соответствует позиции 708 последовательности SEQ ID NO: 43; нуклеотид G в позиции, которая соответствует позиции 650 последовательности SEQ ID NO: 49; нуклеотид С в позиции, которая соответствует позиции 428 последовательности SEQ ID NO: 53; или нуклеотид С в позиции, которая соответствует позиции 491 последовательности SEQ ID NO: 53; и/или

(III) признак оптимизации водопотребления представляет собой вес зерна на участок (GWTPN), и благоприятная аллель содержит нуклеотидную последовательность, содержащую Т в нуклеотидной позиции 518 последовательности SEQ ID NO: 18.

Раскрытый в настоящем документе объект изобретения также относится в некоторых вариантах выполнения изобретения к растениям Zea mays, содержащим по меньшей мере одну благоприятную аллель, способствующую оптимизации водопотребления, и данная аллель определяется по меньшей мере одной маркерной аллелью, содержащей полиморфный сайт, и характеризуется продуктом ПЦР-амплификации, полученным в реакции ПЦР с применением олигонуклеотидного праймера ПЦР или множества олигонуклеотидных праймеров, в частности, пары олигонуклеотидных праймеров ПЦР или нескольких пар праймеров, но особенно пары праймеров, выбранной из группы, состоящей из пары праймеров 1, представленной праймером, содержащим последовательность SEQ ID NO: 118, и праймером, содержащим последовательность SEQ ID NO: 119; пары праймеров 2, представленной праймером, содержащим последовательность SEQ ID NO: 120, и праймером, содержащим последовательность SEQ ID NO: 121, пары праймеров 3, представленной праймером, содержащим последовательность SEQ ID NO: 122, и праймером, содержащим последовательность SEQ ID NO: 123; пары праймеров 4, представленной праймером, содержащим последовательность SEQ ID NO: 124, и праймером, содержащим последовательность SEQ ID NO: 125, пары праймеров 5, представленной праймером, содержащим последовательность SEQ ID NO: 126, и праймером, содержащим последовательность SEQ ID NO: 127; пары праймеров 6, представленной праймером, содержащим последовательность SEQ ID NO: 128, и праймером, содержащим последовательность SEQ ID NO: 129; пары праймеров 7, представленной праймером, содержащим последовательность SEQ ID NO: 130, и праймером, содержащим последовательность SEQ ID NO: 131; пары праймеров 8, представленной праймером, содержащим последовательность SEQ ID NO: 132, и праймером, содержащим последовательность SEQ ID NO: 133; пары праймеров 9, представленной праймером, содержащим последовательность SEQ ID NO: 134, и праймером, содержащим последовательность SEQ ID NO: 135; пары праймеров 10, представленной праймером, содержащим последовательность SEQ ID NO: 136, и праймером, содержащим последовательность SEQ ID NO: 137; пары праймеров 11, представленной праймером, содержащим последовательность SEQ ID NO: 138, и праймером, содержащим последовательность SEQ ID NO: 139; пары праймеров 12, представленной праймером, содержащим последовательность SEQ ID NO: 140, и праймером, содержащим последовательность SEQ ID NO: 141; пары праймеров 13, представленной праймером, содержащим последовательность SEQ ID NO: 142, и праймером, содержащим последовательность SEQ ID NO: 143; пары праймеров 14, представленной праймером, содержащим последовательность SEQ ID NO: 144, и праймером, содержащим последовательность SEQ ID NO: 145; пары праймеров 15, представленной праймером, содержащим последовательность SEQ ID NO: 146, и праймером, содержащим последовательность SEQ ID NO: 147; пары праймеров 16, представленной праймером, содержащим последовательность SEQ ID NO: 148, и праймером, содержащим последовательность SEQ ID NO: 149; пары праймеров 17, представленной праймером, содержащим последовательность SEQ ID NO: 150, и праймером, содержащим последовательность SEQ ID NO: 151; пары праймеров 18, представленной праймером, содержащим последовательность SEQ ID NO: 152, и праймером, содержащим последовательность SEQ ID NO: 153, пары праймеров 19, представленной праймером, содержащим последовательность SEQ ID NO: 154, и праймером, содержащим последовательность SEQ ID NO: 155; пары праймеров 20, представленной праймером, содержащим последовательность SEQ ID NO: 156, и праймером, содержащим последовательность SEQ ID NO: 157; пары праймеров 21, представленной праймером, содержащим последовательность SEQ ID NO: 158, и праймером, содержащим последовательность SEQ ID NO: 159, пары праймеров 22, представленной праймером, содержащим последовательность SEQ ID NO: 160, и праймером, содержащим последовательность SEQ ID NO: 161; пары праймеров 23, представленной праймером, содержащим последовательность SEQ ID NO: 162, и праймером, содержащим последовательность SEQ ID NO: 163; пары праймеров 24, представленной праймером, содержащим последовательность SEQ ID NO: 164, и праймером, содержащим последовательность SEQ ID NO: 165; пары праймеров 25, представленной праймером, содержащим последовательность SEQ ID NO: 166, и праймером, содержащим последовательность SEQ ID NO: 167; пары праймеров 26, представленной праймером, содержащим последовательность SEQ ID NO: 168, и праймером, содержащим последовательность SEQ ID NO: 169; пары праймеров 27, представленной праймером, содержащим последовательность SEQ ID NO: 170, и праймером, содержащим последовательность SEQ ID NO: 171; пары праймеров 28, представленной праймером, содержащим последовательность SEQ ID NO: 172, и праймером, содержащим последовательность SEQ ID NO: 173, пары праймеров 29, представленной праймером, содержащим последовательность SEQ ID NO: 174, и праймером, содержащим последовательность SEQ ID NO: 175; пары праймеров 30, представленной праймером, содержащим последовательность SEQ ID NO: 176, и праймером, содержащим последовательность SEQ ID NO: 177; пары праймеров 31, представленной праймером, содержащим последовательность SEQ ID NO: 178, и праймером, содержащим последовательность SEQ ID NO: 179; пары праймеров 32, представленной праймером, содержащим последовательность SEQ ID NO: 180, и праймером, содержащим последовательность SEQ ID NO: 181; пары праймеров 33, представленной праймером, содержащим последовательность SEQ ID NO: 182, и праймером, содержащим последовательность SEQ ID NO: 183; пары праймеров 34, представленной праймером, содержащим последовательность SEQ ID NO: 184, и праймером, содержащим последовательность SEQ ID NO: 185; пары праймеров 35, представленной праймером, содержащим последовательность SEQ ID NO: 186, и праймером, содержащим последовательность SEQ ID NO: 187; пары праймеров 36, представленной праймером, содержащим последовательность SEQ ID NO: 188, и праймером, содержащим последовательность SEQ ID NO: 189; пары праймеров 37, представленной праймером, содержащим последовательность SEQ ID NO: 190, и праймером, содержащим последовательность SEQ ID NO: 191; пары праймеров 38, представленной праймером, содержащим последовательность SEQ ID NO: 192, и праймером, содержащим последовательность SEQ ID NO: 193; пары праймеров 39, представленной праймером, содержащим последовательность SEQ ID NO: 194, и праймером, содержащим последовательность SEQ ID NO: 195; пары праймеров 40, представленной праймером, содержащим последовательность SEQ ID NO: 196, и праймером, содержащим последовательность SEQ ID NO: 197; пары праймеров 41, представленной праймером, содержащим последовательность SEQ ID NO: 198, и праймером, содержащим последовательность SEQ ID NO: 199; пары праймеров 42, представленной праймером, содержащим последовательность SEQ ID NO: 200, и праймером, содержащим последовательность SEQ ID NO: 201; пары праймеров 43, представленной праймером, содержащим последовательность SEQ ID NO: 202, и праймером, содержащим последовательность SEQ ID NO: 203; пары праймеров 44, представленной праймером, содержащим последовательность SEQ последовательность SEQ ID NO: 204, и праймером, содержащим последовательность SEQ ID NO: 205, пары праймеров 45, представленной праймером, содержащим последовательность SEQ ID NO: 206, и праймером, содержащим последовательность SEQ ID NO: 207; пары праймеров 46, представленной праймером, содержащим последовательность SEQ ID NO: 208, и праймером, содержащим последовательность SEQ ID NO: 209; пары праймеров 47, представленной праймером, содержащим последовательность SEQ ID NO: 210, и праймером, содержащим последовательность SEQ ID NO: 211; пары праймеров 48, представленной праймером, содержащим последовательность SEQ ID NO: 212, и праймером, содержащим последовательность SEQ ID NO: 213; пары праймеров 49, представленной праймером, содержащим последовательность SEQ ID NO: 214, и праймером, содержащим последовательность SEQ ID NO: 215; пары праймеров 50, представленной праймером, содержащим последовательность SEQ ID NO: 216, и праймером, содержащим последовательность SEQ ID NO: 217; пары праймеров 51, представленной праймером, содержащим последовательность SEQ ID NO: 218, и праймером, содержащим последовательность SEQ ID NO: 219; пары праймеров 52, представленной праймером, содержащим последовательность SEQ ID NO: 220, и праймером, содержащим последовательность SEQ ID NO: 221, пары праймеров 53, представленной праймером, содержащим последовательность SEQ ID NO: 222, и праймером, содержащим последовательность SEQ ID NO: 223; пары праймеров 54, представленной праймером, содержащим последовательность SEQ ID NO: 224, и праймером, содержащим последовательность SEQ ID NO: 225, пары праймеров 55, представленной праймером, содержащим последовательность SEQ ID NO: 226, и праймером, содержащим последовательность SEQ ID NO: 227; пары праймеров 56, представленной праймером, содержащим последовательность SEQ ID NO: 228, и праймером, содержащим последовательность SEQ ID NO: 229; и пары праймеров 57, представленной праймером, содержащим последовательность SEQ ID NO: 230, и праймером, содержащим последовательность SEQ ID NO: 231.

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения относится к не встречающемуся в природе кукурузному растению или зародышевой плазме, имеющему в своем геноме гаплотип, ассоциированный с повышенной засухоустойчивостью. Причем в некоторых вариантах выполнения изобретения упомянутый гаплотип выбран из группы, состоящей из:

нуклеотида G в позиции, которая соответствует позиции 100 последовательности SEQ ID NO: 2, тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 116 последовательности SEQ ID NO: 23, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида G в позиции, которая соответствует позиции 562 последовательности SEQ ID NO: 25, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида G в позиции, которая соответствует позиции 100, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 23, нуклеотида С в позиции, которая соответствует позиции 746 последовательности SEQ ID NO: 24, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

делеции нуклеотида в позиции, которая соответствует позициям 264-271 последовательности SEQ ID NO: 2, нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида С в позиции, которая соответствует позиции 486 последовательности SEQ ID NO: 58;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27, нуклеотида А в позиции, которая соответствует позиции 391 последовательности SEQ ID NO: 33, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, нуклеотида С в позиции, которая соответствует позиции 516 последовательности SEQ ID NO: 56, нуклеотида G в позиции, которая соответствует позиции 729 последовательности SEQ ID NO: 59, и нуклеотида G в позиции, которая соответствует позиции 267 последовательности SEQ ID NO: 60;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, нуклеотида А в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56, и нуклеотида Т в позиции, которая соответствует позиции 173 последовательности SEQ ID NO: 57;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 1271 последовательности SEQ ID NO: 26, нуклеотида А в позиции, которая соответствует позиции 266 последовательности SEQ ID NO: 44, нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46, нуклеотида А в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 111 последовательности SEQ ID NO: 51;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида С в позиции, которая соответствует позиции 258 последовательности SEQ ID NO: 29, нуклеотида G в позиции, которая соответствует позиции 87 последовательности SEQ ID NO: 47, нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотида А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, и нуклеотида G в позиции, которая соответствует позиции 237 последовательности SEQ ID NO: 56;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, нуклеотида G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19, нуклеотида Т в позиции, которая соответствует позиции 475 последовательности SEQ ID NO: 45, и нуклеотида G в позиции, которая соответствует позиции 193 последовательности SEQ ID NO: 55;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7;

тринуклеотида ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7, и нуклеотида С в позиции, которая соответствует позиции 386 последовательности SEQ ID NO: 46;

нуклеотида А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, и нуклеотида G в позиции, которая соответствует позиции 472 последовательности SEQ ID NO: 48,

и их комбинаций.

В некоторых вариантах выполнения изобретения геном упомянутого кукурузного растения или зародышевая плазма является по меньшей мере на 95% идентичным таковому элитного сорта кукурузы. В некоторых вариантах выполнения изобретения элитный сорт кукурузы представляет собой NP2391. В некоторых вариантах выполнения изобретения кукурузное растение или зародышевая плазма происходит от скрещивания элитного сорта кукурузы с экзотическим сортом кукурузы. В некоторых вариантах выполнения изобретения геном упомянутого элитного сорта кукурузы является по меньшей мере на 95% идентичным таковому NP2391. В некоторых вариантах выполнения изобретения элитный сорт кукурузы представляет собой NP2391.

В некоторых вариантах выполнения изобретения геном упомянутого экзотического сорта кукурузы является по меньшей мере на 95% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения 32. кукурузное растение или зародышевая плазма по любому п.п.28-30, причем экзотический сорт кукурузы выбирается из группы, состоящей из CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 и Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения упомянутое кукурузное растение или зародышевая плазма происходит от скрещивания первого элитного сорта кукурузы с потомком скрещивания между вторым элитным сортом кукурузы и экзотическим сортом кукурузы.

В некоторых вариантах выполнения изобретения геном упомянутого первого элитного сорта кукурузы является по меньшей мере на 95% идентичным таковому NP2460. В некоторых вариантах выполнения изобретения первый элитный сорт кукурузы представляет собой NP2460.

В некоторых вариантах выполнения изобретения геном упомянутого второго элитного сорта кукурузы является по меньшей мере на 95% идентичным таковому NP2391. В некоторых вариантах выполнения изобретения второй элитный сорт кукурузы представляет собой NP2391.

В некоторых вариантах выполнения изобретения геном упомянутого экзотического сорта кукурузы является по меньшей мере на 95% идентичным таковому CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 или Tuxpeno VEN 692. В некоторых вариантах выполнения изобретения упомянутый экзотический сорт кукурузы выбран из группы, состоящей из CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 и Tuxpeno VEN 692.

Раскрытый в настоящем документе объект изобретения также относится в некоторых вариантах выполнения изобретения к зерну и/или ядрам, продуцируемым из кукурузного растения, описанного здесь.

VI. Другие композиции

В некоторых вариантах выполнения изобретения раскрытый в настоящем документе объект изобретения также относится к парам праймеров, состоящим из прямого праймера и обратного праймера, причем праймеры способны амплифицировать в реакции ПЦР фрагмент маркерной аллели, который генетически сцеплен с или идентичен благоприятной аллели, способствующей фенотипу оптимизации водопотребления, причем упомянутая маркерная аллель содержит полиморфизм, и данный полиморфизм является диагностическим для благоприятной аллели. В некоторых вариантах выполнения изобретения пары праймеров отобраны из группы, состоящей из пары праймеров 1, представленной праймером, содержащим последовательность SEQ ID NO: 118, и праймером, содержащим последовательность SEQ ID NO: 119; пары праймеров 2, представленной праймером, содержащим последовательность SEQ ID NO: 120, и праймером, содержащим последовательность SEQ ID NO: 121, пары праймеров 3, представленной праймером, содержащим последовательность SEQ ID NO: 122, и праймером, содержащим последовательность SEQ ID NO: 123; пары праймеров 4, представленной праймером, содержащим последовательность SEQ ID NO: 124, и праймером, содержащим последовательность SEQ ID NO: 125, пары праймеров 5, представленной праймером, содержащим последовательность SEQ ID NO: 126, и праймером, содержащим последовательность SEQ ID NO: 127; пары праймеров 6, представленной праймером, содержащим последовательность SEQ ID NO: 128, и праймером, содержащим последовательность SEQ ID NO: 129; пары праймеров 7, представленной праймером, содержащим последовательность SEQ ID NO: 130, и праймером, содержащим последовательность SEQ ID NO: 131; пары праймеров 8, представленной праймером, содержащим последовательность SEQ ID NO: 132, и праймером, содержащим последовательность SEQ ID NO: 133; пары праймеров 9, представленной праймером, содержащим последовательность SEQ ID NO: 134, и праймером, содержащим последовательность SEQ ID NO: 135; пары праймеров 10, представленной праймером, содержащим последовательность SEQ ID NO: 136, и праймером, содержащим последовательность SEQ ID NO: 137; пары праймеров 11, представленной праймером, содержащим последовательность SEQ ID NO: 138, и праймером, содержащим последовательность SEQ ID NO: 139; пары праймеров 12, представленной праймером, содержащим последовательность SEQ ID NO: 140, и праймером, содержащим последовательность SEQ ID NO: 141; пары праймеров 13, представленной праймером, содержащим последовательность SEQ ID NO: 142, и праймером, содержащим последовательность SEQ ID NO: 143; пары праймеров 14, представленной праймером, содержащим последовательность SEQ ID NO: 144, и праймером, содержащим последовательность SEQ ID NO: 145; пары праймеров 15, представленной праймером, содержащим последовательность SEQ ID NO: 146, и праймером, содержащим последовательность SEQ ID NO: 147; пары праймеров 16, представленной праймером, содержащим последовательность SEQ ID NO: 148, и праймером, содержащим последовательность SEQ ID NO: 149; пары праймеров 17, представленной праймером, содержащим последовательность SEQ ID NO: 150, и праймером, содержащим последовательность SEQ ID NO: 151; пары праймеров 18, представленной праймером, содержащим последовательность SEQ ID NO: 152, и праймером, содержащим последовательность SEQ ID NO: 153, пары праймеров 19, представленной праймером, содержащим последовательность SEQ ID NO: 154, и праймером, содержащим последовательность SEQ ID NO: 155; пары праймеров 20, представленной праймером, содержащим последовательность SEQ ID NO: 156, и праймером, содержащим последовательность SEQ ID NO: 157; пары праймеров 21, представленной праймером, содержащим последовательность SEQ ID NO: 158, и праймером, содержащим последовательность SEQ ID NO: 159, пары праймеров 22, представленной праймером, содержащим последовательность SEQ ID NO: 160, и праймером, содержащим последовательность SEQ ID NO: 161; пары праймеров 23, представленной праймером, содержащим последовательность SEQ ID NO: 162, и праймером, содержащим последовательность SEQ ID NO: 163; пары праймеров 24, представленной праймером, содержащим последовательность SEQ ID NO: 164, и праймером, содержащим последовательность SEQ ID NO: 165; пары праймеров 25, представленной праймером, содержащим последовательность SEQ ID NO: 166, и праймером, содержащим последовательность SEQ ID NO: 167; пары праймеров 26, представленной праймером, содержащим последовательность SEQ ID NO: 168, и праймером, содержащим последовательность SEQ ID NO: 169; пары праймеров 27, представленной праймером, содержащим последовательность SEQ ID NO: 170, и праймером, содержащим последовательность SEQ ID NO: 171; пары праймеров 28, представленной праймером, содержащим последовательность SEQ ID NO: 172, и праймером, содержащим последовательность SEQ ID NO: 173, пары праймеров 29, представленной праймером, содержащим последовательность SEQ ID NO: 174, и праймером, содержащим последовательность SEQ ID NO: 175; пары праймеров 30, представленной праймером, содержащим последовательность SEQ ID NO: 176, и праймером, содержащим последовательность SEQ ID NO: 177; пары праймеров 31, представленной праймером, содержащим последовательность SEQ ID NO: 178, и праймером, содержащим последовательность SEQ ID NO: 179; пары праймеров 32, представленной праймером, содержащим последовательность SEQ ID NO: 180, и праймером, содержащим последовательность SEQ ID NO: 181; пары праймеров 33, представленной праймером, содержащим последовательность SEQ ID NO: 182, и праймером, содержащим последовательность SEQ ID NO: 183; пары праймеров 34, представленной праймером, содержащим последовательность SEQ ID NO: 184, и праймером, содержащим последовательность SEQ ID NO: 185; пары праймеров 35, представленной праймером, содержащим последовательность SEQ ID NO: 186, и праймером, содержащим последовательность SEQ ID NO: 187; пары праймеров 36, представленной праймером, содержащим последовательность SEQ ID NO: 188, и праймером, содержащим последовательность SEQ ID NO: 189; пары праймеров 37, представленной праймером, содержащим последовательность SEQ ID NO: 190, и праймером, содержащим последовательность SEQ ID NO: 191; пары праймеров 38, представленной праймером, содержащим последовательность SEQ ID NO: 192, и праймером, содержащим последовательность SEQ ID NO: 193; пары праймеров 39, представленной праймером, содержащим последовательность SEQ ID NO: 194, и праймером, содержащим последовательность SEQ ID NO: 195; пары праймеров 40, представленной праймером, содержащим последовательность SEQ ID NO: 196, и праймером, содержащим последовательность SEQ ID NO: 197; пары праймеров 41, представленной праймером, содержащим последовательность SEQ ID NO: 198, и праймером, содержащим последовательность SEQ ID NO: 199; пары праймеров 42, представленной праймером, содержащим последовательность SEQ ID NO: 200, и праймером, содержащим последовательность SEQ ID NO: 201; пары праймеров 43, представленной праймером, содержащим последовательность SEQ ID NO: 202, и праймером, содержащим последовательность SEQ ID NO: 203; пары праймеров 44, представленной праймером, содержащим последовательность SEQ последовательность SEQ ID NO: 204, и праймером, содержащим последовательность SEQ ID NO: 205, пары праймеров 45, представленной праймером, содержащим последовательность SEQ ID NO: 206, и праймером, содержащим последовательность SEQ ID NO: 207; пары праймеров 46, представленной праймером, содержащим последовательность SEQ ID NO: 208, и праймером, содержащим последовательность SEQ ID NO: 209; пары праймеров 47, представленной праймером, содержащим последовательность SEQ ID NO: 210, и праймером, содержащим последовательность SEQ ID NO: 211; пары праймеров 48, представленной праймером, содержащим последовательность SEQ ID NO: 212, и праймером, содержащим последовательность SEQ ID NO: 213; пары праймеров 49, представленной праймером, содержащим последовательность SEQ ID NO: 214, и праймером, содержащим последовательность SEQ ID NO: 215; пары праймеров 50, представленной праймером, содержащим последовательность SEQ ID NO: 216, и праймером, содержащим последовательность SEQ ID NO: 217; пары праймеров 51, представленной праймером, содержащим последовательность SEQ ID NO: 218, и праймером, содержащим последовательность SEQ ID NO: 219; пары праймеров 52, представленной праймером, содержащим последовательность SEQ ID NO: 220, и праймером, содержащим последовательность SEQ ID NO: 221, пары праймеров 53, представленной праймером, содержащим последовательность SEQ ID NO: 222, и праймером, содержащим последовательность SEQ ID NO: 223; пары праймеров 54, представленной праймером, содержащим последовательность SEQ ID NO: 224, и праймером, содержащим последовательность SEQ ID NO: 225, пары праймеров 55, представленной праймером, содержащим последовательность SEQ ID NO: 226, и праймером, содержащим последовательность SEQ ID NO: 227; пары праймеров 56, представленной праймером, содержащим последовательность SEQ ID NO: 228, и праймером, содержащим последовательность SEQ ID NO: 229; и пары праймеров 57, представленной праймером, содержащим последовательность SEQ ID NO: 230, и праймером, содержащим последовательность SEQ ID NO: 231.

ПРИМЕРЫ

Следующие примеры относятся к иллюстративным вариантам выполнения изобретения. В свете настоящего раскрытия и общего уровня данной области техники специалистам будет понятно, что следующие примеры предназначены для применения только в качестве образцов и что многочисленные изменения, модификации и изменения могут быть применены, не выходя из объема раскрытого в настоящем документе объекта изобретения.

ВВЕДЕНИЕ В ПРИМЕРЫ

Для оценки значения аллелей при засухе разную зародышевую плазму скринировали в контролируемых полевых экспериментах, содержащих контрольную обработку с полным орошением и обработку с ограниченным орошением. Цель обработки с полным орошением заключалась в обеспечении того, чтобы вода не ограничивала продуктивность урожая. Напротив, цель обработки с ограниченным орошением состояла в обеспечении того, чтобы вода стала основным лимитирующим ограничителем урожая зерна. Основные эффекты (например, обработка и генотип) и взаимодействия (например, генотип x обработка) можно определить, когда две обработки применяют в поле рядом друг с другом. Более того, для каждого генотипа в панели могут быть количественно определены фенотипы, связанные с засухой, тем самым позволяя проводить ассоциации маркер : признак.

На практике способ обработки с ограниченным орошением может широко варьировать в зависимости от зародышевой плазмы, которую скринируют, типа почвы, местных климатических условий, водоснабжения перед началом сезона и водоснабжения в сезон, и это только некоторые факторы. Первоначально выявляют место, где сезонные осадки невелики (чтобы свести к минимуму вероятность непреднамеренного оводнения), и которое подходит для выращивания сельскохозяйственных культур. В дополнение, может быть важным определение сроков подвергания стрессу, так что определяют цель, для того чтобы обеспечить последовательность скрининга в данном месте из года в год или от местоположения к местоположению. Также могут быть учтены интенсивность обработки или, в некоторых случаях, потеря урожая, желаемая в случае обработки с ограниченным орошением. При выборе интенсивности обработки, которая является слишком легкой, генотипическая изменчивость может не выявиться. Выбор интенсивности обработки, которая является слишком тяжелой, может приводить к слишком большим погрешностям. Как только определены сроки стрессового воздействия и описана интенсивность обработки, орошение можно осуществлять таким образом, чтобы удовлетворять данным целям.

Общие способы оценки и оценки засухоустойчивости можно найти у Salekdeh et al., 2009 и в патентах США №№6635803, 7314757, 7332651 и 7432416.

Пример 1

Оценка фенотипических данных

В целях идентификации аллелей, которые были ассоциированы с оптимизацией водопотребления, гибриды выращивали на разных стадиях в разных местоположениях и оценивали оптимизацию водопотребления. В настоящем анализе были проверены четыре признака на стадии 2-3: YGSMN (урожайность зерна при стандартном проценте влажности %), GMSTP (влажность зерна в период сбора урожая), GWTPN (вес зерна на участок) и PYREC (восстановление процента урожайности). Определяли распределение фенотипических данных гибридов линий по местоположению и тестерам для YGSMN, GMSTP, GWTPN и PYREC. Средние значения для YGSMN, GMSTP и GWTPN составили 165,41 бушелей/акр, 18,94% и 20,0 бушелей/участок, соответственно. Фенотипические данные выбранных исследований включали в себя информацию с четырех местоположений. Число наблюдений в данных местоположениях составляло от 311 до 1456. В общей сложности 575 инбредов было оценено в скрещиваниях с до 47 различными инбредными тестерами. Число наблюдений инбредных линий, скрещенных с определенным тестером, колебалось от 242 до 575 по всем местоположениям.

При тестировании ассоциаций между потенциальными маркерами и данными тремя признаками применяли два аналитических подхода: смешанные линейные модели - (TASSEL) и Quantitative Inbred Pedigree Disequilibrium Test (далее по тексту "QIPDT2").

Пример 2

Фенотипические корректировки

Применение данных, полученных на стадии 2-3 для картирования ассоциаций не является традиционным подходом, и существует несколько аспектов его анализа, которые необходимо рассмотреть. Более того, для фенотипирования были использованы гибриды с различными тестерами, а не линии как таковые, в то время как оба статистические способы (TASSEL и QIPDT2) были разработаны для данных на инбредных линиях, которые требуют единственного значения признака для каждой линии. Чтобы получить единственное значение признака для каждой инбредной линии, которое можно сравнить с ее генотипом, было необходимо предпринять фенотипические корректировки, которые помогают контролировать эффект тестера и/или местоположения. Дополнительные факторы (например, зрелость группы) не рассматривались, чтобы избежать дополнительного сокращения степеней свободы или размера подмножеств образцов.

Для выполнения фенотипических корректировок анализы смешанных линейных моделей проводили в двух различных статистических пакетах SAS/JMP и R, которые были предназначены для того, чтобы подходы со смешанной моделью для большого набора данных были использованы правильно. Поскольку подходы дали очень близкие результаты, результаты SAS/JMP были применены для последующих стадий анализа данных.

При анализе "полная модель" эффекты как местоположения, так и тестеров включались в местоположений модель следующим образом:

Фенотип = эффект местоположения (случайный) + эффект линии (случайный) + эффект тестера (фиксированный) + ошибка

Модель "по местоположению" была применена для каждого из 4-х выбранных местоположений следующим образом:

Фенотип = эффект линии (случайный)+эффект тестера (фиксированный) + ошибка Модель "по тестеру" была применена для каждого из 4-х выбранных подмножеств линий, скрещенных с определенным тестером, следующим образом:

Фенотип = эффект местоположения (случайный) + эффект линии (случайный) + ошибка

Модели оценивали на сходимость, оценку ковариационных оценок, значимость фиксированных эффектов и т.д. Наилучшие линейные несмещенные предсказатели (BLUP) для эффектов линий применяли в качестве скорректированных генотипов. В некоторых случаях предлагаемые смешанные модели не сходились или возникала проблема с оценкой эффектов линий, обусловленной отсутствием репликаций. В каждом таком случае из модели убирали эффект линии и применяли остаточные значения как грубый способ улавливания эффектов линии (дополнительную репликацию получали позже в анализе ассоциаций, когда каждый двуаллельный локус был представлен общим числом инбредных линий каждой группы).

Решение для случайных эффектов линий (BLUP) получали из смешанных моделей, которые сходились.

Пример 3

Генотипические данные

В общей сложности 2189 линий, для которых фенотипические данные собрали в любом из выбранных исследований, также были генотипированы. В общей сложности 95 полиморфизмов, соответствующих около 57 генам-кандидатам, оценили в инбредных линиях. После удаления мономорфных случаев и SNP с частотами аллелей, составляющими менее чем около 0,01, 85 полиморфизмов-кандидатов проверили на ассоциацию в TASSEL. Кроме того, 153 случайных полиморфизмов генотипировали в инбредных линиях. После фильтрации 149 случайных полиморфизмов также проанализировали на ассоциацию в TASSEL как анонимные кандидаты.

Пример 4

Методологии анализа ассоциаций

Картирование на основе анализа ассоциаций (часто называемое картированием на основе анализа неравновесного сцепления) стало мощным инструментом для раскрытия генетического контроля сложных признаков. Картирование на основе анализа ассоциаций опирается на большое число поколений и, следовательно, рекомбинационные возможности в истории вида, которые позволяют удаление ассоциации между QTL и любым маркером, не сцепленным тесно с ним (Jannink & Walsh, 2001). Одним из наиболее важных шагов в анализе картирования на основе анализа ассоциаций является контроль за структурой популяции. Структура популяции может привести к ложным корреляциям между маркерами и фенотипами, увеличивающим возможность ложноположительного результата.

Анализ родства. Способ, реализованный в TASSEL, применяет матрицу родства в подходе смешанных моделей для контроля генетических корреляций между линиями. Анализ родства выполняли с применением генотипических данных из 153 случайно выбранных SNP тестов. Был принят способ оценки родственных отношений, основанный на Zhao et al., 2007. Были созданы скрипты для вычисления коэффициентов родства, которые были определены просто как доля общих аллелей для каждой пары индивидов (К pShared). Zhao et al применяли долю общих гаплотипов как коэффициенты их родства. Матрица коэффициентов К включали в TASSEL для некоторых моделей ассоциаций для оценки контроля за ложными ассоциациями благодаря тесной взаимосвязанности линий в панели. Калькулятор матрицы коэффициента родства. Матрицу К рассчитывали для набора инбредных линий. Коэффициент родства kij был рассчитан как доля общих аллелей для всех локусов между двумя линиями i и j, и kij=kji, kii=1.

Анализ структуры популяции. Анализ с программным обеспечением Structure (Pritchard et al., 2000) выполнили с применением генотипических данных 153 случайно выбранных SNP тестов. Использовали модель сцепления, которая включала примесь популяции и сцепление между маркерами. Вероятности структур популяций с k в пределах от 1 до 15 субпопуляций, определяли с помощью предварительного периода в 50000 с последующими 50000 повторениями МСМС. Проводили четыре репликации для каждого значения k. Оцененный логарифм вероятности данных Pr (X|К) для каждого значения k откладывали на графике, чтобы выбрать соответствующее число субпопуляций для включения в ковариационную матрицу.

Вероятность для детерминанты k увеличивалась вместе с числом проверенных 1 с.Значение k, равное 10, применяли как число субпопуляций для анализа ассоциаций. Таблицу с выведенной родословной, содержащую долю каждой субпопуляции, вносящей вклад в родословную каждого инбреда, применяли в качестве ряда ковариантов в модели тестирования ассоциаций.

Анализ главных компонент. Метод главных компонент (РСА) или "Анализ собственных значений" был применен в качестве альтернативы программному обеспечению Structure для выведения структуры популяции из генотипических данных. РСА имеет некоторые преимущества по сравнению с Structure, такие как возможность обрабатывать большие наборы данных за значительно более короткие периоды времени и отсутствие необходимости выбора специфического количества субпопуляций. РСА выполняли с помощью программного обеспечения SMARTPCA, который является частью Eigenstrat (Price et al., 2006). Десять собственных векторов и соответствующих им собственных значений для каждой из линий применяли в качестве другой ковариантной серии для моделей ассоциации TASSEL.

Пример 5

Анализ с применением TASSEL

Модели ассоциаций в TASSEL. В таблице 6 приведены различные модели, применяемые в TASSEL. Для фенотипов YGSMN и GMSTP, скорректированных по местоположениям и тестерам, запускали и сравнивали шесть (6) моделей. Только модель 4 запускали для всех подмножеств местоположений и тестеров.

Таблица 6
Модели ассоциаций, применяемые в TASSEL
Общие линейные модели Смешанные линейные модели
1) Скоррект. Фенотип = Маркер 4) Скоррект. Фенотип = Маркер + K (pshared)*
2) Скоррект. Фенотип = Маркер + Q (Structure) 5) Скоррект. Фенотип = Маркер + K (pshared) + Q (Structure)
3) Скоррект. Фенотип = Маркер + РСА (собственные значения) 6) Скоррект. Фенотип = Маркер + K (pshared) + РСА (собственные значения)

Процедура GLM в TASSEL использовала возможность выполнять перестановки, чтобы узнать уровень ошибок эксперимента с поправкой на накопление ложнопозитивных результатов при выполнении множественных сравнений. Для данных по оптимизации водопотребления применяли в общей сложности 10000 перестановок. Процедура MLM не включала в себя поправку на многократное тестирование. Поправку Бонферрони применяли апостериори, чтобы избежать накопления ложнопозитивных результатов.

Пример 6

Анализ ассоциаций с применением QIPDT2

QIPDT2 (Quantitative Inbred Pedigree Disequilibrium Test 2) применяли для картирования ассоциаций, что имеет преимущество использования информации об инбредной родословной, которая может дать более высокую статистическую достоверность и меньше ложнопозитивных результатов с лучшим контролем структуры популяции (Stich et al. 2006, TAG 113: 1121-1130). QIPDT2 представляет собой улучшение QIPDT, изначально разработанного для картирования генов человеческих болезней (Zhang et al., 2001. Genetic Epidemiol 21: 370-375 - См. ссылку у Stich et al. 2006). Преимущество QIPDT2 заключается в том, что данный способ может быть легко применим к материалам из ранних стадий разведения (например, стадия 2 и 3), потому что фенотипические данные по таким материалам были собраны для селекционных целей. Вообще говоря, материалы из ранних стадий разведения являются аналогичными линиям в хорошо известных популяциях сгруппированных ассоциаций (NAM), которые были разработаны для применения как сцепления, так и неравновесного сцепления для картирования QTL. Оригинальный QIPDT является статистическим критерием Т, который рассчитывается следующим образом (Stich et al. 2006):

T = k = 1 p D k k = 1 p D k 2 , следуя из N(0, 1) при H0,

D k = i = 1 n k U j k , E ( k = 1 p D k ) = 0 при H0,

U j k = i = 1 t j k ( Y i j k Y k ¯ ) X i j k ,

Y k ¯ - среднее значение признака для улучшенной родословной k,

xijk - значение маркера (-1, 0, 1).

В общем подходе значение Т рассчитывается для каждого SNP, и его значение p находят из стандартного нормального распределения. Хотя такой подход применим для проверки статистической значимости ассоциации, он не дает ни оценки величины генетического эффекта SNP, ни относительного генетического вклада в общую фенотипическую дисперсию.

Таким образом, общий подход QIPDT был улучшен с помощью регрессионной модели, которая называется здесь „QIPDT2"; оригинальный метод называется тогда QIPDT 1.

Модель QIPDT2 можно записать в виде:

yki01xki+eki,

где yki представляет собой скорректированное фенотипические значение для индивидуального i в родословной k; xki представляет собой генотипическое значение кодируемого маркера; β0 представляет собой интерсепт; β1 представляет собой коэффициент регрессии или рассматриваемый генетический эффект SNP, о котором идет речь. Обратите внимание, что способы корректировки фенотипических значений и генотипов кодируемых маркеров являются теми же, которые применяли Stich et al. 2006. С помощью данной модели для каждого SNP могут быть оценены как генетический эффект, так и R2. Важно отметить, что фенотипические данные были предварительно скорректированы, чтобы исключить эффекты от тестеров и/или местоположений, прежде чем они были скорректированы дальше для структуры родословной, данная корректировка была необходима для реализации сложной модели в QIPDT2. Способы предварительной корректировки были такими же, как описано ранее для анализа TASSEL. Модели ассоциаций в QIPDT2. Данные по ассоциациям были получены для всего набора данных и отдельных подмножеств для местоположений местоположений и тестеров с использованием обоих подходов QIPDT1 и QIPDT2. Как и в анализе с TASSEL, фенотипические данные были скорректированы для местоположений и/или тестеров, в зависимости от того, какое подмножество применяли. В результате получали одно скорректированное фенотипическое значение (либо значения линий BLUP или остаточные модельные значения) для каждого инбреда, которое содержит комбинацию всех генетических эффектов для инбреда и только случайного остаточного значения.

Перед анализом QIPDT все инбреды были сгруппированы в различные ядерные семьи, в соответствии с их родительскими линиями. Применение ядерной семьи должно был дать более контролируемую структуру популяции, чем улучшенные родословные, которые применяли у Stich et al. 2006. Для QIPDT 1 тестовая статистика (значение Z) и соответствующее значение р были оценены для каждого SNP; для QIPDT2 тестовая статистика (значение Z) и соответствующее значение p были получены из простой регрессионной модели, наряду с R2, для каждого SNP. QIPDT2 был более достоверным, чем QIPDT 1, с точки зрения значений p. Поскольку QIPDT2 также давал оценки (R2) для относительного вклада каждого SNP, QIPDT2 применяли для отчетности о данных по ассоциациям, полученных с использованием подхода QIPDT.

Пример 7

Значение и вклад благоприятных аллелей

в фенотипы оптимизации водопотребления

Были рассчитаны значения p и наблюдаемые вклады каждой благоприятной аллели на фенотипы оптимизации водопотребления YGSMN, GMSTP и GWTPN. Данные значения приведены в таблицах 7-9. В таблицах 7-9 термин „вклад" относится к вкладу, который, как было рассчитано, благоприятная аллель оказывала на наблюдаемый фенотип с учетом средних значений 201,68 бушелей/акр, 18,95% и 25,29 бушелей/участок для YGSMN, GMSTP и GWTPN, соответственно. В таблицах 7-9 „вклад" выражается в бушелях/акр, процентах и бушелях/участок для YGSMN, GMSTP и GWTPN, соответственно.

Таблица 7
Вклады благоприятных аллелей в увеличение оптимизации водопотребления, выявленные TASSEL и OIPDT2
SEQ ID NO: Позиция SNP F U Признак Вклад Значение P
12 292 С А GMSTP 0.973536 0.000509
37 145 С А GMSTP 0.2769 0.000315
39 169 Т А GMSTP 0.2721405 0.00034675
42 386 А G GMSTP 0.379311 0.000192
51 708 С А GMSTP 0.31989 0.000287
55 491 С G GMSTP 0.544187 0.0001335
56 428 G А GMSTP 0.347253 0.000573
Таблица 8
Вклад благоприятных аллелей в повышение оптимизации водопотребления, выявленные TASSEL
SEQ ID NO: Позиция SNP F U Признак Значение P Вклад
1 428 А G YGSMN 0.0084 11.3070462
2 216 G Т YGSMN 0.000054594 4.15
3 506 А G YGSMN 0.0005806 2.187
4 818-821 - CGCG YGSMN 0.0035 14.5878562
5 254 G A YGSMN 0.00022694 1.6857
A G GMSTP 5.62×10-7 0.3725
6 186-188 G A YGSMN 0.007 6.8929277
7 526 A С YGSMN 0.000211972 3.3256
7* 526 A С YGSMN 0.0026 7.3903226
8 615-616 - GA YGSMN 0.03 5.665
9 375 A G YGSMN 0.0143 6.5897654
10 331 A G YGSMN 0.000435023 3.01738
10* 331 A G YGSMN 0.0026 7.3903226
11 210 A G GMSTP 0.2431269 0.599
12 292 С A YGSMN 0.0031 4.2222
13 166 A G YGSMN 0.0263 5.4031514
A G GMSTP 0.000204245 1.1278
15 94 С G YGSMN 4.38×10-6 1.3181
15* 94 С G YGSMN 0.0309 7.624524
16 35 A Т GMSTP 0.00095646 0.086
17 146 С A YGSMN 0.0071 8.327576
18 149 G С YGSMN 0.000650794 1.312
19 432 G A GMSTP 5.47×10-15 0.0393
20 753 A G YGSMN 0.0025 2.1981
21 755 G A YGSMN 0.000486298 2.2198
22 431 G С GMSTP 5.43×10-6 0.4939
23 518 G Т GMSTP 7.35×10-5 1.2629
24 387 С G GMSTP 0.00039766 0.4522
25 660 А G GMSTP 0.00039306 0.4219
26 536 Т С YGSMN 0.000740946 0.7923
27 773-776 С G YGSMN 0.000138841 0.9736
С G GMSTP 0.000124719 0.7974
28 310 Т А YGSMN 1.87×10-7 1.433
29 211 G А GMSTP 0.00034028 0.5831
30 401 G А YGSMN 0.0102 6.4804254
G А GMSTP 0.000177776 0.6844
31 254 А G YGSMN 0.0044 8.7386037
G А GMSTP 0.00125 1.8112
32 439 А G YGSMN 0.025 5.136
33 384 G А YGSMN 0.015 6.284
35 239 G А YGSMN 0.0495 4.6259439
G А GMSTP 0.000154145 1.4141
36 208 G А YGSMN 0.000249875 1.7148
37 145 С А YGSMN 0.00029249 3.16538
38 535 А Т GMSTP 0.000180209 0.1236
39 169 Т А GMSTP 0.000124333 1.2461
40 76 G А YGSMN 0.0012 11.9039947
41 724 А G YGSMN 2.71×10-5 4.65472
42 386 А G YGSMN 0.0037 11.255257
43 375 А G GMSTP 0.000221511 0.6653
44 309 С G GMSTP 0.0011 0.1152
45 342 А С GMSTP 0.266801841 0.8445
46 445 G С YGSMN 0.000032821 1.6764
47 602 А Т YGSMN 0.000769319 3.7163
48 190 G А YGSMN 0.000297308 3.369
48* 190 G А YGSMN 0.0054 8.0700349
49 593 С G YGSMN 0.001142836 10.5852
49* 593 С G YGSMN 0.0282 7.642183
50 266-267 - АА YGSMN 0.017 6.724
51 708 А С YGSMN 0.0054 7.3294598
С А GMSTP 2.42×10-5 0.3221
52 648 G А YGSMN 0.0026 10.9837972
53 541 A Т YGSMN 0.0003 10.3325637
54 442 С G YGSMN 0.000013938 11.0737
55 491 С G YGSMN 0.000238135 7.1354
55* 491 С G YGSMN 0.0446 9.1504902
56 428 А G YGSMN 0.000578625 0.7024
57 126 А G YGSMN 6.83×10-5 3.70653
А G GMSTP 6.19×10-5 0.5342
* Данные относятся к испытаниям гибридов
Таблица 9
Вклады благоприятных аллелей в повышение оптимизации водопотребления, выявленные OIPDT2
SEQ ID NO: Позиция SNP F U Признак Вклад Значение P
12 292 С А GMSTP 0.973536 0.000509
14 148 G Т GMSTP 0.739413 0.000003
23 518 Т G GWTPN 3.438703 0.000198
37 145 С А GMSTP 0.2769 0.000315
39 169 т А GMSTP 0.2721405 0.00034675
42 386 А G GMSTP 0.379311 0.000192
46 445 С G GMSTP 0.777738 0.000547
48 190 А G GMSTP 1.47593 0.000274
51 708 С А GMSTP 0.31989 0.000287
52 648 G А GMSTP 0.450848 0.000111
55 491 С G GMSTP 0.544187 0.0001335
56 428 G А GMSTP 0.347253 0.000573

Материалы и способы, применяемые в примерах 8-12

NP2391 представляет собой элитный сорт кукурузы с нежесткими стеблями. NP2391 описан в патенте США №7166783. NP2391 содержит аллель G в позиции 87 последовательности SEQ ID NO: 47, аллель G в позиции 386 последовательности SEQ ID NO: 46, аллель G в позициях 4979-4981 последовательности последовательности SEQ ID NO: 7, аллель С в позиции 4641 последовательности последовательности SEQ ID NO: 7, аллель А в позиции 472 последовательности SEQ ID NO: 48, аллель G в позиции 237 последовательности SEQ ID NO: 56, аллель А в позиции 516 последовательности SEQ ID NO: 56, аллель А в позиции 266 последовательности SEQ ID NO: 44, аллель Т в позиции 475 последовательности SEQ ID NO: 45, аллель Т в позиции 173 последовательности SEQ ID NO: 57, аллель С в позиции 746 последовательности SEQ ID NO: 24, аллель А в позиции 391 последовательности SEQ ID NO: 33, аллель С в позиции 258 последовательности SEQ ID NO: 29, аллель А в позиции 217 последовательности SEQ ID NO: 23, аллель G в позиции 116 последовательности SEQ ID NO: 23, аллель G в позиции 463 последовательности SEQ ID NO: 19, аллель Т в позиции 309 последовательности SEQ ID NO: 19, аллель D в позициях 264-271 последовательности SEQ ID NO: 2, аллель G в позиции 100 последовательности SEQ ID NO: 2, аллель С в позиции 486 последовательности SEQ ID NO: 58, аллель G в позиции 111 последовательности SEQ ID NO: 51, аллель G в позиции 254 последовательности SEQ ID NO: 27, аллель G в позиции 729 последовательности SEQ ID NO: 59, аллель G в позиции 267 последовательности SEQ ID NO: 60, аллель G в позиции 562 последовательности SEQ ID NO: 25, аллель С в позиции 1271 последовательности SEQ ID NO: 26 и аллель G в позиции 193 последовательности SEQ ID NO: 55. См. фигуру 1.

NP2460 представляет собой элитный сорт кукурузы с жесткими стеблями. NP2460 описан в патенте США №7122726. NP2460 содержит аллель С в позиции 386 последовательности SEQ ID NO: 46, аллель А в позициях 4979-4981 последовательности последовательности SEQ ID NO: 7, аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель G в позиции 472 последовательности SEQ ID NO: 48, аллель G в позиции 237 последовательности SEQ ID NO: 56, аллель С в позиции 516 последовательности SEQ ID NO: 56, аллель С в позиции 266 последовательности SEQ ID NO: 44, аллель С в позиции 475 последовательности SEQ ID NO: 45, аллель G в позиции 173 последовательности SEQ ID NO: 57, аллель С в позиции 746 последовательности SEQ ID NO: 24, аллель А в позиции 391 последовательности SEQ ID NO: 33, аллель Т в позиции 258 последовательности SEQ ID NO: 29, аллель А в позиции 217 последовательности SEQ ID NO: 23, аллель G в позиции 116 последовательности SEQ ID NO: 23, аллель С в позиции 463 последовательности SEQ ID NO: 19, аллель С в позиции 309 последовательности SEQ ID NO: 19, аллель D в позиции 264-271 последовательности SEQ ID NO: 2, аллель G в позиции 100 последовательности SEQ ID NO: 2, аллель С в позиции 486 последовательности SEQ ID NO: 58, аллель G в позиции 254 последовательности SEQ ID NO: 27, аллель G в позиции 729 последовательности SEQ ID NO: 59, аллель G в позиции 267 последовательности SEQ ID NO: 60, аллель G в позиции 562 последовательности SEQ ID NO: 25, аллель С в позиции 1271 последовательности SEQ ID NO: 26 и аллель А в позиции 193 последовательности SEQ ID NO: 55. См. фигуру 1.

CML333 представляет собой экзотический инбредный сорт кукурузы из Международного центра улучшения кукурузы и пшеницы (CIMMYT) в Мексике. Известно, что CML333, устойчив как к юго-западному кукурузному сверлильщику, так и к травяной совке. CML333 содержит аллель А в позициях 4979-4981 последовательности последовательности SEQ ID NO: 7, аллель G в позиции 472 последовательности SEQ ID NO: 48, аллель G в позиции 237 последовательности SEQ ID NO: 56, аллель G в позиции 173 последовательности SEQ ID NO: 57, аллель G в 0172А, аллель А в позиции 116 последовательности SEQ ID NO: 23, аллель А в позиции 100 последовательности SEQ ID NO: 2 и аллель А в позиции 267 последовательности SEQ ID NO: 60. См. фигуру 1.

CML322 представляет собой экзотический инбредный сорт кукурузы из Международного центра улучшения кукурузы и пшеницы (CIMMYT) в Мексике. CML322 содержит аллель С в позиции 386 последовательности SEQ ID NO: 46, аллель А в позициях 4979-4981 последовательности SEQ ID NO: 7, аллель G в позиции 472 последовательности SEQ ID NO: 48, аллель С в позиции 266 последовательности SEQ ID NO: 44, аллель С в позиции 309 последовательности SEQ ID NO: 19, аллель С в позиции 111 последовательности SEQ ID NO: 51, аллель А в позиции 562 последовательности SEQ ID NO: 25 и аллель А в позиции 1271 последовательности SEQ ID NO: 26. См. фигуру 1.

Cateto SP VII представляет собой экзотический сорт кукурузы родом из Бразилии. Хотя данный сорт демонстрирует высокую способность к объединению со многими сортами кукурузы, он имеет сравнительно низкую урожайность. Cateto SP VII содержит аллель А в позиции 87 последовательности SEQ ID NO: 47, аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель G в позиции 472 последовательности SEQ ID NO: 48, аллель С в позиции 266 последовательности SEQ ID NO: 44, аллель А в позиции 746 последовательности SEQ ID NO: 24, аллель Т в позиции 258 последовательности SEQ ID NO: 29, аллель G в позиции 217 последовательности SEQ ID NO: 23, аллель А в позиции 100 последовательности SEQ ID NO: 2, аллель А в позиции 486 последовательности SEQ ID NO: 58 и аллель А в позиции 193 последовательности SEQ ID NO: 55. См. фигуру 1.

Confite Morocho AYA 38 представляет собой экзотический сорт кукурузы родом из Перу. Несмотря на то, что он устойчив к гельминтоспориозной пятнистости листьев, он подвержен поражению ржавчиной. Confite Morocho AYA 38 содержит аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель С в позиции 237 последовательности SEQ ID NO: 56, аллель G в позиции 391 последовательности SEQ ID NO: 33, аллель С в позиции 309 последовательности SEQ ID NO: 19, инсерцию в позициях 264-271 последовательности SEQ ID NO: 2 и аллель А в позиции 486 последовательности SEQ ID NO: 58. См. фигуру 1.

Tuxpeno VEN 692 представляет собой экзотический сорт кукурузы родом из Венесуэлы. Он обладает высокой устойчивостью как к гельминтоспориозной пятнистости листьев, так и к ржавчине. Tuxpeno VEN 692 содержит аллель А в позиции 4641 последовательности SEQ ID NO: 7, аллель С в позиции 237 последовательности SEQ ID NO: 56, аллель G в позиции 258 последовательности SEQ ID NO: 29, аллель С в позиции 463 последовательности SEQ ID NO: 19 и аллель А в позиции 193 последовательности SEQ ID NO: 55. См. фигуру 1.

Кукурузные растения сорта NP23 91 скрещивали с 134 экзотическими сортами кукурузы, в том числе CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 и Tuxpeno VEN 692. Потомство данных скрещиваний возвратно скрещивали с NP23 91 на протяжении пяти поколений для создания NP23 91-экзотических гибридов. Сегментные интрогрессии из гена shaggy киназы (номер доступа базы данных GenBank® AY103545, включен сюда посредством ссылки) были обнаружены в NP23 91-экзотических гибридах, представляющих 42 экзотических донора (CML333, CML322, Cateto SP VII, Confite Morocho AYA 38 Tuxpeno VEN 692, CML69, HH5982, TLT0766, CML103, M37W, TLZ0845, AGG742, NC358, P39, Серрано GUA 3, Mochero LBQ 17 KXI0970, 6B209, Cholito BOV 705 CML228, Coroico Amarillo, 8B006, EE8001, Enano MD3, Perola BOV 711, Puya Grande SAN, XPRR001, B97, Cacao SAS 327, Тх303, Clavito ECU 366, Early Caribbean MAR 10, Patillo BOV 502, Rabo De Zorro AHK 325 Shajatu AHK 120, Shoe Peg PI269743, St. Croix IVC 2, Oh7B, Polio VEN 336, Tzi8 и Oh43). Каждый из NP23 91-экзотических гибридов, содержащих сегментарную интрогрессию в гене shaggy киназы, самоопыляли на протяжении двух поколений, отбирая потомство, содержащее экзотический донорный генотип в позициях 4979-4981 последовательности SEQ ID NO: 7/позиция 4641 последовательности SEQ ID NO: 7. Две линии были отобраны из потомства каждого самооопыления NP2391-экзотического гибрида: один гомозиготный экзотический донорный генотип в позициях 4979-4981 последовательности SEQ ID NO: 7/позиция 4641 последовательности SEQ ID NO: 7 и другой гомозиготный экзотический донорный генотип NP2391 в позициях 4979-4981 последовательности SEQ ID NO: 7/позиция 4641 последовательности SEQ ID NO: 7. Каждую из данных линий скрещивали с NP2460, чтобы создать гибридную линию F1. В дополнение, NP2460 скрещивали непосредственно с NP2391, чтобы создать контрольный гибрид F1.

Гибриды F1 оценивали в четырех засушливых местоположениях (La Salle, Колорадо, США, Gilroy, Калифорния, США; Los Andes, Чили и Granaros, Чили), с шестью повторами обработки в каждом местоположении с помощью конструирования ограниченных рандомизированных блоков, а также в двенадцати областях с оптимальными условиями с одним повтором. Обработки стрессовым воздействием засухи проводили во время опыления, и они состояли из периода дефицита воды, способного снизить урожай зерновых на около 40-60%. Сроки проведения каждой обработки стрессовым воздействием засухи определялись типом почвы и местным климатом (исходя из которых были оценены или измерены водоудерживающая способность и скорость испарения (ЕТ)). Нормальное орошение прекращали за 3-4 недели до середины периода пыления, чтобы уровень влажности почвы снизился до критического уровня, который достигался примерно за 7 дней до пыления. Как только почва высыхала до критического уровня, устанавливался режим дефицита орошения (около 40% ЕТ). Обработки стрессовым воздействием засухи продолжали в течение двух недель после середины периода пыления, после чего возобновляли нормальное орошение.

Засухоустойчивость оценивали измерением урожая зерна при стандартном проценте влажности (YGSMN) и влажности зерна в период сбора урожая (GMSTP). Качественный контроль статистических данных проводили построением распределения данных. Остатки получали с помощью следующей модели:

Y = µ + местоположение + репликации (местоположение) + семья + аллель (семейная),

где Y представляет собой зависимый фенотип и µ представляет собой фенотипическое среднее; местоположение и репликации (местоположение) были случайные. Семья и аллель (семейная) были фиксированы. Остатки были проанализированы по репликациям внутри семьи и помечены в соответствии с заданными критериями, зависимыми от оцениваемого признака. Заключительный анализ был проведен как для отдельных местоположений, так и для местоположений, объединенных с помощью следующей модели:

Y = µ + репликации + семья + аллель (семейная) + репликации* семья,

где Y представляет собой зависимый фенотип и µ представляет собой фенотипическое среднее. Репликации были случайными. Семья и аллель (семейная) были фиксированы. Рассчитывали методом наименьших квадратов и применяли Т-критерий Стьюдента для парных сравнений.

Как показано в таблице 10, шесть F1 гибридов, полученных от скрещивания NP2460 с линией, гомозиготной по экзотическому донорному генотипу в позициях 4979-4981 последовательности SEQ ID NO: 7/позиция 4641 последовательности SEQ ID NO: 7, показали повышенную засухоустойчивость.

Таблица 10
Сравнение гибридов NP2460 в отношении SEO ID NO: 7
Гибрид F1 Урожайность (бушель/акр) Разница в условиях засухи (бушель/акр)
Оптимальные условия для выращивания кукурузы Засуха vs. контроль гибрид vs. - гибрид
Контроль 180 162
CML333+ 184 176 14* 11*
CML333- 179 165
CML322+ 185 182 20* 23*
CML322- 183 159
Cateto+ 214 168 6* 18*
Cateto- 180 150
Confite+ 191 170 8* 13*
Confite- 189 157
Tuxpeno+ 195 175 13* 10*
Tuxpeno- 159 165
* указывает значение p<0.05

Пример 8

NP2460×(NP2391×CML333)

NP2391 скрещивали с CML333, и потомство, полученное от данного скрещивания, возвратно скрещивали с NP2391 на протяжении пяти поколений, чтобы создать гибрид NP2391×CML333 shaggy. Гибрид NP2391×CML333 shaggy самоопыляли на протяжении двух поколений, и две линии были отобраны на основании их генотипа в позициях 4979-4981 последовательности SEQ ID NO: 7: одна линия с гомозиготным генотипом CML333 (АА) ("CML333 гомозиготный+") и другая линия с гомозиготным генотипом NP2931 (GG) ("CML333 гомозиготный-"). См. фигуру 2. Каждую из данных линий скрещивали с NP2460, чтобы создать гибрид F1. См. фигуру 2.

Как показано в таблице 2, линия гибрида F1, созданная скрещиванием NP2460 с линией, содержащей АА в позициях 4979-4981 последовательности SEQ ID NO: 7 ("CML333+"), продемонстрировала повышенную засухоустойчивость по сравнению как с контрольным гибридом, так и с гибридом F1, полученным скрещиванием NP2460 с линией, содержащей GG в позициях 4979-4981 последовательности SEQ ID NO: 7 ("CML333-"). При обработке стрессовым воздействием засухи гибрид CML333+ продемонстрировал значительно более высокую урожайность зерна при стандартном проценте влажности (176 бушель/акр), чем оба контрольный гибрид (162 бушель/акр) и гибрид CML333 (165 бушель/акр).

Пример 9

NP2460×(NP2391×CML322)

NP2391 скрещивали с CML322, и потомство, полученное от данного скрещивания, возвратно скрещивали с NP2391 на протяжении пяти поколений, чтобы создать гибрид NP2391×CML322 shaggy. Гибрид NP2391×CML322 shaggy самоопыляли на протяжении двух поколений, и две линии были отобраны на основании их генотипа в позициях 4979-4981 последовательности SEQ ID NO: 7: одна линия с гомозиготным генотипом CML322 (АА) ("CML322 гомозиготный+") и другая линия с гомозиготным генотипом NP2931 (GG) ("CML322 гомозиготный-"). См. фигуру 3. Каждую из данных линий скрещивали с NP2460, чтобы создать гибрид F1. См. фигуру 3.

Как показано в таблице 2, линия гибрида F1, созданная скрещиванием NP2460 с линией, содержащей АА в позициях 4979-4981 последовательности SEQ ID NO: 7 ("CML322+"), продемонстрировала повышенную засухоустойчивость по сравнению как с контрольным гибридом, так и с гибридом F1, полученным скрещиванием NP2460 с линией, содержащей GG в позициях 4979-4981 последовательности SEQ ID NO: 7 ("CML322-"). При обработке стрессовым воздействием засухи гибрид CML322+ продемонстрировал значительно более высокую урожайность зерна при стандартном проценте влажности (182 бушель/акр), чем оба контрольный гибрид (162 бушель/акр) и гибрид CML322- (159 бушель/акр). Примечательно, что урожайность зерна гибрида CML322+ в условиях засухи была почти идентичной его урожайности в оптимальных условиях.

Пример 10

NP2460×(NP2391×Cateto SP VII)

NP2391 скрещивали с Cateto SP VII, и потомство, полученное от данного скрещивания, возвратно скрещивали с NP2391 на протяжении пяти поколений, чтобы создать гибрид NP2391×Cateto SP VII shaggy. Гибрид NP2391×Cateto SP VII shaggy самоопыляли на протяжении двух поколений, и две линии были отобраны на основании их генотипа в позиции 4641 последовательности SEQ ID NO: 7: одна линия с гомозиготным генотипом Cateto SP VII (АА) ("Cateto гомозиготный+") и другая линия с гомозиготным генотипом NP2931 (GG) ("Cateto гомозиготный-"). См. фигуру 4. Каждую из данных линий скрещивали с NP2460, чтобы создать гибрид F1. См. фигуру 4.

Как показано в таблице 2, линия гибрида F1, созданная скрещиванием NP2460 с линией, содержащей АА в позиции 4641 последовательности SEQ ID NO: 7 ("Cateto+"), продемонстрировала повышенную засухоустойчивость по сравнению как с контрольным гибридом, так и с гибридом F1, полученным скрещиванием NP2460 с линией, содержащей GG в позиции 4641 последовательности SEQ ID NO: 7 ("Cateto-"). При обработке стрессовым воздействием засухи гибрид Cateto+ продемонстрировал значительно более высокую урожайность зерна при стандартном проценте влажности (168 бушель/акр), чем оба контрольный гибрид (162 бушель/акр) и гибрид Cateto- (150 бушель/акр).

Пример 11

NP2460×(NP2391×Confite Morocho AYA 38)

NP2391 скрещивали с Confite Morocho AYA 38, и потомство, полученное от данного скрещивания, возвратно скрещивали с NP2391 на протяжении пяти поколений, чтобы создать гибрид NP2391×Confite Morocho AYA 38 shaggy. Гибрид NP2391×Confite Morocho AYA 38 shaggy самоопыляли на протяжении двух поколений, и две линии были отобраны на основании их генотипа в позиции 4641 последовательности SEQ ID NO: 7: одна линия с гомозиготным генотипом Confite Morocho AYA 38 (АА) ("Confite гомозиготный+") и другая линия с гомозиготным генотипом NP2931 (GG) ("Confite гомозиготный-"). См. фигуру 5. Каждую из данных линий скрещивали с NP2460, чтобы создать гибрид F1. См. фигуру 5.

Как показано в таблице 2, линия гибрида F1, созданная скрещиванием NP2460 с линией, содержащей АА в позиции 4641 последовательности SEQ ID NO: 7 ("Confite+"), продемонстрировала повышенную засухоустойчивость по сравнению как с контрольным гибридом, так и с гибридом F1, полученным скрещиванием NP2460 с линией, содержащей GG в позиции 4641 последовательности SEQ ID NO: 7 ("Confite-"). При обработке стрессовым воздействием засухи гибрид Confite+ продемонстрировал значительно более высокую урожайность зерна при стандартном проценте влажности (170 бушель/акр), чем оба контрольный гибрид (162 бушель/акр) и гибрид Confite- (157 бушель/акр).

Пример 12

NP2460×(NP2391×Tuxpeno VEN 692)

NP2391 скрещивали с Tuxpeno VEN 692, и потомство, полученное от данного скрещивания, возвратно скрещивали с NP2391 на протяжении пяти поколений, чтобы создать гибрид NP2391×Tuxpeno VEN 692 shaggy. Гибрид NP2391×Tuxpeno VEN 692 shaggy самоопыляли на протяжении двух поколений, и две линии были отобраны на основании их генотипа в позиции 4641 последовательности SEQ ID NO: 7: одна линия с гомозиготным генотипом Tuxpeno VEN 692 (АА) ("Tuxpeno гомозиготный+") и другая линия с гомозиготным генотипом NP2931 (GG) ("Tuxpeno гомозиготный-"). См. фигуру 7. Каждую из данных линий скрещивали с NP2460, чтобы создать гибрид F1. См. фигуру 7. Как показано в таблице 2, линия гибрида F1, созданная скрещиванием NP2460 с линией, содержащей АА в позиции 4641 последовательности SEQ ID NO: 7 ("Tuxpeno+"), продемонстрировала повышенную засухоустойчивость по сравнению как с контрольным гибридом, так и с гибридом F1, полученным скрещиванием NP2460 с линией, содержащей GG в позиции 4641 последовательности SEQ ID NO: 7 ("Tuxpeno-"). При обработке стрессовым воздействием засухи гибрид Tuxpeno+ продемонстрировал значительно более высокую урожайность зерна при стандартном проценте влажности (175 бушель/акр), чем оба контрольный гибрид (162 бушель/акр) и гибрид Tuxpeno- (165 бушель/акр).

Пример 13

Тестирование водно-оптимизированных гибридов на выход урожая

157 водно-оптимизированных гибридов на основе 36 исходных генотипов сравнивали с базовым генетическим (контрольным) растением в 9-21 местоположениях, каждый при четырех типах окружающей среды: полное орошение, ограниченное орошение, богара (без стресса/получение адекватного количества осадков), богарный стресс, засушливые земли (низкая плотность растений; без стресса/получение адекватного количества осадков) и стресс из-за засухи). Как показано в таблицах 11 и 12, гибриды оптимизированным водопотреблением превзошли близкородственные базовые гибриды при всех испытываемых условиях.

Таблица 11
Урожайность при условиях полного орошения
WO Базовый WO Базовый Разница Значение
гибридный гаплотип* гибридный гаплотип гибрид гибрид P
ChIa CI 219.8 205.4 14.3 0.108
aCGhI CGI 216.4 205.4 10.9 0.220
bCdeghil Cdeghi 224.5 213.5 11.0 0.048
среднее 220.2 208.1 12.1
SD 4.1 4.7 1.9
bCdefGhil CdefGh(1) 241.0 226.8 14.2 0.005
bCdefGhil CdefGh(2) 238.0 226.8 11.2 0.030
CefGh cgi 204.4 192.1 12.3 0.077
CefGh cgi 211.2 192.1 19.2 0.018
среднее 223.7 209.4 14.2
SD 18.6 20.0 3.5
*: Обозначения гаплотипов относятся к гаплотипам А-М, описанным выше. Заглавные буквы указывают на то, что гибрид был гомозиготным по соответствующему гаплотипу, и строчные буквы указывают на то, что гибрид был гетерозиготным по соответствующему гаплотипу. Отсутствие буквы из перечня А-М в обозначении указывает на то, что гибрид не обладал данным гаплотипом.
(1), (2) указывают на то, что данные растения были получены из одного и того же начального разведения, но были отдельными индивидуальными растениями.
Таблица 12
Урожайность в условиях ограниченного орошения
WO гибридный гаплотип* Базовый гибридный гаплотип WO гибрид Базовый гибрид Разница Значение P
ChIa CI 138.3 132.6 5.9 0.371
aCGhI CGI 145.9 132.6 13.3 0.039
bCdeghil Cdeghi 149.2 142.1 7.2 0.266
среднее 144.5 135.8 8.8
SD 5.5 5.5 4.0
*: Обозначения гаплотипов как в таблице 11.
Таблица 13
Урожайность в условиях стресса из-за засухи
WO гибридный гаплотип* Базовый гибридный гаплотип WO гибрид Базовый гибрид Разница Значение P
bCdgil Cdgi 100.5 86.8 13.7 0.387
aCeGHI CeghI 107.5 88.5 19.0 0.178
aCeGHI CeghI 99.7 88.5 11.2 0.334
cdefGhijkl dfGh 109.3 90.9 18.4 0.157
cdefghl d 116.2 86.0 30.2 0.161
acghi cgi 102.2 81.5 20.7 0.066
acghi cgi 108.9 81.5 27.4 0.036
cefGhi cgi 96.9 77.7 19.2 0.100
cdfghe cd 95.2 81.6 13.6 0.201
среднее 104.1 84.8 19.3
SD 6.8 4.4 6.3
*: Обозначения гаплотипов как в таблице 11.

ССЫЛКИ

Все ссылки, перечисленные ниже, а также все ссылки, цитируемые в настоящем раскрытии, включая, но не ограничиваясь ими, все патенты, заявки на патенты и их публикации, научные журнальные статьи и записи в базе данных (например, записи в базе данных GenBank® и все аннотации, доступные в ней), включены сюда посредством отсылки во всей их полноте в той мере, в какой они дополняют, объясняют, обеспечивают фон или учат методологии, способам и/или композициям, используемым здесь.

Altschul et al. (1990) J Mol Biol 215: 403-410.

Altschul et al. (1997) Nucleic Acids Res 25: 3389-3402.

Ausubel et al. (eds.) (1999) Short Protocols in Molecular Biology Wiley, New York, New York, United States of America.

Bradbury et al. (2007) Bioinformatics 23: 2633-2635.

Camus-Kulandaivelu et al. (2007) Crop Science 47: 887-890.

Close et al. (1989) Plant Mol Biol 13: 95-108.

Dennis et al. (1984) Nucleic Acids Res 12: 3983-4000.

Evanno et al. (2005) Molecular Ecology 14: 2611-2620.

Falush et al. (2003) Genetics 164: 1567-1587.

Fan et al. (2006) Nature Reviews Genetics 7: 632-644.

Glick & Thompson (1993) Methods in Plant Molecular Biology and Biotechnology, CRC Press, Boca Raton. Florida, United States of America.

Guan & Scandalios (1993) Plant J 3: 527-536.

Hannah et al. (2001) Plant Physiol 127: 173-183.

Hardy & Vekemans (2002) Molecular Ecology Notes 2: 618-620.

Jannink & Walsh (2002) in Quantitative Genetics. Genomics and Plant Breeding. Kang (ed.) CAB International Publishing, New York, New York, United States of America, pp.59-68.

Liu & Muse (2005) Bioinformatics 21: 2128-2129.

Loiselle et al. (2005) American Journal of Botany 82: 1420-1425.

Morinaka et al. (2006) Plant Physiol 141: 924-931.

Paterson (1996) in Paterson (ed.) Genome Mapping in Plants. R.G.Landes Company, Georgetown, Texas, United States of America, pages 41-54.

Patterson et al. (2006) PLoS Genetics 2: e190.

Perin et al. (2002) Theor Appl Genet 104: 1017-1034.

Price et al. (2006) Nature Genetics 38: 904-909.

Pritchard et al. (2000) Genetics 155: 945-959.

Ritland (1996) Genetics Research 67: 175-186.

Salekdeh et al. (2009) Trends in Plant Science 14: 488-496.

Sambrook & Russell (2001). Molecular Cloning: A Laboratory Manual, Third Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, United States of America.

Stich et al. (2006) Theoretical and Applied Genetics 113: 1121-1130.

Storey (2002) Journal of the Royal Statistical Society: Series В 64:479-498.

Tijssen (1993) in Laboratory Techniques in Biochemistry and Molecular Biology. Elsevier, New York, New York, United States of America.

U.S. Patent Nos. 4,458,068; 6,635,803; 7,314,757; 7,332,651; 7,432,416.

Wu et al. (1994) Plant Physiol 106: 1709-1710.

Zhang et al. (2001) Genetic Epidemiol 21: 370-375.

Zhao et al. (2007) PLoS Genetics 3: e4.

Zietkiewicz et al. (1994) Genomics 20: 176-183.

Следует иметь в виду, что различные детали раскрытого в настоящем документе объекта изобретения могут быть изменены, не выходя из объема раскрытого в настоящем документе объекта изобретения. Дополнительно, вышеприведенное описание предназначено только для целей иллюстрации, а не для целей ограничения.

1. Способ получения гибридного растения Zea mays с улучшенной оптимизацией водопотребления, способ включает:
(a) предоставление первого растения Zea mays, содержащего первый генотип, содержащий любой из гаплотипов А-М;
(b) предоставление второго растения Zea mays, содержащего второй генотип, содержащий любой из гаплотипов А-М, причем второе растение содержит по меньшей мере один из гаплотипов А-М, который не присутствует в первом растении;
(c) скрещивание первого растения и второго кукурузного растения для получения поколения F1; и
(d) идентификацию одного или более представителей поколения F1, который содержит желаемый генотип, содержащий любую комбинацию гаплотипов А-М, причем желаемый генотип отличается как от первого генотипа (а), так и от второго генотипа (b), получая тем самым гибридное растение с улучшенной оптимизацией водопотребления,
в котором упомянутые гаплотипы определяются следующим образом:
i) гаплотип А содержит нуклеотид G в позиции, которая соответствует позиции 115 последовательности SEQ ID NO: 1, нуклеотид А в позиции, которая соответствует позиции 270 последовательности SEQ ID NO: 1, нуклеотид Т в позиции, которая соответствует позиции 301 последовательности SEQ ID NO: 1, и нуклеотид А в позиции, которая соответствует позиции 483 последовательности SEQ ID NO: 1 на хромосоме 8 в геноме первого растения;
ii) гаплотип В содержит делецию в позициях 4497-4498 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4505 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4609 последовательности SEQ ID NO: 7, нуклеотид А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4792 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4836 последовательности SEQ ID NO: 7, нуклеотид С в позиции, которая соответствует позиции 4844 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4969 последовательности SEQ ID NO: 7, и тринуклеотид ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7 на хромосоме 8 в геноме первого растения;
iii) гаплотип С содержит нуклеотид А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 8, нуклеотид G в позиции, которая соответствует позиции 390 последовательности SEQ ID NO: 8, и нуклеотид А в позиции, которая соответствует позиции 477 последовательности SEQ ID NO: 8 на хромосоме 2 в геноме первого растения;
iv) гаплотип D содержит нуклеотид G в позиции, которая соответствует позиции 182 последовательности SEQ ID NO: 19, нуклеотид А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотид G в позиции, которая соответствует позиции 330 последовательности SEQ ID NO: 19, и нуклеотид G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19 на хромосоме 8 в геноме первого растения;
v) гаплотип Е содержит нуклеотид С в позиции, которая соответствует позиции 61 последовательности SEQ ID NO: 21, нуклеотид С в позиции, которая соответствует позиции 200 последовательности SEQ ID NO: 21, и делецию девяти нуклеотидов в позициях, которые соответствуют позициям 316-324 последовательности SEQ ID NO: 21 на хромосоме 5 в геноме первого растения;
vi) гаплотип F содержит нуклеотид G в позиции, которая соответствует позиции 64 последовательности SEQ ID NO: 27, и нуклеотид Т в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27 на хромосоме 8 в геноме первого растения;
vii) гаплотип G содержит нуклеотид С в позиции, которая соответствует позиции 98 последовательности SEQ ID NO: 28, нуклеотид Т в позиции, которая соответствует позиции 147 последовательности SEQ ID NO: 28, нуклеотид С в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 28, и нуклеотид Т в позиции, которая соответствует позиции 496 последовательности SEQ ID NO: 28 на хромосоме 9 в геноме первого растения;
viii) гаплотип Н содержит нуклеотид Т в позиции, которая соответствует позиции 259 последовательности SEQ ID NO: 30, нуклеотид Т в позиции, которая соответствует позиции 306 последовательности SEQ ID NO: 30, нуклеотид А в позиции, которая соответствует позиции 398 последовательности SEQ ID NO: 30, и нуклеотид С в позиции, которая соответствует позиции 1057 последовательности SEQ ID NO: 30 на хромосоме 4 в геноме первого растения;
ix) гаплотип I содержит нуклеотид С в позиции, которая соответствует позиции 500 последовательности SEQ ID NO: 36, нуклеотид G в позиции, которая соответствует позиции 568 последовательности SEQ ID NO: 36, и нуклеотид Т в позиции, которая соответствует позиции 698 последовательности SEQ ID NO: 36 на хромосоме 6 в геноме первого растения;
x) гаплотип J содержит нуклеотид А в позиции, которая соответствует позиции 238 последовательности SEQ ID NO: 42, делецию нуклеотидов, которые соответствуют позициям 266-268 последовательности SEQ ID NO: 42, и нуклеотид С в позиции, которая соответствует позиции 808 последовательности SEQ ID NO: 42 в геноме первого растения;
xi) гаплотип К содержит нуклеотид С в позиции, которая соответствует позиции 166 последовательности SEQ ID NO: 49, и нуклеотид А в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 49, нуклеотид G в позиции, которая соответствует позиции 650 последовательности SEQ ID NO: 49, и нуклеотид G в позиции, которая соответствует позиции 892 последовательности SEQ ID NO: 49 на хромосоме 8 в геноме первого растения;
xii) гаплотип L содержит нуклеотид С в позициях, которые соответствуют позициям 83, 428, 491 и 548 последовательности SEQ ID NO: 53 на хромосоме 9 в геноме первого растения, а также
xiii) гаплотип М содержит нуклеотид С в позиции, которая соответствует позиции 83 в последовательности SEQ ID NO: 400, нуклеотид А в позиции, которая соответствует позиции 119 последовательности SEQ ID NO: 400, и нуклеотид Т в позиции, которая соответствует позиции 601 последовательности SEQ ID NO: 400.

2. Способ по п. 1, в котором гибридное растение с улучшенной оптимизацией водопотребления содержит один из гаплотипов А-М, которые присутствуют в первом растении, а также по меньшей мере один дополнительный гаплотип, выбранный из гаплотипов А-М, который присутствует во втором растении.

3. Способ по п. 1, в котором первое растение представляет собой рекуррентный родитель, содержащий по меньшей мере один из гаплотипов А-М, и второе растение представляет собой донор, который содержит по меньшей мере один из гаплотипов А-М, который не присутствует в первом растении.

4. Способ по п. 3, в котором первое растение является гомозиготным по меньшей мере по двум, трем, четырем или пяти гаплотипам А-М.

5. Способ по п. 3, в котором гибридное растение содержит по меньшей мере три, четыре, пять, шесть, семь, восемь или девять гаплотипов А-М.

6. Способ по п. 1, в котором идентификация включает генотипирование одного или более представителей поколения F1, полученного скрещиванием первого растения и второго растения, по отношению к каждому из гаплотипов А-М, присутствующему в первом растении или во втором растении.

7. Способ по п. 1, в котором улучшенная оптимизация водопотребления дает увеличенный или стабильный урожай в среде обитания, подвергаемой водному стрессу, по сравнению с контрольным растением.

8. Способ по п. 1, в котором гибрид с улучшенной оптимизацией водопотребления может быть высеян с более высокой густотой посева.

9. Способ по п. 1, в котором гибрид с улучшенной оптимизацией водопотребления не дает обусловленного сцеплением генов падения урожая при благоприятных уровнях влажности.

10. Не сортовое инбредное или гибридное растение Zea mays, геном которого содержит по меньшей мере три, четыре, пять, шесть, семь, восемь или девять гаплотипов из гаплотипов А-М, причем гаплотипы А-М являются ассоциированными с оптимизацией водопотребления и определяются следующим образом:
i) гаплотип А содержит нуклеотид G в позиции, которая соответствует позиции 115 последовательности SEQ ID NO: 1, нуклеотид А в позиции, которая соответствует позиции 270 последовательности SEQ ID NO: 1, нуклеотид Т в позиции, которая соответствует позиции 301 последовательности SEQ ID NO: 1, и нуклеотид А в позиции, которая соответствует позиции 483 последовательности SEQ ID NO: 1 на хромосоме 8 в геноме первого растения;
ii) гаплотип В содержит делецию в позициях 4497-4498 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4505 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4609 последовательности SEQ ID NO: 7, нуклеотид А в позиции, которая соответствует позиции 4641 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4792 последовательности SEQ ID NO: 7, нуклеотид Т в позиции, которая соответствует позиции 4836 последовательности SEQ ID NO: 7, нуклеотид С в позиции, которая соответствует позиции 4844 последовательности SEQ ID NO: 7, нуклеотид G в позиции, которая соответствует позиции 4969 последовательности SEQ ID NO: 7, и тринуклеотид ТСС в позиции, которая соответствует позициям 4979-4981 последовательности SEQ ID NO: 7 на хромосоме 8 в геноме первого растения;
iii) гаплотип С содержит нуклеотид А в позиции, которая соответствует позиции 217 последовательности SEQ ID NO: 8, нуклеотид G в позиции, которая соответствует позиции 390 последовательности SEQ ID NO: 8, и нуклеотид А в позиции, которая соответствует позиции 477 последовательности SEQ ID NO: 8 на хромосоме 2 в геноме первого растения;
iv) гаплотип D содержит нуклеотид G в позиции, которая соответствует позиции 182 последовательности SEQ ID NO: 19, нуклеотид А в позиции, которая соответствует позиции 309 последовательности SEQ ID NO: 19, нуклеотид G в позиции, которая соответствует позиции 330 последовательности SEQ ID NO: 19, и нуклеотид G в позиции, которая соответствует позиции 463 последовательности SEQ ID NO: 19 на хромосоме 8 в геноме первого растения;
v) гаплотип Е содержит нуклеотид С в позиции, которая соответствует позиции 61 последовательности SEQ ID NO: 21, нуклеотид С в позиции, которая соответствует позиции 200 последовательности SEQ ID NO: 21, и делецию девяти нуклеотидов в позициях, которые соответствуют позициям 316-324 последовательности SEQ ID NO: 21 на хромосоме 5 в геноме первого растения;
vi) гаплотип F содержит нуклеотид G в позиции, которая соответствует позиции 64 последовательности SEQ ID NO: 27, и нуклеотид Т в позиции, которая соответствует позиции 254 последовательности SEQ ID NO: 27 на хромосоме 8 в геноме первого растения;
vii) гаплотип G содержит нуклеотид С в позиции, которая соответствует позиции 98 последовательности SEQ ID NO: 28, нуклеотид Т в позиции, которая соответствует позиции 147 последовательности SEQ ID NO: 28, нуклеотид С в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 28, и нуклеотид Т в позиции, которая соответствует позиции 496 последовательности SEQ ID NO: 28 на хромосоме 9 в геноме первого растения;
viii) гаплотип Н содержит нуклеотид Т в позиции, которая соответствует позиции 259 последовательности SEQ ID NO: 30, нуклеотид Т в позиции, которая соответствует позиции 306 последовательности SEQ ID NO: 30, нуклеотид А в позиции, которая соответствует позиции 398 последовательности SEQ ID NO: 30, и нуклеотид С в позиции, которая соответствует позиции 1057 последовательности SEQ ID NO: 30 на хромосоме 4 в геноме первого растения;
ix) гаплотип I содержит нуклеотид С в позиции, которая соответствует позиции 500 последовательности SEQ ID NO: 36, нуклеотид G в позиции, которая соответствует позиции 568 последовательности SEQ ID NO: 36, и нуклеотид T в позиции, которая соответствует позиции 698 последовательности SEQ ID NO: 36 на хромосоме 6 в геноме первого растения;
x) гаплотип J содержит нуклеотид А в позиции, которая соответствует позиции 238 последовательности SEQ ID NO: 42, делецию нуклеотидов, которые соответствуют позициям 266-268 последовательности SEQ ID NO: 42, и нуклеотид С в позиции, которая соответствует позиции 808 последовательности SEQ ID NO: 42 в геноме первого растения;
xi) гаплотип К содержит нуклеотид С в позиции, которая соответствует позиции 166 последовательности SEQ ID NO: 49, и нуклеотид А в позиции, которая соответствует позиции 224 последовательности SEQ ID NO: 49, нуклеотид G в позиции, которая соответствует позиции 650 последовательности SEQ ID NO: 49, и нуклеотид G в позиции, которая соответствует позиции 892 последовательности SEQ ID NO: 49 на хромосоме 8 в геноме первого растения;
xii) гаплотип L содержит нуклеотид С в позициях, которые соответствуют позициям 83, 428, 491 и 548 последовательности SEQ ID NO: 53 на хромосоме 9 в геноме первого растения.

11. Не сортовое инбредное или гибридное растение Zea mays по п. 10, которое содержит геном, содержащий гаплотипы С, D и G; гаплотипы С, D и L; гаплотипы С, G, Н; гаплотипы С, G и I; гаплотипы С, I и L; гаплотипы Е, G и I; гаплотипы F, G и Н; гаплотипы А, С, F и G; гаплотипы С, Е, Н и I; гаплотипы С, G, Н и I; гаплотипы С, Н, I и К; гаплотипы С, Н, I и L; гаплотипы Е, F, G и Н; гаплотипы А, С, G, Н и I; гаплотипы В, С, D, G и L; гаплотипы С, Е, G, Н и I; гаплотипы С, G, Н, I и L; гаплотипы А, С, G, Н, I и К; и гаплотипы С, Е, F, G, Н, I, J, К и L.

12. Не сортовое инбредное или гибридное растение Zea mays по п. 10, которое представляет собой гибридное растение, которое является гомозиготным по меньшей мере по одному из гаплотипов А-М.

13. Не сортовое инбредное или гибридное растение Zea mays по п. 10, которое дополнительно содержит трансген, который кодирует генный продукт, обеспечивающий устойчивость к гербициду, отобранному из глифосата, сульфонилмочевины, имидазолиниона, дикамбы, глюфисината, феноксипропионовой кислоты, циклосгекома, триазина, бензонитрила и броксинила.

14. Не сортовое растение Zea mays с улучшенной оптимизацией водопотребления, зародышевая плазма которого включает аллель локуса, ассоциированного с признаком оптимизации водопотребления, причем этот аллель содержит нуклеотидную последовательность, которая является по меньшей мере на 90% идентичной любой последовательностей SEQ ID NO: 1-117, 400 и 401.



 

Похожие патенты:

Настоящее изобретение относится к биотехнологии и представляет собой способ мониторинга экспрессии представляющего интерес гена полипептида CADM1, Rb, ZMYND10, RASSF5, PTEN, SERPINB5, EPB41L3 или DAPK1 для определения терапевтического эффекта соединения при лечении заболевания, связанного с экспрессией указанного представляющего интерес гена полипептида.

Изобретение относится к области биотехнологии, а именно к способу выявления РНК вируса бешенства и набору, который используется в данном способе. Способ включает проведение ОТ-ПЦР с олигонуклеотидными праймерами.

Настоящее изобретение относится к фосфодиэстеразе 4D7 (PDE4D7) для применения в качестве маркера для агрессивного гормон-чувствительного рака предстательной железы, где экспрессия маркера повышена при сравнении экспрессии в ткани агрессивного гормон-чувствительного рака предстательной железы с экспрессией в нормальной ткани или ткани доброкачественной опухоли предстательной железы, и к применению PDE4D7 в качестве диагностического маркера для агрессивного гормон-чувствительного рака предстательной железы.

Изобретение относится к области биохимии. Заявлен способ молекулярно-генетического внутривидового типирования Vibrio cholerae O1 и O139 серогрупп.

Изобретение относится к области биотехнологии, а именно к способу определения эффективной терапевтической дозы противоэпилептического препарата и риска развития побочных эффектов.

Изобретение относится к области биотехнологии, в частности к набору синтетических олигонуклеотидов для выявления видовой принадлежности володушки многожильчатой (Bupleurum multinerve DC.), включающий проведение полимеразной цепной реакции с фрагментом ITS2 ядерной ДНК.

Биомаркер // 2573925
Изобретение относится к области биотехнологии, конкретно к маркерам рака, и может быть использовано в медицине. Выявление белка Engrailed-2 (EN2) или кодирующей его нуклеиновой кислоты в образце тканей мочевого пузыря или мочи от пациента может быть использовано в диагностике рака мочевого пузыря или для идентификации пациента, имеющего риск развития рака мочевого пузыря, а также для мониторинга прогрессирования рака мочевого пузыря у пациента или мониторинга эффективности лечения рака мочевого пузыря.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Изобретение относится к области биохимии, в частности к способу определения зиготности растения сои, включающего арилоксиалканоатдиоксигеназу (AAD-12) с SEQ ID NO: 1, где указанное растение содержит трансгенную конструкцию, включающую ген AAD-12, состоящий из остатков 2731-9121 SEQ ID NO: 1, и указанная трансгенная конструкция фланкирована 5′-фланкирующей геномной ДНК сои и 3′-фланкирующей геномной ДНК сои, где указанная 5′-фланкирующая геномная ДНК содержит остатки 1-2730 SEQ ID NO: 1, указанная 3′-фланкирующая геномная ДНК содержит остатки 9122-10212 SEQ ID NO: 1, а также к комплекту для его выполнения.

Группа изобретений относится к области молекулярной биологии. Сущность изобретения состоит в подавлении активности активированного онкогена AML-ETO методом РНК-интерференции в злокачественных кроветворных клетках, полученных от больных лейкозом, с использованием конструкции малой шпилечной РНК, встроенной в лентивирусный вектор pLSLP-AML-ETO-shRNA, кодируемой нуклеотидной последовательностью двухцепочечной ДНК, представляющей собой: 5′-р-gatccgCCTCGAAATCGTACTGAGActtcctgcaa TCTCAGTACGATTTCGAGGtttttg-3′ (смысловая цепь), 5′-р-aattcaaaaaCCTCGAAATCGTACT GAGAttgcaggaagTCTCAGTACGATTTCGAGGcg-3′ (антисмысловая цепь).

Изобретение относится к области медицины и предназначено для ПЦР-диагностики гена резус-фактора плода по крови беременной женщины. Предложен набор с лиофилизированными праймерами, содержащий готовые к амплификации реакционные пробирки с лиофилизированными праймерами и праймерами-зондами для экзонов RHD-5 и RHD-7 гена RHD. Все смеси в реакционных пробирках подготовлены для реакции в необходимых объемах, подвергнуты заморозке в жидком азоте, затем высушены по программе лиофилизации. Изобретение обеспечивает создание набора, эффективного для ПЦР-диагностики гена резус-фактора плода по крови беременной женщины с увеличенным сроком годности, с возможностью транспортировки в дальние регионы без строгого соблюдения температурного режима. 1 табл.

Изобретение относится к области биотехнологии, а именно к способу поиска белков-мишеней, запускающих процесс канцерогенеза, в образцах тканей индивидуального пациента, для последующей противоопухолевой фармакотерапии. Определяют методом секвенирования транскриптомные данные об уровнях экспрессии генов в образцах. Получают набор активированных генно-регуляторных сетей, состоящих из центрального гена регулятора и регулируемых им генов. Определяют из транскриптомных данных дифференциально экспрессированные гены. Определяют методами секвенирования изменения в последовательностях ДНК, представленных в виде набора однонуклеотидных полиморфизмов в образцах. Определяют среди найденных генетических вариантов гены-драйверы. Проводят поиск канонических сигнальных путей, значимо обогащенных ранее найденными центральными генами регуляторами экспрессии, дифференциально экспрессированными генами, генами с идентифицированными однонуклеотидными полиморфизмами и инделами, генами-драйверами. Проводят поиск методом перебора в составе идентифицированных сигнальных путей существующих белков-мишеней для лекарственных препаратов, предназначенных для противоопухолевой терапии. Предложенное изобретение позволяет с высокой эффективностью найти белки-мишени, запускающие процесс канцерогенеза, в образцах тканей индивидуального пациента. 1 ил., 5 табл.

Изобретение относится к области биохимии, в частности к способу определения зиготности растения кукурузы, содержащего трансгенную конструкцию, содержащую ген арилоксиалканоатдиоксигеназы, где указанный способ включает: получение образца геномной ДНК от указанного растения кукурузы; получение приведенного в контакт образца посредством контактирования указанного образца ДНК с первым праймером и вторым праймером и флуоресцентным зондом, определение зиготности указанного растения кукурузы, а также к набору для его осуществления. Изобретение позволяет эффективно определять зиготность растения кукурузы, содержащего ген арилоксиалканоатдиоксигеназы. 2 н. и 13 з.п. ф-лы, 3 ил., 1 табл., 1 пр.

Предложенная группа изобретений относится к области медицины. Предложен способ прогнозирования у пациента с влажной возрастной дегенерацией желтого пятна (AMD) повышенной вероятности эффекта от лечения высокоаффинным антителом против VEGF, в частности, ранибизумабом. Предложен набор, содержащий первый олигонуклеотид и вторые олигонуклеотиды, специфичные для аллелей полиморфизма гена BATF, соответствующего rs175714. Если генотип содержит АА или AG, у пациента прогнозируют повышенную вероятность эффекта от указанного лечения. Предложенная группа изобретений обеспечивает эффективные средства и методы для прогнозирования повышенной вероятности эффекта от лечения у пациента с влажной AMD. 2 н. и 7 з.п. ф-лы, 1 ил., 5 табл., 1 пр.

Изобретение относится к области биотехнологии, а именно к набору последовательностей праймеров и аллель-специфических зондов для одновременной генодиагностики двух мутантных аллелей, вызывающих комплекс аномалий позвоночника (CVM) и дефицит лейкоцитарной адгезии (BLAD) у крупного рогатого скота. Набор включает последовательности праймеров и аллель-специфических зондов, которые имеют следующую структуру: CVM_up gattctcaagagcttaattctaagga, CVM_low aagtaaaccccagcaaagccac, CVM_Wt (FAM)-aggtctcatggcagttct-(BHQ1), CVM_m (R6G)-catggcatttctcacagcat-(BHQ2), BLAD_up ttaggcagttgcgttc, BLAD_low acgttgacgaggtcatccacca, BLAD_Wt (ROX)-accccatcgacctgtacta-(BHQ1), BLAD_m (Cy5)-ccatcggcctgtactacct-(BHQ2). Предложенное изобретение позволяет одновременно диагностировать CVM и BLAD у крупного рогатого скота методом ПЦР в реальном времени, а также сократить время выполнения полимеразной цепной реакции в реальном времени. 3 ил., 2 табл., 1 пр.

Изобретение относится к биотехнологии, а именно к способу селективного подавления амплификации в ходе ПЦР фрагментов ДНК. Добавляют в реакционную смесь блокирующий олигонуклеотид в концентрации, которая превышает концентрацию праймеров, используемых для ПЦР, не менее чем в 2 раза. 3′-концевая последовательность блокирующего олигонуклеотида служит для его отжига на 3′-участок фрагмента ДНК, амплификация которого должна быть подавлена, и имеет длину, обеспечивающую ее эффективную гибридизацию на 3′-участок фрагмента ДНК при температуре отжига праймера, используемого в ПЦР. 5′-концевая последовательность блокирующего олигонуклеотида служит матрицей для достройки нового 3′-конца для указанного фрагмента ДНК, где новая 3′-концевая последовательность не имеет комплементарности с предполагаемыми матрицами и исключает дальнейшее участие этого фрагмента в амплификации в качестве затравки. Предложенное изобретение позволяет провести селективное подавление амплификации с высокой эффективностью. 4 з.п. ф-лы, 6 табл., 2 пр., 8 ил.
Изобретение относится к области медицины и предназначено для прогнозирования ответа на стандартную двухкомпонентную противовирусную терапию у пациентов с хроническим гепатитом С (ХГС), генотипом 1в. Для прогнозирования достоверности ответа на стандартную двухкомпонентную противовирусную терапию пегилированными интерферонами и рибавирином у пациентов с хроническим гепатитом С, генотипом 1в, осуществляют генетическое исследование крови на полиморфизм гена IL28B и определяют групповую принадлежность крови. Прогнозируют устойчивый вирусологический ответ в 100% случаев у пациентов с группой крови 0αβ (I) и полиморфизмом гена IL28B в rs12979860 с генотипом С/С и генотипом Т/Т в rs8099917. Прогнозируют устойчивый вирусологический ответ в 80% случаев у пациентов с группой крови Аβ (II) и при однонуклеотидной замене цитозина на тимин (С>Т) в локусе rs12979860 гена IL28B. При однонуклеотидной замене тимина на гуанин (T>G) в rs8099917 гена IL28B устойчивый вирусологический ответ прогнозируют только у пациентов с группой крови Вα (III). Использование изобретения позволяет повысить достоверность и эффективность прогнозирования стандартной противовирусной терапии. 2 табл.

Группа изобретений относится к обоасти биохимии и биотехнологии. Представлены аптамер, связывающийся с химазой и ингибирующий активность химазы, содержащий нуклеотидную последовательность, представленную как X1GAUAGAN1N2UAAX2, где X1 и X2 идентичны или не идентичны друг другу и каждый означает A или G, а N1 и N2 идентичны или не идентичны друг другу и каждый означает A, G, C, U или T; комплекс, включающий аптамер и функциональное вещество, например вещество, обладающее сродством, вещество для мечения, фермент, средство доставки лекарственного средства, лекарственное средство; лекарственное средство или реагент, содержащее аптамер или комплекс; способы детекции и очистки химазы с использованием аптамера или комплекса. 9 н. и 7 з.п. ф-лы, 8 ил., 9 табл., 9 пр.

Группа изобретений относится к области генной инженерии, в целом к трансгенным конструкциям, трансгенным животным, отличным от человека, способам количественного анализа активации GPCR лигандов неинвазивно в интактных животных, тканевых срезах или в нативных клетках, используя трансгенную модель, содержащую систему биолюминесцентного трансгена-репортера, которая является чувствительной к модуляции путей после связывания лиганда с рецепторами GPCR. Трансгенное животное, отличное от человека, для оценки функции рецептора, сопряженного с G-белком (GPCR), имеющее геном, содержащий индуцируемый циклическим АМФ (цАМФ), трансген, содержащий, в направлении от 5′-конца к 3′-концу, первый инсуляторный элемент, ответный элемент цАМФ, промотор, биолюминесцентный репортер, миниген человеческого гормона роста (hGH) и второй инсуляторный элемент. Использование трансгенной конструкции приводит к повышению мышиных линий, продуцирующих мРНК и белок, а также к увеличению уровня экспрессии репортерного гена. 9 н. и 11 з.п. ф-лы, 41 ил., 10 табл.

Изобретение относится к области биотехнологии, а именно к тест-системе для обнаружения экспрессии гена NAT2 у человека. Данная тест-система включает смесь праймеров, комплементарных концам разных цепей требуемого фрагмента ДНК-матрицы для ПЦР, эндонуклеазу рестрикции с буфером и технологическую смесь для ПЦР с Taq-полимеразой. В качестве смеси праймеров она содержит пару дезоксиолигонуклеотидов, обладающих активностью прямого и обратного праймеров в реакции обратной транскрипции и полимеразной цепной реакции со следующей структурой: Nat2(F) MR1ACCWAAYCAGCCAGR1AAGC и Nat2(R) AGMCCSACCAWACAGYAMACC, где F и R - прямой и обратный праймеры соответственно и A, G, С, R1, W, М, S и Y - кодовые обозначения нуклеотидов. Предложенное изобретение позволяет с высокой достоверностью обнаруживать экспрессию гена NAT2 у человека. 6 ил., 3 табл., 2 пр.

Изобретение относится к биохимии. Описан способ получения кукурузного растения с улучшенной оптимизаций водопотребления и растение, полученное таким способом. Изобретение позволяет получать растения, обладающие повышенной засухоустойчивостью. 3 н. и 11 з.п. ф-лы, 6 ил., 13 табл., 13 пр.

Наверх