Иммуногенная композиция на основе синтетических пептидов, копирующих актуальные детерминанты gp120 вич1

Изобретение относится к медицине, а именно к иммунологии и может быть использовано для создания вакцин против ВИЧ/СПИД. Для этого иммуногенная композиция содержит синтетические пептиды, повторяющие консенсусную последовательность группы М V1-, V2-, V3 - петли и V3 - петлю российского изолята RU A022a2 оболочечного белка gp120 ВИЧ1, а также иммуноадъювант или нагруженные пептидами дендридные клетки. Использование данного изобретения состоит в создании иммунногенной композиции вызывающей ответ на каждый антиген композиции, состоящей на основе синтетических пептидов, повторяющих актуальные антигенные детерминанты ВИЧ. 2 пр., 2 табл.


Изобретение относится к медицине, а именно, к препаратам для создания кандидатных вакцин против ВИЧ/СПИД.

Считается, что эффективная вакцина способна остановить распространение ВИЧ-инфекции. Существующая на сегодняшний день специфическая антиретровирусная терапия не удаляет полностью вирус из организма, а лишь способствует замедлению развития заболевания. Классический подход к разработке вакцин - это аттенуация или инактивация возбудителя.

В случае ВИЧ/СПИД эти методы не могут быть использованы по соображениям безопасности. В качестве антигенной субстанции кандидатных вакцин против ВИЧ/СПИД используются рекомбинантные белки и синтетические пептиды, копирующие актуальные детерминанты ВИЧ, а также бактериальные или вирусные векторы и ДНК-вакцины, кодирующие заданные последовательности эпитопов ВИЧ.

Механизм действия большинства лицензированных вакцин против различных возбудителей основан на их способности вызывать образование нейтрализующих антител. (Adv Immunol. 2001; V. 79 p. 1-53. Neutralizing antiviral antibody responses. Zinkernagel RM1, LaMarre A, Ciurea A, Hunziker L, Ochsenbein AF, McCoy KD, Fehr T, Bachmann MF, Kalinke U, Hengartner H.)

Эти антитела, связываясь с вирусом, затрудняют или предотвращают его проникновение в клетку. При инфицировании ВИЧ первые антитела определяются уже через 10 дней после заражения, но они не обладают нейтрализующей активностью. Нейтрализующие антитела образуются примерно через 2-3 месяца после заражения. За это время вирус успевает встроиться в геном клетки и становится невидимым для иммунной системы человека (Nat Rev Immunol. 2010 Jan V. 10 №1 p. 11-23. The immune response during acute HIV-1 infection: clues for vaccine development. McMichael AJ1, Borrow P, Tomaras GD, Goonetilleke N, Haynes BF.) (N Engl J Med. 2011 May 19 V. 364 №20 p. 1943-54. Acute HIV-1 Infection. Cohen MS1, Shaw GM, McMichael AJ, Haynes BF). Обол очечные белки вируса (gp120 и gp41) содержат эпитопы для нейтрализующих антител. Однако иммунизация лабораторных животных и добровольцев, участвующих в клинических испытаниях рекомбинантными антигенами, копирующими полноразмерные gp120 или gp41, индуцировала слабый иммунный ответ, направленный, в основном, на непротективные эпитопы. Вероятно, это связано с тем, что эпитопы, ответственные за индукцию нейтрализующих антител, являются слабыми иммуногенами и скрыты для распознавания иммунной системой.

Помимо вирусной нейтрализации, другим механизмом защитных свойств антител является антитело-зависимая клеточная цитотоксичность и антитело-зависимое ингибирование вирусной инфекции.

Другой особенностью ВИЧ - является его высокая изменчивость. Кроме того, вирусы, относящиеся к различным субтипам, могут рекомбинировать и образовывать, так называемые, циркулирующие рекомбинантные формы. Поэтому создание универсальной вакцины, которая бы вызывала протективный иммунный ответ против различных вариантов ВИЧ, циркулирующих в различных регионах, представляет определенную трудность. 90% всех вариантов ВИЧ объединены в группу M. Liao et al. на основе анализа последовательностей вирусов, входящих в эту группу, создали так называемую консенсусная последовательность. (Virology. 2006 Sep. 30 V. 353 №2 p. 268-82. A group M consensus envelope glycoprotein induces antibodies that neutralize subsets of subtype В and С HIV-1 primary viruses. Liao HX, Sutherland LL, Xia SM, Brock ME, Scearce RM, Vanleeuwen S, Alam SM, McAdams M, Weaver EA, Camacho Z, Ma BJ, Li Y, Decker JM, Nabel GJ, Montefiori DC, Hahn BH, Korber ВТ, Gao F, Haynes BF).

Разработка вакцинных препаратов на основе такого типа последовательностей позволило бы расширить спектр иммунного ответа.

Большинство нейтрализающих эпитопов ВИЧ были выявлены при исследовании специфичности моноклональных антител, обладающих широким спектром нейтрализующей активности. Эти эпитопы находятся на оболочечном (gp120) и трансмембранном (gp41) белках ВИЧ. Наибольшей интерес представляет участок, расположенный на оболочечном белке gp120, V3-петля. Он ответственен за связывание вируса с хемокиновыми рецепторами клетки CCR5/CXCR4. Удаление V3-петли у вируса делает его неинфекционным. Антитела, к этому эпитопу, обнаруживаются почти во всех сыворотках ВИЧ-инфицированных людей. Удаление анти-V3-антител из сыворотки ВИЧ-инфицированных людей приводила к потери ею нейтрализующей активности против лабораторных, но не первичных, штаммов ВИЧ (Differential role of V3-specific antibodies in neutralization assays involving primary and laboratory-adapted isolates of HIV type 1. Vancott TC, Polonis VR, Loomis LD, Michael NL, Nara PL, Birx DL. AIDS Res Hum Retroviruses. 1995 Nov V. 11 №11 p. 1379-1391) Используя В-лимфоциты ВИЧ-инфицированных людей, к V3-петле получено ряд нейтрализующих моноклональных антител, такие как, например, 447-52В и HGN194. Данные антитела эффективно нейтрализуют панель гомологичных и чувствительных к нейтрализации вариантов ВИЧ (Tier 1) и часть (11%) гетерологичных вариантов (Tier 2) (PLoS One. 2010 Jan 20 V. 5 №1, e8805. Analysis of memory В cell responses and isolation of novel monoclonal antibodies with neutralizing breadth from HIV-1-infected individuals. Corti D1, Langedijk JP, Hinz A, Seaman MS, Vanzetta F, Fernandez-Rodriguez BM, Silacci C, Pinna D, Jarrossay D, Baila-Jhagjhoorsingh S, Willems В, Zekveld MJ, Dreja H, O′Sullivan Ε, Pade С, Orkin С, Jeffs SA, Montefiori DC, Davis D, Weissenhorn W, McKnight A, Heeney JL, Sallusto F, Sattentau QJ, Weiss RA, Lanzavecchia A.)

V1/V2-петля gp120 также является эпитопом для нейтрализующих антител. Аутологичные нейтрализующие антитела, направленные к этому региону, часто выявляются в первые месяцы после заражения. Два моноклональных антитела PG9 и PG16 с широким спектром нейтрализующей активности, специфичные к V1/V2 региону, были изолированы из ВИЧ-инфицированных. (J Transl Med. 2011 Jan 27 V. 9 Suppl 1:S2. HIV-1 envelope, integrins and co-receptor use in mucosal transmission of HIV. Cicala C, Arthos J, Fauci AS.) V1/V2 регион принимает участие в формировании сайта связывания белка gp120 как с хемокиновым рецептором клетки CCR5/CXCR4, так и с интегриновым рецептором клетки α4β7. (Structure-function relationships of HIV-1 envelope sequence-variable regions refocus vaccine design. Zolla-Pazner S, Cardozo T. Nat Rev Immunol. 2010 Jul V. 10 №7 p. 527-35.)

После ряда неудач, определенный прорыв был отмечен в клинических испытаниях RV 144, проводимых в Таиланде, где впервые была выявлена эффективность вакцинного препарата против ВИЧ/СПИД. Для иммунизации использовалась комбинация двух препаратов: сначала вводился рекомбинатный вирус оспы канареек (ALVAC vCP1521), а затем рекомбинантный белок, копирующий оболочечный белок ВИЧ gp120 (AIDSVAX В/Е). У иммунизированных людей процент заражения был на 31,2% ниже, по сравнению с группой, получавшей плацебо. Хотя иммунизация не давала 100% защиты от инфицирования, считается, что это первые достоверные результаты вакцин-индуцированного протективного иммунного ответа, полученные в клинических испытаниях на людях. Исследование иммунных коррелятов протективного действия вакцины показало, что наличие антител к V1/V2-региону оболочечного белка gp120, связано с пониженным риском инфицирования. Эти антитела не обладали нейтрализующей активностью, но они принимали участие в механизме развития антитело-зависимой клеточной цитотоксичности. (Clin Vaccine Immunol. 2014 Aug V. 21 №8 p. 1023-1036. Nonneutralizing functional antibodies: a new "old" paradigm for HIV vaccines. Excler JL, Ake J, Robb ML, Kim JH, Plotkin SA).

Синтетические пептиды, копирующие актуальные эпитопы ВИЧ, как и рекомбинантные белки, являются хорошей основной для вакцины против ВИЧ. Они безопасны, хорошо переносимы и могут повторять только тот эпитоп, который вызывает протективный ответ.

Известен пептид, копирующий фрагмент V2-петли gp120 ВИЧ (патент WO 2013040040). Этот пептид специфически связывается с антителами добровольцев, принимавших участие в клинических испытаниях RV144. Он входит в состав полипептида, содержащего также субъединицу В холерного токсина (scaffold protein) или эндотоксин E. coli.

Известен рекомбинантный белок, копирующий V1/V2-домен оболочечного белка gp120 ВИЧ, штамма Case-A2 (субтип В), а также белок gp70 MuLV (патент US 20030105282). Данный белок представлял эпитоп, который распознавался антителами, способными нейтрализовать первичные изоляты ВИЧ. Иммунизация лабораторных животных (крыс) этим белком вызывала образование антител, способных нейтрализовать ряд первичных изолятов (М-тропных) ВИЧ. Однако большая часть антител индуцировалась на белок gp70 (63%).

Также известен ряд белков, копирующих последовательности V1/V2 - петли белка gp120 субтипов АЕ, и содержащих лидерную последовательность Ig (патент WO 2013085550). Данные белки также распознавались моноклональными антителами, обладающими широким спектром нейтрализующей активности. Однако, не исследована способность этого белка вызывать антитела широкой нейтрализующей активности.

Известны антигены, повторяющие V1/V2-петли gp120 (WO 2014039775) различных структурных конфигураций. Данные конфигурации возникают за счет образования альтернативных дисульфидных связей. Образование различных изоформ белка влияет на иммуногенность антигенов и их способности связываться со специфическими антителами.

Известна рекомбинантная ДНК, копирующая оболочечный белок gp120, в котором последовательности V1/V2- и V4-петли заменены на консесуные последовательности V3-петли, относящихся к разным субтипам (A1, В, С) (WO 2008005929). Данный подход позволил расширить специфичность иммунного ответа. Иммунизация лабораторных животных (кроликов) этой вакциной (прайм) и соответствующим рекомбинантным белком (буст), вызывала образование нейтрализующих антител широкой специфичности. Однако, иммунизация лабораторных животных только рекомбинантной ДНК, не приводила к индукции нейтрализующих антител.

Задачей данного изобретения является создание иммунногенной композиции с широким спектром иммунного ответа.

Таким образом, технический результат, получаемый при реализации описываемого изобретения, состоит в создании иммунногенной композиции на основе синтетических пептидов, повторяющих актуальные антигенные детерминанты вируса.

Указанный технический результат достигается тем, что иммуногенная композиция включает синтетические пептиды, повторяющие консенсусную последовательность группы M V1-, V2-, V3 - петли и V3 - петлю российского изолята RUA022a2 оболочечного белка gp120 ВИЧ1.

Иммуногенная композиция может дополнительно содержать иммуноадъювант для введения млекопитающему.

Иммуногенная композиция может содержать комбинацию пептидов, повторяющих V1-, V2-, V3 - петли любых последовательностей.

Композиция была разработана, исходя из теоретических предположений на основе приведенного выше анализа известных технических решений, и проверена на опытах.

Иммуногенная композиция включает пептиды, копирующие антигенные детерминанты ВИЧ, ответственные за индукцию как нейтрализующих антител, так и антител, принимающих участие в реакции антитело-зависимой клеточной цитотоксичности. Данные антигенные детерминанты представляют собой вариабельные участки оболочечного белка gp120 ВИЧ1, так называемые V1-, V2-, V3 - петля.

Данные пептиды (V1-, V2-, V3 - петля) повторяют как консесуную последовательность группы М, так и последовательность российского изолята RUA022a2 (V3-петля) (субтип A1) (http://vyww.ncbi.nlm.nih.gov/nucleotide/HQ616082).

Предлагаемая композиция позволит расширить специфичность иммунного ответа.

Ниже указана последовательность пептидов:

1. Аминокислотная последовательность V1-петли консенсусной CTNVNVTNTTNNTEEKGEIKNC

2. Аминокислотная последовательность V2-петли консенсусной TTEIRDKKQKVYALFYRLDWPIDDNNNNSSNYRL

3. Аминокислотная последовательность V3-петли российского изолята RUA022a2 (субтип A1)


4. Аминокислотная последовательность V3-петли консенсусной NCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCN

Сходство данных пептидов с вирусным прототипом проверялось по их способности распознаваться антителами ВИЧ-инфицированных людей в иммуноферментном анализе (ИФА) (пример 1). Антитела, полученные в результате естественной инфекции, специфически взаимодействовали с синтетическими пептидами в ИФА.

Иммунизация смесью пептидов вызывала иммунный ответ у лабораторных животных (мышей) (пример 2). Антитела индуцировались на каждый пептид, входящий в состав композиции. Помимо, образования специфических антител класса IgG, иммунизация вызывала продукцию специфических IgM антител. Т.к. пептиды являются слабыми иммуногенами, то для усиления иммунного ответа в составе композиции могут быть использованы различные иммуноадъюванты. Иммуноадъюванты не только усиливают иммунный ответ, но и способны сдвигать его направленность (Th1 или Th2). Так введение в состав композиции полного адъюванта Фрейнда (ПАФ) значительно увеличило титр антител. Таким образом, данная композиция может вводиться с любыми разрешенными к использованию в клинической практике иммуноадъювантами.

Другим важным моментом является способ доставки композиции. Помимо внутримышечного и подкожного введения, данная композиция может быть введена нагруженными пептидами дендридными клетками.

Для лучшего понимания сущности предлагаемого изобретения ниже приведены примеры его осуществления.

Пример 1. Исследование иммунорективности синтетических пептидов, копирующих эпитопы ВИЧ1 V1-, V2-, V3- петлю белка gp120 консенсусной последовательности группы M и V3- петлю белка gp120 российского изолята.

Определение проводили с помощью иммуноферментного анализа (ИФА). В качестве ВИЧ-позитивных образцов применяли сыворотки ВИЧ-инфицированных людей, подтвержденных в иммуноблоте. В качестве ВИЧ-негативных образцов использовали сыворотки крови человека, не содержащих антител к ВИЧ-1.

Пептиды сорбировали на твердую фазу (полистироловые планшеты Greiner, Германия) в концентрации 10 мкг/мл в расчете на антиген. После окончания инкубации содержимое лунок стряхивали. Сыворотки разводили 1:10 в 0,01 M фосфатно-солевом буфере, содержащем 0,05% раствора Твин-20 (ФСБ-Т) и 0,02% бычьего сывороточного альбумина (ФСБ-АТ). Образцы вносили в лунку в трех параллелях, и выдерживали 60 мин при 37°С.

По окончании инкубации, лунки пятикратно отмывали ФСБ-Т для удаления не связавшихся антител. В качестве детектирующего реагента использовали конъюгат пероксидазы хрена с моноклональными антителами мыши против IgG человека. Конъюгат в рабочем разведении на ФСБ-АТ вносили в лунку. Инкубировали 60 мин при 37°С. После этого лунки вновь промывали пятикратно ФСБ-Т. Реакцию проявляли внесением в каждую лунку 0,2% раствора ортофенилендиамина в субстратном буфере.

Развитие цветной ферментативной реакции останавливали после 15-минутной инкубации в темноте, внося в каждую лунку 50 мкл 10% раствора серной кислоты. Учет реакции производили с помощью спектрофотометра-ридера при длине волны 492 нм.

Результаты проведенного опыта представлены в виде отношения оптической плотности сыворотки, содержащей антитела к ВИЧ (ОП иссл), к оптической плотности негативной сыворотки (ОП негативная).

Исследование специфической активности пептидов с сыворотками ВИЧ-инфицированных людей показало, что пептиды, копирующие V3-петлю (консенсусную последовательность и российского изолята), распознаются почти всеми сыворотками ВИЧ инфицированных людей (31 из 32). Пептид, копирующий V1-петлю узнавали только 2 образца из 32, V2 - 4 из 32. Это объясняется тем, что V3 - петля является иммунодоминантным эпитопом, в отличие от V1-, V2- петли, антитела к которым индуцируются только у 25-40% ВИЧ-инфицированных (AIDS. 1997 Jan V. 11 №1 р. 128-30. Prevalence of a V2 epitope in clade В primary isolates and its recognition by sera from HIV-1-infected individuals.Israel ZR, Gorny MK, Palmer C, McKeating JA, Zolla-Pazner S.)

Пример 2. Изучение иммуногенности смеси пептидов, копирующих V1-, V2-, V3-петлю белка gp120 консенсусной последовательности группы М и V3-петлю белка gp120 российского изолята.

Для изучения иммуногенных свойств пептидов, копирующих V1-, V2-, V3-петлю белка gp120 консенсусной последовательности группы М и V3- петлю белка gp120 российского изолята, животных (мыши-гибридов (CBAxC57BL/6)F1 массой 16-18 г.) иммунизировали внутрибрюшинно смесью пептидов три раза, с интервалом две недели. Иммунизирующая доза составляла 100 мкг каждого антигена, входящего в состав в композиции, на животное. Антигены вводили как в смеси с ПАФ, так и без использования иммуноадъювантов (в фосфатно-солевом буфере). Кровь собирали через 7 дней после третьей иммунизации, затем получали сыворотки.

Титр антител (IgG и IgM) определяли для каждого антигена, входящего в состав иммуногенной смеси (таблица 2). Определение проводили с помощью твердофазного непрямого иммуноферментного анализа (ИФА). В качестве твердофазного иммуносорбента использовали каждый пептид по отдельности, сорбированный на твердой фазе (в лунках полистиролового планшета). Пептид в концентрации 10 мкг/мл сорбировали на полистироловых планшетах фирмы «Greiner» (Германия) в 0,05 M растворе карбонантно-бикарбонантного буфера pH 9,5, внося по 100 мкл раствора антигена в лунку. Выдерживали 24 часа при комнатной температуре во влажной камере.

После окончания инкубации содержимое лунок стряхивали. Готовили ряд последовательных двоичных разведений сывороток на 0,01 M фосфатно-солевом буфере, содержащем 0,05% раствора Твин-20 (ФСБ-Т) и 0,02% бычьего сывороточного альбумина (ФСБ-АТ). Образцы вносили в лунку в трех параллелях для каждого разведения, и выдерживали 60 мин при 37°С.

По окончании инкубации, лунки пятикратно отмывали ФСБ-Т для удаления не связавшихся антител. В качестве детектирующего реагента использовали конъюгат пероксидазы хрена с антителами кролика против молекулы IgG мыши или IgM. Конъюгат в рабочем разведении на ФСБ-АТ вносили в лунку. Инкубировали 60 мин при 37°С. После этого лунки вновь промывали пятикратно ФСБ-Т. Реакцию проявляли внесением в каждую лунку 0,2% раствора ортофенилендиамина в субстратном буфере. Развитие цветной ферментативной реакции останавливали после 15-минутной инкубации в темноте, внося в каждую лунку 50 мкл 10% раствора серной кислоты. Учет реакции производили с помощью спектрофотометра-ридера при длине волны 492 нм.

Результат считали положительным, если ОП (оптическая плотность) в анализируемой лунке превышала ОП крит., рассчитанную по формуле:

ОПкрит.=ср.знач.ОП К(-)+0,2,

где 0,2 - коэффициент, определяемый методом статистической обработки результатов постановки ИФА,

ОП К(-) - оптическая плотность сыворотки интактной мыши, в рабочем разведении 1:10.

Иммунизация смесью синтетических пептидов вызывала ответ на каждый антиген иммуногенной композиции. Показано, что пептиды индуцировали различный по силе иммунный ответ. Наименьшие титры антител образовывались на пептид, копирующий VI-петлю. Титры IgG антител на V2- и V3-петлю значительно не отличались. Наличие иммуноадъювантов в составе иммуногенной композиции значительно усиливает ответ. Так титр IgG антител в группе, где пептиды вводились без адъювантов, составлял 1:10-1:20, а в группах, где использовался ПАФ 1:2580-20480. Кроме того, были выявлены специфические антитела класса IgM. Отличие в титрах антител можно объяснить разной длиной пептидов и, соответственно, разностью в молекулярном весе. Чем меньше молекулярная масса антигена, тем меньше его иммуногенность.

Перечень последовательностей

<110> ФГБУ "ГНЦ Институт иммунологии" ФМБА

<120> Иммуногенная композиция на основе синтетических пептидов, копирующих актуальные детерминанты gp120 ВИЧ1


<210> SEQ ID NO 1




<400> SEQUENCE 1

Cys Thr Asn Val Asn Val Thr Asn Thr Thr
tgc acc aac gtg aac gtg acc aac acc acc
1 5 10
Asn Asn Thr Glu Glu Lys Gly Glu Ile Lys
aac aac acc gag gag aag ggc gag atc aag
15 20
Asn Cys
aac tgc

<210> SEQ ID NO 2




<400> SEQUENCE 2

Thr Thr Glu Ile Arg Asp Lys Lys Gln Lys
acc acc gag atc cgc gac aag aag cag aag
1 5 10
Val Tyr Ala Leu Phe Tyr Arg Leu Asp Val
gtg tac gcc ctg ttc tac cgc ctg gac gtg
15 20
Val Pro Ile Asp Asp Asn Asn Asn Asn Ser
gtg ccc atc gac gac aac aac aac aac tcc
25 30
Ser Asn Tyr Arg Leu
tcc aac tac cgc ctg

<210> SEQ ID NO 3




<400> SEQUENCE 3

Cys Ile Arg Pro Gly Asn Asn Thr Arg Thr
tgt atc aga cct ggc aac aat aca aga aca
1 5 10
Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe
agt ata cgt ata gga cca gga caa gct ttc
15 20
Tyr Ala Thr Gly Glu Ile Ile Gly Asp Thr
tat gca aca ggt gag ata ata ggg gac aca
25 30
Arg Lys Ala His Cys
aga aaa gca cat tgt

<210> SEQ ID NO 4




<400> SEQUENCE 4

Asn Cys Thr Arg Pro Asn Asn Asn Thr Arg
aac tgc acc cgc ccc aac aac aac acc cgc
1 5 10
Lys Ser Ile Arg Ile Gly Pro Gly Gln Ala
aag tcc atc cgc atc ggc ccc ggc cag gcc
15 20
Phe Tyr Ala Thr Gly Asp Ile Ile Gly Asp
ttc tac gcc acc ggc gac atc atc ggc gac
25 30
Ile Arg Gln Ala His Cys Asn
atc cgc cag gcc cac tgc aac
35 37

Иммуногенная композиция, включающая синтетические пептиды, повторяющие консенсусную последовательность группы М V1-, V2-, V3 - петли и V3 - петлю российского изолята RU A022a2 оболочечного белка gp120 ВИЧ1, а также иммуноадъювант или нагруженные пептидами дендридные клетки для введения млекопитающему.


Похожие патенты:

Изобретение относится к применению соединения формулы (I) или любой из его фармацевтически приемлемых солей, где означает ароматическое кольцо, где V представляет собой С или N, и, когда V представляет собой N, V находится в мета- или пара-положении к Z, R независимо представляет собой атом водорода, атом галогена или группу, выбранную из группы -CN, гидроксильной группы, группы -COOR1, (С1-С3)фторалкильной группы, группы (С1-С3)фторалкокси, группы -NO2, группы -NR1R2, группы (С1-С4)алкокси, группы фенокси и (С1-С3)алкильной группы, где указанный алкил возможно является монозамещенным гидроксильной группой, R1 и R2 независимо представляют собой атом водорода или (С1-С3)алкильную группу, n равно 1, 2 или 3, n′ равно 1 или 2, R′ представляет собой атом водорода, атом галогена или группу, выбранную из (С1-С3)алкильной группы, группы -NO2, группы -NR1R2, группы морфолинил, N-метилпиперазинильной группы, (С1-С3)фторалкильной группы и группы (С1-С4)алкокси, R″ представляет собой атом водорода, Z, Y, X, W, Т и U представляют собой N или С, и где максимум четыре из групп V, Т, U, Z, Y, X и W представляют собой N, и по меньшей мере одна из групп Т, U, Y, X и W представляет собой N, для изготовления лекарственного средства для предупреждения, ингибирования или лечения СПИДа.

Предложенное изобретение относится к области иммунологии. Предложено антитело против CXCR4 человека или его функциональный фрагмент, которые характенизуются тем, что содержат легкую и тяжелую цепи, содержащие по 3 соответствующих CDR.

Группа изобретений относится к долговременному применению парентерального состава для производства лекарственного препарата для лечения субъекта, инфицированного ВИЧ, причем данный препарат предназначен для подкожной или внутримышечной инъекции и состоит из бреканавира, или его соли в форме водной суспензии микро- или наночастиц, содержащей полисорбат-20, и вводится периодически с интервалами от 6 до 12 месяцев и к указанной фармацевтической композиции.

Изобретение относится к области органической химии, а именно к новым карбоксамидным соединениям формулы (I) и к их фармацевтически приемлемым солям, где R1 является фенил-С1-С6-алкилом, где фенил может быть незамещенным или замещенным 1 радикалом R1c; где R1c выбирают независимо из галогена, С1-С6-алкила, C1-C6-алкокси, где С1-С6алкильные группы могут быть частично или полностью галогенированы или могут иметь 1, 2 или 3 заместителя R1a, и -(CH2)p-NRc6Rc7, где р=0, 1, где R1a выбирают независимо из NRa6Ra7, Ra6 представляет собой С1-С6-алкил, Ra7 представляет собой С1-С6-алкил, или два радикала Ra6 и Ra7, или Rc6 и Rc7 образуют вместе с атомом N азотсодержащий 6-членный насыщенный гетероцикл, который может необязательно иметь 1 дополнительный гетероатом О в качестве члена кольца, R2 представляет собой фенил, пиридил, где фенил может быть незамещенным или может иметь 1 заместитель R2c; где R2c имеет одно из значений, указанных для R1c; R3 представляет собой С1-С6-алкил, С3-С6-алкенил, С3-С6-циклоалкил, С3-С6-циклоалкил-С1-С2-алкил, где С1-С6алкил, является незамещенным или имеет 1 заместитель Rxa, где Rxa имеет одно из значений, указанных для R1a; R5 представляет собой галоген или С1-С2-алкил, где m является 0 или 1; n является 0.

Изобретение относится к макроциклическому соединению общей формулы I, к его стереохимически изомерной форме и к его фармацевтически приемлемой соли, где R1 представляет собой F; R2 представляет собой Н, F или Cl; R3 представляет собой C1-4алкил или циклопропил; R4 представляет собой метил; J представляет собой ---N(R5)-SO2-, ---С(=O)-N(R5)-, ---N(R5)-, где пунктирная линия означает точку присоединения к пиридазиноновому кольцу; К представляет собой -(CHR6)P, или *-(СН2)q-CH=CH-CH2-, где * означает точку присоединения к группе J; L представляет собой -O-, -O-СН2-* или -N(R5)-С(=O)-*, где * означает точку присоединения к фенильному кольцу; и R5 представляет собой водород, C1-4алкил или C3-5циклоалкил; каждый R6 независимо представляет собой водород или C1-3алкил; p равно 3, 4, 5 или 6; q равно 2 или 3.

Изобретение относится к соединениям формулы (I) где: R1 представляет собой СН3, СН2СН3, Cl, Br, CHF2 или CF3; R2 представляет собой Н, ОН или F; X представляет собой СН2 или О при условии, что когда R1 представляет собой СН3 и R2 представляет собой Н, тогда X представляет собой О; и к применению таких соединений в качестве ингибиторов репликации ВИЧ.6 н.

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. Описан экспрессионный вектор для предотвращения или подавления вхождения, слияния или репликации ВИЧ в клетках млекопитающих.

Изобретение относится к новым тритерпеновым производным формулы (I) и формулы (2A), активным в отношении ВИЧ, фармацевтическим композициям на их основе, способу лечения ВИЧ, а также заболеваний, обусловленных ВИЧ, а также к промежуточному соединению формулы (3).

Изобретение относится к антиретровирусным производным азидотимидина формулы 1 и может быть использовано в качестве лекарственного средства. , где: R1+R2=-CH2(CH2)2CH2- R1+R2=-CH2(CH2)3CH2- R1=Н, R2=СН3 R1=H, R2=CH2CH2CH3 R1=H, R2=C(CH3)3 R1=H, R2=CH2(CH2)6CH3 Предложены новые эффективные средства с низкой токсичностью против ретровирусных инфекций.

Изобретение относится к применению фармацевтической композиции для местного нанесения для профилактики передаваемых половым путем вирусных заболеваний, включающей эффективное количество соединения формулы (I).

Предложенное изобретение относится к области биотехнологии, а именно к вирусоподобной частице (VLP) для применения в вакцинах или антигенных композициях для лечения или профилактики инфекции вируса бешенства (RV), а также способам их получения и применения.

Изобретение относится к области биотехнологии, вирусологии и ветеринарии. Изобретение раскрывает применение иммуногенной композиции, содержащей рекомбинантный белок PCV2 ORF2, для индукции иммунного ответа против PCV2 или для получения лекарственного средства для индукции иммунного ответа против PCV2.

Изобретение относится к области медицины и генной инженерии и предназначено для лечения вирусного гепатита С (ВГС). Предложено лекарственное средство, содержащее модифицированные псевдовирионы фага MS2, оболочка которых создана белками «А» и «В» фага MS2, а часть геномной РНК, кодирующая «репликазу», заменена РНК, способной селективно уничтожать клетки, зараженные вирусом гепатита С или его РНК репликоном, при этом геном модифицированного псевдовириона фага MS2 характеризуется нуклеотидной последовательностью, соответствующей SEQ ID NO 1.

Изобретения касаются вакцины и способа ее использования. Охарактеризованная вакцина включает: (i) живой аттенуированный QX-подобный вирус инфекционного бронхита (IB), полученный посредством пассирования на яйцах домашней птицы с развивающимися эмбрионами от 25 до 80 раз) и имеющий белок S1, кодируемый нуклеотидной последовательностью, которая по меньшей мере на 95% идентична SEQ ID NO.

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. Описан вирусный самоинактивирующийся (SIN) вектор на основе вируса саркомы и лейкоза птиц (ASLV) и расщепляющая-пакующая система.

Предложен штамм энтеровируса человека А71 типа субгенотипа С4. Штамм депонирован в Коллекции микроорганизмов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под регистрационным номером V-670.
Предлагаемое изобретение относится к области биотехнологии и касается способа получения иммуноферментной тест-системы для определения эпитопов оболочечного белка вируса Пуумала протективной направленности в вакцинных препаратах против геморрагической лихорадки с почечным синдромом (ГЛПС).

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. Раскрыта конструкция, которая, при экспрессии в клетке-хозяине, является способной продуцировать пустые вирусные капсиды.

Группа изобретений раскрывает способ вакцинации свиньи от воздействия высокотемпературной формы PRRS, включающий введение свинье иммуногенной композиции, содержащей вирус PRRS типа II, который представляет собой ослабленную форму штамма с регистрационным №АТСС VR-2332 или №АТСС VR-2495, или их потомство, причем указанная высокотемпературная форма PRRS вызывается китайским штаммом PRRSV, который имеет нуклеотидную последовательность, гомологичную по меньшей мере на 95% нуклеотидной последовательности штамма НВ-1 или JX143, а также применение вируса PRRS типа II для вакцинации свиньи от воздействия высокотемпературной формы PRRS.

Изобретение касается способа изготовления вакцины, ассоциированной против псевдомоноза и вирусной геморрагической болезни кроликов. Охарактеризованный способ включает отбор пораженных органов от павших кроликов в период их заболевания из местного эпизоотического очага, выделение чистых культур возбудителей болезней, для чего проводят раздельное выращивание культур Pseudomonas aeruginosa и вируса геморрагической болезни кроликов.

Изобретение относится к иммунологии и вирусологии. Разработано иммунобиологическое средство для индукции специфического иммунного ответа к вирусу Эбола. Средство включает рекомбинантный аденовирус человека 5 серотипа, содержащий экспрессирующую кассету со вставкой гена GP вируса Эбола, и рекомбинантный аденовирус человека 5 серотипа, содержащий экспрессирующую кассету со вставкой гена NP вируса Эбола. При этом в качестве гена GP вируса Эбола используют ген GP вируса Эбола /H.sapiens-wt/SLE/2014/Makona-G3735.1 GenBank ID KM233056 с модифицированной нуклеотидной последовательностью, выбранной из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, а в качестве гена NP вируса Эбола используют ген NP вируса Эбола /H.sapiens-wt/SLE/2014/Makona-G3735.1 GenBank ID KM233056 SEQ ID NO: 5. Иммунобиологическое средство дополнительно включает гиалуронидазу. Также разработан способ использования иммунобиологического средства для индукции специфического иммунитета к вирусу Эбола путем введения этого иммунобиологического средства в эффективном количестве. Представленные изобретения более эффективно индуцируют усиленный иммунный ответ против вируса Эбола в сравнении с аналогичными средствами за счет особенностей используемых генетических конструкций, оптимизации кодонов нуклеотидных последовательностей, кодирующих белки вируса Эбола, а также аминокислотных последовательностей белков вируса Эбола. Представленные изобретения могут быть использованы в медицине в качестве специфического профилактического средства против заболеваний, вызванных вирусом Эбола. 2 н. и 1 з.п. ф-лы, 9 ил., 2 табл., 6 пр.

Изобретение относится к медицине, а именно к иммунологии и может быть использовано для создания вакцин против ВИЧСПИД. Для этого иммуногенная композиция содержит синтетические пептиды, повторяющие консенсусную последовательность группы М V1-, V2-, V3 - петли и V3 - петлю российского изолята RU A022a2 оболочечного белка gp120 ВИЧ1, а также иммуноадъювант или нагруженные пептидами дендридные клетки. Использование данного изобретения состоит в создании иммунногенной композиции вызывающей ответ на каждый антиген композиции, состоящей на основе синтетических пептидов, повторяющих актуальные антигенные детерминанты ВИЧ. 2 пр., 2 табл.
