Анти-il-17-антитела, способ их получения и способ применения



Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения
Анти-il-17-антитела, способ их получения и способ применения

 


Владельцы патента RU 2577228:

Закрытое Акционерное Общество "БИОКАД" (RU)

Настоящее изобретение относится к области иммунологии. Предложено моноклональное антитело и его антигенсвязывающий фрагмент, обладающие способностью специфически связываться с IL-17А человека и охарактеризованные последовательностями CDR. Также рассмотрены: ДНК, кодирующая антитело или его антигенсвязывающий фрагмент по изобретению; экспрессионный вектор; клеточная линия и способ получения антитела или его фрагмента по изобретению. Кроме того, предложена фармацевтическая композиция и способ лечения опосредованного IL-17A заболевания или нарушения. Антитело по настоящему изобретению обладает способностью блокировать IL-17A стабильно в условиях термостресса и обладает большим периодом полувыведения из крови. 7 н. и 20 з.п. ф-лы, 16 ил., 1 табл., 15 пр.

 

Область применения

Настоящее изобретение относится к области медицины, в частности, к области моноклональных антител против IL-17 человека. Более подробно, изобретение относится к моноклональным антителам - антагонистам IL-17A, которые связываются с высокой аффинностью с эпитопом IL-17, при этом антитела содержат аминокислотные замены в гипервариабельных участках тяжелых и легких цепей. Антитела согласно изобретению могут быть химерными, гуманизированными или человеческими антителами, или их антигенсвязывающими фрагментами и могут использоваться в качестве лекарственного средства для лечения аутоиммунных и воспалительных нарушений и нарушений пролиферации и развития клеток. Изобретение также относится к способам получения указанных антител.

Уровень техники

Основной функцией иммунной системы является защита организма от инфекций, например, бактерий или вирусов, а также от раковых новообразований. Данная система организма включает несколько типов лимфоидных и миелоидных клеток, таких как моноциты, макрофаги, дендритные клетки, эузинофилы, Т-клетки, В-клетки и нейтрофилы.

Указанные лимфоидные и миелоидные клетки могут продуцировать сигнальные белки, известные как цитокины. Иммунный ответ включает воспаление, т.е. накопление иммунных клеток системно или в определенном участке организма. В ответ на инфекцию или чужеродное вещество, иммунные клетки секретируют цитокины, которые, в свою очередь, модулируют пролиферацию иммунных клеток, их развитие, дифференциацию или миграцию. Иммунный ответ может продуцировать патологические процессы, например, при запуске превышающего норму воспаления, как в случае аутоиммунных заболеваний (см. напр., Abbas et al. (eds.) (2000) Cellular and Molecular Immunology, W.B. Saunders Co., Philadelphia, Pa.; Oppenheim and Feldmann (eds.) (2001) Cytokine Reference, Academic Press, San Diego, Calif.; von Andrian and Mackay (2000) New Engl. J. Med. 343:1020-1034; Davidson and Diamond (2001) New Engl. J. Med. 345:340-350).

На сегодня семейство IL-17 цитокинов включает IL-17A, IL-17B, IL-17C, IL-17D, IL-17E и IL-17F. Все члены семейства IL-17 имеют четыре высококонсервативных цистеиновых остатка, которые вовлечены в формирование межцепочечных дисульфидных связей, и имеют два или более цистеиновых остатка, которые могут быть вовлечены в межцепочечные дисульфидные связи. Члены семейства IL-17 не имеют никакого сходства с последовательностями любых других известных цитокинов.

Интерлейкин-17А (IL-17A; также известный как цитотоксичный Т-лимфоцит-связанный антиген 8 (CTLA-8), IL-17) представляет собой гомодимерный цитокин в 20-30 кДа, продуцируемый Т-клетками памяти с последующим распознаванием антигена. Рост таких Т-клеток стимулируется интерлейкином-23 (IL-23). (см. напр., McKenzie et al. (2006) Trends Immunol. 27(1): 17-23; Langrish et al. (2005) J. Exp.Med. 201(2):233-40). IL-17A действует посредством двух рецепторов (IL-17RA и IL-17RC) для инициации выработки многих молекул, вовлеченных в процессы с участием нейтрофилов, воспалительные процессы и разрушение органов. Этот цитокин обладает синергическим действием с фактором некроза опухоли (ФНО) или интерлейкином 1-бета (IL-1β) для достижения более значимого провоспалительного состояния. Для лечения множества воспалительных, иммунных и пролиферативных состояний, включая ревматоидный артрит (РА), остеоартрит, остеопороз при ревматоидном артрите, воспалительный фиброз (напр.. склеродерма, фиброз легких и цирроз), гингивит, парондотоз или пародонтальные заболевания, воспалительные заболевания кишечника (напр. Болезнь Крона, язвенный колит и воспалительное заболевание кишечника), астма (включая аллергическую астму), аллергии, хроническое обструктивное заболевание легких (ХОЗЛ), рассеянный склероз, псориаз и рак, и другие, было предложено снижать активность IL-17A с помощью антител или антиген - связывающих фрагментов антител, которые являются в данном случае антагонистами этих рецепторов. (см., напр., US 2003/0166862, WO 2005/108616, WO 2005/051422, и WO 2006/013107).

В настоящее время создано несколько видов антител против IL-17, в частности, антитела против IL-17A, включая AIN457 (секукинумаб, Эбботт Лэборетриз), LY2439821 (икзекизумаб, Эли Лилли), SCH900117 (Мерк), RG4943 (Рош), и другие.

Так, в заявке на патент США US 2010/0245666 описываются антитела против IL-17 (секукинумаб, AIN457), содержащие в одном из CDR участков тяжелой или легкой цепи замену аминокислоты или ее делецию. Данные антитела характеризуются высокой аффинностью к IL-17, при этом константа диссоциации KD составляет примерно 122 µМ. Также описано применение данных антител в качестве ингибиторов связывания IL-17 с соответствующим рецептором, в частности, для лечения увеита. В настоящее время описанное антитело проходит клинические исследования по лечению ревматоидного артрита, анкилозирующей спондилоартропатии, болезни Крона, псориаза, рассеянного склероза и нейтрофилии, индуцированной озоном воздуха. Было показано, что это антитело безопасно при применении и эффективно в лечении ревматоидного артрита у 46% пациентов (Durez et al., Communication EULAR 2009-RA).

Также в предшествующем уровне техники раскрыты гуманизированные антитела против IL-17 согласно международной публикации заявки WO 2007/070750 (LY2439821, икзекизумаб, Эли Лилли). Данные антитела содержат вариабельные участки тяжелой и легкой цепей с аминокислотными заменами. При этом описанное антитело характеризуется сильным сродством к связыванию (KD) IL-17 человека, т.е. меньше чем приблизительно 7,0-4,0 пМ, и коэффициентом выведения koff для IL-17 человека меньше чем 2x10-5 с-1. Антитела проходили клинические испытания на безопасность, переносимость и эффективность при внутривенном введении пациентам с ревматоидными артритом. (Genoevse et al., Communication EULAR 2009-RA; Genoevse et al., Arthritis & Rheumatism, 62: 929-39, (2010)).

Также в предшествующем уровне техники описаны другие антитела к IL-17: мышиные анти-человеческие нейтрализующие антитела eBio64CAP17 (eBioscience) или их производные. Другие примеры антител к IL-17 раскрыты в заявках на патент US 2009/0175881A1, US 2008/0269467A1, и международных публикациях WO 2008/001063A1, и WO 2007/117749А1.

Таким образом, учитывая локализованное распространение в участках воспаления, IL-17 является новой мишенью для лечения воспалительных и аутоиммунных заболеваний с потенциально большим профилем безопасности, чем лекарства, которые нацелены на провоспалительные цитокины большого круга кровообращения, такие как ФНО (фактор некроза опухоли). На основе всего вышесказанного можно заключить, что имеется потребность в антителах, которые обладают антагонистическим действием или нейтрализуют активность IL-17A для лечения расстройств, заболеваний или состояний, где присутствие биологической активности IL-17A вызывает или способствует нежелательному патологическому результату, или там, где снижение биологической активности IL-17A способствует желательному терапевтическому результату, включая воспалительные нарушения, нарушения пролиферации и развития клеток, аутоиммунные нарушения, такие как ревматоидный артрит (РА), рассеянный склероз (PC) и воспалительные заболевания кишечника (ВЗК).

Наибольшее ограничение при применении антител в качестве препаратов накладывает иммуногенность антител и их аффинность. Т.к. большинство моноклональных антител получены на основе мышиных, периодическое применение таких антител у людей провидит к развитию иммунного ответа на терапию антителами, например, аллергических реакций. Такие типы иммунного ответа приводят в конечном итоге к потере эффективности при лечении по меньшей мере и, в худшем случае, к возможным анафилактическим реакциям.

Таким образом, согласно настоящему изобретению предложены антитела против IL-17A, содержащие аминокислотные замены, при этом предложенные антитела обладают высокой аффинностью и улучшенной растворимостью, а также повышенной IC50.

Описание рисунков

Рис.1. Форетограмма полученного раствора белка IL-17A.

Рис.2. Форетограмма полученного раствора белка IL-17A-Fc.

Рис.3. Гель электрофорез в 12% SDS-PAGE в восстанавливающих условиях (А), в невосстанавливающих условиях (В).

Рис.4. Схема синтеза комбинаторной Fab-библиотеки ламы.

Рис.5. Фагмида для клонирования Fab фаговых дисплейных библиотек.

Рис.6А. Схема синтеза комбинаторных библиотек гибридных Fab антител.

Рис.6B. Схема синтеза комбинаторных библиотек гибридных Fab антител.

Рис.7. Комбинирование пулов вариабельных доменов.

Рис.8. ИФА скрининг Fab, специфических против IL-17A человека.

Рис.9. Конкурентный ИФА скрининг Fab-кандидатов, блокирующих взаимодействие IL-17A AL-17R.

Рис.10. Результаты koff-скрининга анти-IL-17А Fab кандидатов человека.

Рис.11. Электрофореграмма раствора BCD085.

Рис.12. Гельфильтрационный профиль очищенного препарата BCD085.

Рис.13. IL-6 Ингибирующая способность BCD085 в сравнении с AIN 457.

Рис.14А. Кривая взаимодействия BCD085 с человеческим IL-17.

Рис.14B. Кривая взаимодействия BCD085 с IL-17 макаки (macaca mulatta).

Рис.15. Хроматограмма антитела BCD085, полученная после проведения термостресса.

Рис.16. Фармакокинетика препарата антитела против IL-17A BCD085 при однократном подкожном введении обезьянам макакам резус (Масаса mulatta) в дозе 40 мг/кг.

Описание изобретения

Определения

"Интерлейкин 17", также указанный как "IL-17" или "IL-17A", является 20-30 кД гликозилированным гомодимерным протеином. Ген IL-17 человека кодирует 155-ти аминокислотный протеин, который имеет 19-ти аминокислотную сигнальную последовательность и 136-ти аминокислотный зрелый сегмент. Полноразмерное антитело в том виде, в котором оно встречается в природе, представляет собой молекулу иммуноглобулина (антитела), которая состоит из четырех пептидных цепей, две тяжелые (Н) цепи (приблизительно 50-70 кД при полной длине) и две легкие (L) цепи (приблизительно 25 кД при полной длине), взаимосвязанных дисульфидными мостиками. Аминоконцевая часть каждой цепи включает вариабельный участок из приблизительно 100-110 или более аминокислот, которые в основном отвечают за распознавание антигенов. Карбоксиконцевая часть каждой цепи определяет константный участок, главным образом, отвечающий за функцию эффектора.

Антитело состоит из нескольких фрагментов: легких и тяжелых цепей. Вариабельные участки тяжелых и легких цепей образуют антигенсвязывающий центр (или участок). Строение антитела показано на рисунке ниже:

Легкие цепи классифицируют как каппа или лямбда и они характеризуются конкретным константным участком. Каждая легкая цепь состоит из вариабельного участка N-концевой легкой цепи (в данной заявке "LCVR" или “VL”) и константного участка легкой цепи, состоящего из одного домена, CL. Тяжелые цепи классифицируют как гамма, мю, альфа, дельта или эпсилон, и они определяют изотип антитела, такой как IgG, IgM, IgA, IgD и IgE, соответственно, и несколько из них могут быть дополнительно разделены на подклассы (изотипы), например IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2. Каждый тип тяжелой цепи характеризуется конкретным константным участком, Fc. Каждая тяжелая цепь состоит из вариабельного участка N-концевой тяжелой цепи (в данной заявке "HCVR" или "VH") и константного участка тяжелой цепи, СН. Константный участок тяжелой цепи состоит из трех доменов (CH1, СН2 и СН3) для IgG, IgD и IgA и 4 доменов (CH1, СН2, СН3 и СН4) для IgM и IgE. Участки HCVR и LCVR могут быть дополнительно разделены на участки гипервариабельности, названные Rf-гипервариабельными участками (CDR), перемежающиеся с более консервативными участками, названными каркасными участками (FR). Каждый HCVR и LCVR состоит из трех CDR и четырех FR, расположенных в следующем порядке от аминоконца к карбоксиконцу: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. В данной заявке 3 CDR тяжелые цепи обозначены как "CDRH1, CDRH2 и CDRH3", а 3 CDR легкой цепи обозначены как "CDRL1, CDRL2 и CDRL3". CDR содержат большинство остатков, которые образуют специфические взаимодействия с антигеном. Нумерацию и позиционирование CDR-аминокислотных остатков в пределах HCVR и LCVR участков антител согласно данному изобретению осуществляют с хорошо известной номенклатурой Kabat, если не указано иного. В настоящей заявке используется, если не указано иного, общепринятые буквенные обозначения аминокислот.

Термин «анти-IL-17-антитело», «антитело к IL-17», «антитело, специфически связывающееся с интерлейкином IL-17» или «антитело против IL-17А» являются взаимозаменяемы в контексте настоящей заявки и относятся к антителу, которое специфически связывается с IL-17A.

Термин "антитело" в связи с анти-IL-17А моноклональным антителом по изобретению (либо упрощенно, "моноклональное антитело по изобретению"), как используется в данной заявке, относится к моноклональному антителу. "Моноклональное антитело", как используется в данной заявке, относится к антителу грызуна, семейства приматов или Camelidae, предпочтительно к антителу мыши, макаки, верблюда или ламы, химерному антителу, гуманизированному антителу или полностью человеческому антителу, если в данной заявке не указано иное.

Моноклональные антитела по изобретению могут быть получены с использованием, например, гибридомных методик, хорошо известных из уровня техники, а также рекомбинантных технологий, технологий фагового дисплея, синтетических технологий или комбинаций таких технологий или других технологий, хорошо известных из уровня техники. Термин "моноклональное антитело", как его используют в данной заявке, не ограничивается антителами, полученными с помощью гибридомной технологии. "Моноклональное антитело" относится к антителу, полученному из единой копии или клона, включая, например, любой эукариотический, прокариотический или фаговый клон, а не к способу его получения. "Моноклональное антитело" может быть интактным антителом (содержащим полный или полноразмерный Fc-участок), по существу интактным антителом, частью или фрагментом антитела, содержащими антигенсвязующую часть, например Fab-фрагмент, Fab′-фрагмент или F(ab′)2-фрагмент антитела. "Fab"-фрагмент содержит вариабельный и константный домен легкой цепи и вариабельный домен и первый константный домен (СН1) тяжелой цепи. "F(ab′)2"-фрагменты антитела содержат пару Fab-фрагментов, которые в основном ковалентно связаны возле их карбоксиконцов шарнирными аминокислотами между ними. Fv-вариабельный фрагмент антитела (variable fragment), scFv (single chain Fv)-вариабельный фрагмент анти тела, у которого фрагменты легкой и тяжелой цепи связаны полипептидным линкером, (scFv)2 - фрагмент, состоящий из двух молекул scFv, соединенных дисульфидной связью, dsFv - вариабельный фрагмент, стабилизированный дополнительной внутримолекулярной дисульфидной связью. Другие химические связывания фрагментов антител также хорошо известны из уровня техники.

Термин «антитело» и «иммуноглобулин» являются взаимозаменяемыми в контексте данной заявки.

Вариабельные участки каждой из пар легкая/тяжелая цепь образуют антигенсвязывающие сайты антитела. Как используется в данной заявке, "антигенсвязывающая часть", или "антигенсвязывающий участок", или "антигенсвязывающий домен" или «антигенсвязывающий центр» относятся, взаимозаменяемо, к такой части молекулы антитела, которая содержит аминокислотные остатки, взаимодействующие с антигеном и придающие антителу его специфичность и аффинность по отношению к антигену. Эта часть антитела включает "каркасные" аминокислотные остатки, необходимые для поддержания надлежащей конформации антигенсвязывающих остатков.

Предпочтительно CDR антигенсвязывающего участка или весь антигенсвязывающий участок антител по изобретению имеет происхождение из донорской человеческой библиотеки или по существу человеческое происхождение с определенными аминокислотными остатками, измененными, например, замещенными разными аминокислотными остатками с тем, чтобы оптимизировать конкретные свойства антитела, например KD, koff, IC50. Предпочтительно каркасные участки антитела по изобретению имеют человеческое происхождение или по существу человеческое происхождение (по крайней мере на 80, 85, 90, 95, 96, 97, 98 или 99% человеческое происхождение). Предпочтительные каркасные участки антитела по изобретению имеют следующие аминокислотные последовательности, соответствующие каркасным участкам антитела человека:

Вариабельный домен тяжелой цепи

Вариабельный домен легкой цепи

В других вариантах осуществления антигенсвязывающий участок IL-17-антитела по изобретению может происходить из других нечеловеческих видов, включая кролика, крысу или хомяка, но не ограничиваясь ими. Альтернативно, антигенсвязывающий участок может происходить из человеческих видов.

Кроме того, "моноклональное антитело", как используется в данной заявке, может быть одноцепочечным Fv-фрагментом, который может быть получен путем связывания ДНК, кодирующей LCVR и HCVR, с линкерной последовательностью (см. Pluckthun, The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, p. 269-315, 1994). Подразумевается, что вне зависимости от того, указаны ли фрагменты или части, термин "антитело", как используется в данной заявке, включает такие фрагменты или части, а также одноцепочечные формы. До тех пор пока белок сохраняет способность специфического или предпочтительного связывания своей мишени (например, эпитопа или антигена), он относится к термину "антитело". Антитела могут быть гликозилированными, или не быть таковыми, и входят в рамки изобретения.

Популяция "моноклональных антител" относится к гомогенной или по существу гомогенной популяции антител (т.е. по крайней мере приблизительно 85, 90, 91, 92, 93, 94, 95, 96%, более предпочтительно по крайней мере приблизительно 97 или 98% или еще более предпочтительно по крайней мере 99% антител в популяции будут конкурировать в анализе ELISA за тот же антиген или эпитоп, или более предпочтительно антитела являются идентичными в аминокислотной последовательности). Антитела могут быть, а могут и не быть, гликолизированными и все еще подпадать в объем изобретения. Моноклональные антитела могут быть гомогенными, если они имеют идентичную аминокислотную последовательность, хотя они могут отличаться по посттрансляционной модификации, например паттернгликолизации.

"Вариант" антитела относится в данной заявке к молекуле, аминокислотная последовательность которой отличается от аминокислотной последовательности "родительского" антитела путем добавления, делеции и/или замещения одного или более аминокислотных остатков в последовательности родительского антитела. В предпочтительном из вариантов осуществления вариантное антитело содержит по крайней мере одну аминокислотную (например, от одной до приблизительно десяти и предпочтительно 2, 3, 4, 5, 6, 7 или 8) добавку, делецию и/или замещение в CDR-участках родительского антитела. Идентичность или гомологичность относительно последовательности вариантного антитела определена в данной заявке как процент аминокислотных остатков в последовательности вариантного антитела, идентичный остаткам родительского антитела, после выравнивания последовательностей и введения разрывов, при необходимости, для достижения максимального процента идентичности последовательности. Вариантное антитело сохраняет способность связывать антиген или предпочтительно эпитоп, с которым связывается родительское антитело или предпочтительно имеет по крайней мере одно свойство или биологическую активность, которая превосходит аналогичные свойства родительского антитела. Например, антитело предпочтительно обладает более сильной аффинностью связывания, большим периодом полувыведения, более низким IC50 или повышенной способностью ингибировать биологическую активность антигена, чем родительское антитело. Вариантное антитело, представляющее особый интерес, в данной заявке является антителом, проявляющим по крайней мере приблизительно 2-кратное, предпочтительно по крайней мере приблизительно 5-кратное, 10-кратное или 20-кратное увеличение биологической активности по сравнению с родительским антителом.

"Родительское" антитело в данной заявке - это антитело, кодированное аминокислотной последовательностью, которая используется для получения варианта. Родительское антитело может иметь каркасную последовательность происхождения из Lama glama, но предпочтительно каркасная последовательность имеет полностью или по существу человеческое происхождение. Родительское антитело может быть из ламы, химерным, гуманизированным или человеческим антителом.

Антитела согласно изобретению могут быть получены различными методиками конструирования, в том числе, с использованием рекомбинантных способов, включая шаффлинг ДНК, полученной из различных источников.

Термин "специфически связывает", как используется в данной заявке, относится к той ситуации, при которой один участник пары специфического связывания не связывает в значительной степени молекулы, отличные от его партнера (партнеров) по специфическому связыванию. Термин также применим, когда, например, антигенсвязывающий домен антитела по изобретению является специфическим для конкретного эпитопа, который переносится рядом антигенов, в таком случае специфическое антитело, имеющее антигенсвязывающий домен, будет способно к специфическому связыванию различных антигенов, несущих эпитоп. Соответственно, моноклональное антитело по изобретению специфически связывает IL-17 человека (т.е. IL-17A), в то время как оно специфически не связывает человеческие IL-17B, IL-17C, IL-17D, IL-17E, IL-17F.

Термин "эпитоп" относится к той части молекулы, которая способна распознаваться и связываться с антителом в одном или более антигенсвязывающих участках антитела. Эпитопы часто состоят из химически активных поверхностных групп молекул, таких как аминокислоты или сахарные боковые цепи, и обладают специфическими трехмерными структурными характеристиками, а также специфическими зарядовыми характеристиками. Под "ингибирующим эпитопом" и/или "нейтрализующим эпитопом" подразумевается эпитоп, который в контексте интактной антигенной молекулы и при связывании антителом, специфическим к эпитопу, приводит к утрате или к уменьшению биологической активности молекулы или организма, который содержит молекулу, in vivo или in vitro.

Термин "эпитоп", как используется в данной заявке, кроме того, относится к части полипептида, которая обладает антигенной и/или иммуногенной активностью у животного, предпочтительно млекопитающего, например мыши или человека. Термин "антигенный эпитоп", как используется в данной заявке, определяется как часть полипептида, с которой может специфически связываться антитело, определенная любым способом, хорошо известным из уровня техники, например при помощи традиционного иммунного анализа. Антигенные эпитопы не обязательно должны быть иммуногенными, но могут также быть имуногенными. "Иммуногенный эпитоп", как используется в данной заявке, определяется как часть полипептида, который вызывает отклик антитела у животного, как устанавливается любым способом, известным из уровня техники. "Нелинейный эпитоп" или "конформационный эпитоп" содержат несмежные полипептиды (или аминокислоты) в пределах антигенного протеина, с которым антитело, специфическое к эпитопу, связывается.

Выражения "биологическое свойство" или "биологическая характеристика" или термины "активность" или "биоактивность" по отношению к антителу по изобретению используются в данной заявке как взаимозаменяемые и включают, но не ограничиваются приведенными, эпитоп/антигенную аффинность и специфичность, способность нейтрализовать или быть антагонистом активности IL-17 in vivo или in vitro, IC50, стабильность антитела и иммуногенные свойства антитела in vivo.

Остальные идентифицируемые из уровня техники биологические свойства или характеристики антитела включают, например, перекрестную реактивность (т.е. с нечеловеческими гомологами пептида-мишени или с остальными протеинами или мишенями, в общем), и способность сохранять высокие уровни экспрессии протеина в клетках млекопитающих. Вышеуказанные свойства или характеристики могут наблюдаться, измеряться или оцениваться с использованием методик, признанных в уровне техники, включая, но не ограничиваясь приведенными, анализ ELISA, конкурентный анализ ELISA, BIACORE или анализ поверхностного плазмонного резонанса KINEXA, анализы нейтрализации in vitro или in vivo без ограничений, рецепторного связывания, продуцирования и/или секреции цитокина или фактора роста, сигнальную трансдукцию и иммуногистохимию срезов тканей, полученных из различных источников, включая человека, примата или любой другой источник.

Термин "ингибировать" или "нейтрализовать", как используется в данной заявке, по отношению к активности антитела по изобретению, означает способность в значительной степени противодействовать, препятствовать, предотвращать, ограничивать, замедлять, прерывать, уничтожать, прекращать, уменьшать или обращать, например, развитие или тяжесть того, что ингибируют, включая, но не ограничиваясь вышеприведенными, биологическую активность (например, активность IL-17) или свойство, заболевание или состояние. Ингибирование или нейтрализация активности IL-17 в результате связывания антитела по изобретению с IL-17 составляет предпочтительно по крайней мере приблизительно 20, 30, 40, 50, 60, 70, 80, 90, 95% или выше.

Термин "пациент" в данной заявке относится к млекопитающему, включая, но не ограничиваясь приведенными, мышей, обезьян, людей, млекопитающих сельскохозяйственных животных, млекопитающих спортивных животных и млекопитающих комнатных животных; предпочтительно термин относится к людям. В определенном из вариантов осуществления пациент, предпочтительно млекопитающее, предпочтительно человек, дополнительно характеризуется заболеванием или расстройством, или состоянием, опосредованными IL-17A, которые могут быть улучшены путем уменьшения биоактивности IL-17.

Термин "вектор" включает молекулу нуклеиновой кислоты, способную транспортировать другую нуклеиновую кислоту, с которой она связана, включая плазмиды и вирусные векторы, но не ограничиваясь ими. Определенные векторы способны к автономной репликации в клетке-хозяине, в которую они введены, в то время как остальные векторы могут быть интегрированы в геном клетки-хозяина и, таким образом, реплицированы наряду с геномом-хозяином. Более того, определенные векторы способны направлять экспрессию генов, с которыми они функционально связаны. Такие векторы имеют в данной заявке название "векторы рекомбинантной экспрессии" (или, упрощенно, "векторы экспрессии"), а иллюстративные векторы хорошо известны из уровня техники.

Как используется в данной заявке, выражения "клетка", "клетка-хозяин", "линия клеток" и "клеточная культура", «клеточная линия как продуцент» используются как взаимозаменяемые и включают индивидуальную клетку или клеточную культуру, являющиеся реципиентом любого выделенного полинуклеотида по изобретению или любого рекомбинантного вектора (любых рекомбинантных векторов), которые содержат последовательность, кодирующую HCVR, LCVR или моноклональное антитело по изобретению. Клетки-хозяева включают потомство индивидуальной клетки-хозяина, и потомство может не обязательно быть полностью идентичным (по морфологии или полному ДНК комплементу) оригинальной родительской клетке из-за природных, случайных или преднамеренных мутаций и/или изменений. Клетка-хозяин включает клетки, трансформированные, трансдуцированные или инфицированные рекомбинантным вектором, или моноклональное антитело, которое экспрессирует полинуклеотид по изобретению или его легкую или тяжелую цепь. Клетка-хозяин, которая содержит рекомбинантный вектор по изобретению (как стабильно включенный в хромосом-хозяин, так и не включенный), также может называться "рекомбинантной клеткой-хозяином".

Предпочтительными клетками-хозяевами для использования в изобретении являются СНО клетки (например, АТСС CRL-9096), NS0 клетки, SP2/0 клетки, COS клетки (АТСС, например, CRL-1650, CRL-1651) и HeLa (АТСС CCL-2). Дополнительные клетки-хозяева для использования в изобретении включают растительные клетки, дрожжевые клетки, другие клетки млекопитающих и прокариотные клетки.

Термин «опосредуемое IL-17A заболевание или нарушение» включает в себя заболевание или нарушение, связанное с аномальными уровнями IL-17 в организме или тканях. Данное заболевание или нарушение может быть как инфекционного или воспалительного характера, так и аутоиммуного, и может быть выбрано из ревматоидного артрита, остеоартрита, ювенильного хронического артрита, септического артрита, артрита Лайма, псориатического артрита, реактивного артрита, спондилоартропатии, системной красной волчанки, болезни Крона, язвенного колита, воспалительного заболевания кишечника, инсулинзависимого сахарного диабета, тиреоидита, астмы, аллергических заболеваний, псориаза, дерматита, склеродермии, реакции "трансплантат против хозяина", отторжения трансплантата органа, острого или хронического иммунного заболевания, связанного с трансплантацией органа, саркоидоза, атеросклероза, диссеминированного внутрисосудистого свертывания, болезни Кавасаки, болезни Грэйвса, нефротического синдрома, синдрома хронической усталости, гранулематоза Вегенера, пурпуры Шенлейна-Геноха, микроскопического васкулита почек, хронического активного гепатита, увеита, септического шока, синдрома токсического шока, септического синдрома, кахексии, инфекционных заболеваний, паразитарных заболеваний, синдрома приобретенного иммунодефицита, острого поперечного миелита, хореи Гентингтона, болезни Паркинсона, болезни Альцгеймера, инсульта, первичного билиарного цирроза, гемолитической анемии, злокачественных опухолей, сердечной недостаточности, инфаркта миокарда, болезни Аддисона, спорадического полигландулярного дефицита типа I и полигландулярного дефицита типа II, синдрома Шмидта, взрослого (острого) респираторного дистресс-синдрома, алопеции, очаговой алопеции, серонегативной артропатии, артропатии, болезни Рейтера, псориатической артропатии, связанной с язвенным колитом артропатии, энтеропатического синовита, связанной с хламидиями, иерсиниями и сальмонеллами артропатии, спондилоартропатии, атероматозного заболевания/артериосклероза, атопической аллергии, аутоиммунного буллезного заболевания, пемфигуса обыкновенного, листовидного пемфигуса, пемфигоида, болезни линейных IgA, аутоиммунной гемолитической анемии, Кумбс-положительной гемолитической анемии, приобретенной перниционзой анемии, ювенильной перниционзой анемии, миалгического энцефалита/ синдрома хронической усталости, хронического кожно-слизистого кандидоза, гигантоклеточного артериита, первичного склерозирующего гепатита, криптогенного аутоиммунного гепатита, синдрома приобретенного иммунодефицита, связанных с приобретенным иммунодефицитом заболеваний, гепатита В, гепатита С, вариабельного неклассифицируемого иммунодефицита (вариабельной неклассифицируемой гипогаммаглобулинемии), кардиомиопатии с дилятацией, женского бесплодия, недостаточности яичников, преждевременного угасания функции яичников, фиброзного заболевания легких, криптогенного фиброзного альвеолита, поствоспалительного интерстициального заболевания легких, интерстициального пневмонита, связанного с болезнью соединительной ткани интерстициального заболевания легких, связанного со смешанной болезнью соединительной ткани заболевания легких, связанного с системной склеродермией заболевания легких, связанного с ревматоидным артритом интерстициального заболевания легких, связанного с системной красной волчанкой заболевания легких, связанного с дерматомиозитом/полимиозитом заболевания легких, связанного с болезнью Шегрена заболевания легких, связанного с анкилозирующим спондилитом заболевания легких, васкулитного диффузного заболевания легких, связанного с гемосидерозом заболевания легких, индуцированного лекарственным средством интерстициального заболевания легких, фиброза, связанного с радиацией фиброза, облитерирующего бронхиолита, хронической эозинофильной пневмонии, заболевания легких с инфильтрацией лимфоцитов, постинфекционного интерстициального заболевания легких, подагрического артрита, аутоиммунного гепатита, аутоиммунного гепатита I типа (классического аутоиммунного или люпоидного гепатита), аутоиммунного гепатита II типа (гепатита, связанного с антителом против LKM), опосредуемой аутоиммунным заболеванием гипогликемии, устойчивости к инсулину типа В с акантокератодермией, гипопаратиреоза, острого иммунного заболевания, связанного с трансплантацией органа, хронического иммунного заболевания, связанного с трансплантацией органа, остеоартроза, первичного склерозирующего холангита, псориаза I типа, псориаза II типа, идиопатической лейкопении, аутоиммунной нейтропении, NOS-болезни почек, гломерулонефрита, микроскопического васкулита почек, болезни Лайма, дискоидной красной волчанки, идиопатического или NOS-мужского бесплодия, аутоиммунитета к сперматозоидам, рассеянного склероза (все подтипы), симпатической офтальмии, легочной гипертензии, вторичной для болезни соединительной ткани, синдрома Гудпасчера, легочного проявления узелкового полиартериита, острой ревматической атаки, ревматоидного спондилита, болезни Стилла, системной склеродермии, синдрома Шенгрена, болезни/артериита Такаясу, аутоиммунной тромбоцитопении, идиопатической тромбоцитопении, аутоиммунного заболевания щитовидной железы, гипертиреоидизма, зобного аутоиммунного гипотиреоза (болезнь Хашимото), атрофического аутоиммунного гипотиреоза, первичной микседемы, факогенного увеита, первичного васкулита, витилиго, острого заболевания печени, хронического заболевания печени, алкогольного цирроза, индуцированного алкоголем повреждения печени, холестаза, идиосинкразического заболевания печени, индуцированного лекарственным средством гепатита, неалкогольного стеатогепатита, аллергии и астмы, стрептококковой инфекции группы В (GBS), психических расстройств (включая депрессию и шизофрению), опосредуемых типом Th2 и типом Th1 заболеваний, острой и хронической боли (различные формы боли), и злокачественных опухолей, таких как рак легкого, молочной железы, желудка, мочевого пузыря, толстого кишечника, поджелудочной железы, яичника, предстательной железы и прямой кишки и гемопоэтические злокачественные опухоли (лейкоз и лимфома), абеталипопротеинемии, акроцианоза, острых и хронических паразитарных и инфекционных процессов, острого лейкоза, острого лимфобластного лейкоза, острого миелоидного лейкоза, острой или хронической бактериальной инфекции, острого панкреатита, острой почечной недостаточности, аденокарцином, эктопической систолы предсердий, СПИД-дементного комплекса, индуцированного алкоголем гепатита, аллергического конъюнктивита, аллергического контактного дерматита, аллергического ринита, отторжения аллотрансплантата, дефицита альфа-1-антитрипсина, бокового амиотрофическего склероза, анемии, стенокардии, дегенерации клеток передних рогов спинного мозга, терапию против CD3, антифосфолипидного синдрома, реакций гиперчувствительности против рецепторов, аортальных и периферических аневризм, расслоения аорты, артериальной гипертензии, артериосклероза, артериовенозного свища, атаксии, фибрилляции предсердий (постоянной или пароксизмальной), трепетания предсердий, атриовентрикулярной блокады, В-клеточной лимфомы, отторжения трансплантата кости, отторжения трансплантата костного мозга (ВМТ), блокады пучка Гиса, лимфомы Беркитта, ожогов, аритмий сердца, синдрома оглушения сердца, опухолей сердца, кардиомиопатии, воспалительных ответов на искусственное кровообращение, отторжения трансплантата хряща, дегенерации коры головного мозга, нарушений мозжечка, хаотической или многоочаговой тахикардии предсердий, связанных с химиотерапией нарушений, хронического миелоцитарного лейкоза (CML), хронического алкоголизма, хронических воспалительных патологий, хронического лимфоцитарного лейкоза (CLL), хронического обструктивного заболевания легких, хронической интоксикации салицилатами, карциномы ободочной и прямой кишки, застойной сердечной недостаточности, конъюнктивита, контактного дерматита, легочного сердца, болезни коронарных артерий, болезни Крейтцфельда-Якоба, культурально-негативного сепсиса, кистозного фиброза, связанных с цитокиновой терапией нарушений, деменции боксеров, демиелинизирующих заболеваний, геморрагической лихорадки денге, дерматита, дерматологических состояний, диабета, сахарного диабета, диабетического атеросклеротического заболевания, диффузного заболевания с тельцами Леви, застойной кардиомиопатии с дилятацией, нарушений базальных ганглиев, синдрома Дауна в среднем возрасте, двигательных нарушений, индуцированных лекарственным средством, которое блокирует дофаминовые рецепторы ЦНС, чувствительности к лекарственным средствам, экземы, энцефаломиелита, эндокардита, эндокринопатии, эпиглоттита, инфекции вирусом Эпштейна-Барр, эритромелалгии, экстрапирамидальных и мозжечковых нарушений, семейного гематофагоцитарного лимфогистиоцитоза, отторжения имплантата эмбрионального тимуса, наследственной атаксии Фридрейха, функциональных нарушений периферических артерий, грибкового сепсиса, газовой гангрены, язвы желудка, гломерулонефрита, отторжения трансплантата любого органа или ткани, грамотрицательного сепсиса, грамположительного сепсиса, гранулем вследствие внутриклеточных организмов, волосатоклеточного лейкоза, болезни Галлервордена-Шпатца, тиреоидита Хашимото, сенной лихорадки, отторжения трансплантата сердца, гемахроматоза, гемодиализа, гемолитическоого уремического синдрома/тромболитической тромбоцитопенической пурпуры, кровопотери, гепатита (А), аритмий пучка Гиса, ВИЧ-инфекции/ВИЧ-невропатии, болезни Ходжкина, гиперкинетических двигательных нарушений, реакций гиперчувствительности, связанного с гиперчувствительностью пневмонита, гипертензии, гипокинетических двигательных нарушений, обследования гипоталамо-гипофизарно-надпочечниковой системы, идиопатической болезни Аддисона, идиопатическоого фиброза легких, опосредуемой антителами цитотоксичности, астении, младенческой спинальной мышечной атрофии, воспаления аорты, вируса гриппа а, облучения ионизирующей радиацией, иридоциклита/увеита/оптического неврита, повреждения при ишемии-реперфузии, ишемического инсульта, ювенильного ревматоидного артрита, ювенильной спинальной мышечной атрофии, саркомы Капоши, отторжения трансплантата почки, легионеллеза, лейшманиоза, лепры, повреждений кортикоспинальной системы, жирового отека, отторжения трансплантата печени, лимфатического отека, малярии, злокачественной лимфомы, злокачественного гистиоцитоза, злокачественной меланомы, менингита, менингококкемии, метаболических/идиопатических заболеваний, мигрени, митохондриального полисистемного нарушения, смешанной болезни соединительной ткани, моноклональной гаммапатии, множественной миеломы, полисистемной дегенерации (Менцеля, Дежерина-Тома, Шая-Дрейджера и Мачадо-Джозефа), миастении, внутриклеточных Mycobacterium avium, Mycobacterium tuberculosis, миелодиспластического синдрома, инфаркта миокарда, ишемических нарушений миокарда, карциномы носоглотки, хронического заболевания легких новорожденных, нефрита, нефроза, нейродегенеративных заболеваний, нейрогенных мышечных атрофий I, нейтропенической лихорадки, неходжкинских лимфом, окклюзии брюшного отдела аорты и ее ветвей, окклюзионных нарушений артерий, терапии ОКТ3®, орхита/эпидидимита, орхита/возвратных процедур после вазэктомии, органомегалии, остеопороза, отторжения трансплантата поджелудочной железы, карциномы поджелудочной железы, паранеопластического синдрома/гиперкальцемии при злокачественной опухоли, отторжения трансплантата паращитовидной железы, воспалительного заболевания органов таза, круглогодичного ринита, заболевания перикарда, периферического артериосклеротического заболевания, периферических сосудистых нарушений, перитонита, пернициозной анемии, пневмонии Pneumocystis carinii, пневмонии, синдрома POEMS (полиневропатия, органомегалия, эндокринопатия, моноклональная гаммапатия и синдром кожных изменений), постперфузионного синдрома, синдрома после искусственного кровообращения, посткардиотомного синдрома после инфаркта миокарда, преэклампсии, прогрессирующего супрануклеарного паралича, первичной гипертензии легких, лучевой терапии, феномена и болезни Рейно, болезни Рейно, болезни Рефсума, регулярной тахикардии с узким комплексом QRS, вазоренальной гипертензии, реперфузионного повреждения, рестриктивной кардиомиопатии, сарком, склеродермии, сенильной хореи, сенильной деменции с тельцами Леви, серонегативных артропатий, шока, серповидно-клеточной анемии, отторжения аллотрансплантата кожи, синдрома кожных изменений, отторжения трансплантата тонкого кишечника, солидных опухолей, специфических аритмий, спинальной атаксии, спиномозжечковых дегенераций, стрептококкового миозита, структурных повреждений мозжечка, подострого склерозирующего панэнцефалита, обмороков, сифилиса сердечно-сосудистой системы, системной анафилаксии, синдрома системного воспалительного ответа, ювенильного ревматоидного артрита с системным началом, Т-клеточного или FAB ALL, телеангиэктазии, облитерирующего тромбоангита, тромбоцитопении, токсичности, трансплантации, травмы/кровопотери, реакций гиперчувствительности типа III, гиперчувствительности типа IV, нестабильной стенокардии, уремии, уросепсиса, крапивницы, заболеваний клапанов сердца, варикоза вен, васкулита, заболеваний вен, венозного тромбоза, фибрилляции желудочков, вирусных и грибковых инфекций, энцефалита с высоким риском смертельного исхода/асептического менингита, гемофагоцитарного синдрома с высоким риском смертельного исхода, синдрома Вернике-Корсакова, болезни Вилсона, отторжения ксенотрансплантата любого органа или ткани, острого коронарного синдрома, острого идиопатического полиневрита, острой воспалительной демиелинизирующей полирадикулоневропатии, острой ишемии, болезни Стилла взрослых, очаговой алопеции, анафилаксии, синдрома антифосфолипидных антител, апластической анемии, артериосклероза, атопической экземы, атопического дерматита, аутоиммунного дерматита, аутоиммунного нарушения, связанного со стрептококковой инфекцией, аутоиммунной энтеропатии, аутоиммунной потери слуха, аутоиммунного лимфопролиферативного синдрома, аутоиммунного миокардита, аутоиммунного преждевременного угасания функции яичников, блефарита, бронхоэктазов, буллезного пемфигоида, сердечно-сосудистого заболевания, катастрофического антифосфолипидного синдрома, глютеиновой болезни, шейного спондилеза, хронической ишемии, рубцового пемфигоида, клинически изолированного синдрома (cis) с риском рассеянного склероза, конъюнктивита, психиатрического нарушения с началом в детском возрасте, хронического обструктивного заболевания легких, дакриоцистита, дерматомиозита, диабетической ретинопатии, сахарного диабета, грыжи межпозвоночного диска, пролапса межпозвоночного диска, индуцированной лекарственным средством иммунной гемолитической анемии, эндокардита, эндометриоза, эндофтальмита, эписклерита, полиформной эритемы, тяжелой полиформной эритемы, гестационного пемфигоида, синдрома Гийена-Барре,сенной лихорадки, синдрома Хьюза, идиопатической болезни Паркинсона, идиопатической интерстициальной пневмонии, опосредуемой IgE аллергии, иммунной гемолитической анемии, миозита с тельцами включения, инфекционного воспалительного заболевания глаз, воспалительного демиелинизирующего заболевания, воспалительного заболевания сердца, воспалительного заболевания почек, идиопатического пневмосклероза/ идиопатического легочного фиброза, ирита, кератита, сухого кератоконъюнктивита, болезни Куссмауля или болезни Куссмауля-Мейера, паралича Ландри, гистиоцитоза клеток Лангерганса, синдрома мраморной кожи, дегенерации желтого пятна, микроскопического полиангиита, болезни Бехтерева, нарушений двигательных нейронов, пемфигоида слизистых оболочек, полиорганной недостаточности, миастении, миелодиспластического синдрома, миокардита, нарушений корешков нервов, невропатии, не-А не-В гепатита, оптического неврита, остеолизиса, рака яичника, олигоартикулярного ювенильного ревматоидного артрита, окклюзионого заболевания периферических артерий, заболевания периферических сосудов, заболевания периферических артерий (PAD), флебита, узелкового полиартериита (или нодозного полиартериита), полихондрита, ревматической полимиалгии, полиоза, полиартикулярного ювенильного ревматоидного артрита, синдрома полиэндокринной недостаточности, полимиозита, ревматической полимиалгии (PMR), синдрома после искусственного кровообращения, первичного паркинсонизма, рака предстательной железы и прямой кишки и гемопоэтических злокачественных опухолей (лейкоз и лимфому), простатита, истинной эритроцитарной аплазии, первичной недостаточности надпочечников, рецидивирующего оптического нейромиелита, рестеноза, ревматической болезни сердца, SAPHO (синовит, акне, пустулез, гиперостоз и остеит), склеродермии, вторичного амилоидоза, шокового легкого, склерита, ишиаса, вторичной недостаточности надпочечников, связанного с кремнийорганическими соединениями заболевания соединительных тканей, дерматоза Снеддона-Уилкинсона, анкилозирующего спондилита, синдрома Стивенса-Джонсона, синдрома системного воспалительного ответа, височного артериита, токсоплазменного ретинита, токсического эпидермального некролиза, поперечного миелита, TRAPS (связанный с рецептором фактора некроза опухоли периодический синдром), аллергической реакции I типа, диабета типа II, крапивницы, обычной интерстициальной пневмонии, васкулита, весеннего конъюнктивита, вирусного ретинита, синдрома Фогта-Коянаги-Харада (синдром VKH), влажной дегенерации желтого пятна, заживления ран и связанной с иерсиниями и сальмонеллами артропатии.

Подробное описание антител

Согласно настоящему изобретению, предложено выделенное моноклональное антитело или его активный фрагмент, обладающие способностью специфически связываться с IL-17A человека, характеризующиеся тем, что

а) вариабельный домен их тяжелой цепи (VH) содержит 3 гипервариабельных участка HCDR1, HCDR2 и HCDR3, где

HCDR1 включает аминокислотную последовательность SEQ NO: 1 (согласно номенклатуре Kabat):

FTFS-X31-X32-X33-X34-X35, где Х31, Х32, Х33, Х34 и Х35, представляют собой, аминокислоту N, Y, А, М, S, соответственно;

HCDR2 включает аминокислотную последовательность SEQ ID: NO 2:

X50-I-X52-X52a-X52b-X53-X55-X56-X57-X58, где Х52, Х52а, X52b, Х53, Х55, Х56, Х57 и Х58 представляют собой аминокислоту R, D, G, G, I, S, S, Т и Y, соответственно;

HCDR3 включает аминокислотную последовательность SEQ ID: NO 3:

CA-X94-X95-Y-X97-X98-X99-X100-X100a, где Х94, Х95, Х97, Х98, Х99, X100 и X100a представляют собой аминокислоту V, N, Y, G, М, Y и Y, соответственно;

б) вариабельный домен их легкой цепи (VL) содержит 3 гипервариабельных участка LCDR1, LCDR2 и LCDR3, где

LCDR1 включает аминокислотную последовательность SEQ ID: NO 4:

TGTS-X28-X29-X30-X31-X32-X33-X34-X35-X36- Х37, где Х28, Х29, Х30, Х31, Х32, Х33, Х34 и Х35 представляют собой Е, D, V, G, F, G, N, Y, V и S соответственно;

LCDR2 включает аминокислотную последовательность SEQ ID: NO 5:

X50-X51-X52-X53-R-P-S, где Х50, Х51, Х52 и Х53 представляют собой аминокислоту R, V, N и Т, соответственно;

LCDR3 включает аминокислотную последовательность SEQ ID: NO 6:

C-X89-X90-X91-X92-X93-X94-X95-X95a-X95b, где X89, X90, X91, X92, X93, X94, X95, X95a и X95 представляют собой аминокислоту A, S, Y, R, А, G, G, Т и Y, соответственно;

при этом они необязательно содержат мутации в вариабельном домене тяжелой цепи, выбранные из группы, включающей: N31D, N31K, N31L, N31P, N31T, Y32F, A33G, A33N, A33S, А33Т, A33V, M34I, S35G, S35N, S35T, R50G, R50I, R50L, R50M, R50S, D52E, G52aM, G52bL, G52bR, G52bV, I53L, S55T, S55L, S55R, S55W, S56T, S56S, S56Y, T57S, T57L, T57R, T57W, Y58T, Y58L, Y58K, V94R, V94A, V94I, N95E, N95L, N95S, N95T, N95V, Y97F, Y97V, G98S, M99A, M99F, M99L, M99P, M99Y, Y100F, Y100H, Y100I, Y100S, Y100W, Y100aA, Y100aI, Y100aN, Y100aR, Y100aS и/или Y100aV,

и, необязательно содержат мутации в вариабельном домене легкой цепи, выбранные из группы, включающей: E28N, E28R, D29S, V30L, V30R, G31V, F32Y, F32L, F32S, F32T, F32V, G33L, G33V, N34S, N34P, N34R, Y35W, Y35A, Y35L, R50E, R50L, V51S, V51L, N52G, T53I, Т53К, T53L, T53R, T53W, A89S, S90G, S90T, Y91F, Y91A, Y91I, R92K, A93S, G94F, G95H, Y95bI, Y95bL и/или Y95bW.

Еще в одном предпочтительном варианте реализации изобретения антитело представляет собой выделенное моноклональное антитело, специфически связывающееся с IL-17A человека, или его фрагмент, содержащий вариабельные домены тяжелой цепи (VH) и легкой цепи (VL), где указанное антитело или его активный фрагмент содержит по меньшей мере один вариабельный домен, включающий:

а) вариабельный домен тяжелой цепи (VH) антитела, который включает аминокислотную последовательность SEQ ID NO: 7.

б) вариабельный домен легкой цепи (VL) антитела, который включает аминокислотную последовательность SEQ ID NO: 8.

Также антитело может содержать аминокислотную последовательность тяжелой цепи, идентичную SEQ ID NO: 9. Еще в одном варианте реализации антитело содержит легкую цепь с аминокислотной последовательностью, идентичной SEQ ID NO: 10.

Также антитела согласно настоящему изобретению могут содержать дополнительные мутации M252Y/S254T/T256E, N434W, N434A, N434F, H433K/N434F/Y436H, H433K/N434F/Y436H+M252Y/S254T/T256E, T307A/E380A/N434A, T250Q/M428L. Указанные замены не приводят к потере способности антитела связывать IL-17A, но могут приводить к снижению ADCC (антитело-зависимой клеточно-опосредованной цитотоксичности) или увеличению аффинности или других биологических свойств антител.

Антитела согласно настоящему изобретению обладают улучшенными биологическими свойствами, в частности, лучшей ингибирующей способностью (IC50) в отношении IL-17A и повышенной агрегационной стабильностью.

Также, согласно изобретению предложена ДНК, кодирующая описанные антитела, а также экспрессионный вектор, содержащий указанную конструкцию ДНК, для получения антител согласно изобретению.

Кроме того, предложена клеточная линия, содержащая в клетках экспрессионный вектор с ДНК, описанной выше, которая может быть использована в качестве продуцента антитела согласно данному изобретению.

Фармацевтические композиции

Антитело по изобретению может быть включено в фармацевтическую композицию, пригодную для введения пациенту (см., Пример 14). Антитела по изобретению могут быть введены отдельно или в комбинации с фармацевтически приемлемым носителем, разбавителем и/или наполнителем в однократных или многократных дозах. Фармацевтические композиции для введения разработаны таким образом, чтобы соответствовать выбранному режиму введения, а фармацевтически приемлемые разбавители, носители и/или наполнители, такие как диспергирующие агенты, буфера, поверхностно-активные вещества, консерванты, солюбилизирующие агенты, изотонические агенты, стабилизаторы и т.п. использованы должным образом (см. пример 14). Указанные композиции разработаны в соответствии с традиционными методами, приведенными в, например, Remington, The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA 1995, где описаны различные методы получения композиций, в общем известных специалистам.

Фармацевтическая композиция, содержащая анти-IL-17 моноклональное антитело по изобретению, может быть введена пациенту, имеющему риск развития или имеющему патологии, как описано в данной заявке, с использованием стандартных методов введения, включая пероральное, внутривенное, интраперитонеальное, подкожное, легочное, трансдермальное, внутримышечное, интраназальное, буккальное, сублингвальное или при помощи суппозиториев.

Фармацевтическая композиция по изобретению предпочтительно содержит или является "терапевтически эффективным количеством" антитела по изобретению. "Терапевтически эффективное количество" относится к количеству, эффективному при дозировках и на протяжении периодов времени, необходимого для достижения желаемого терапевтического результата. Терапевтически эффективное количество антитела может варьироваться в зависимости от таких факторов, как состояние болезни, возраст, пол и вес индивидуума, и способности антитела или части антитела вызывать желательную реакцию у индивидуума. Терапевтически эффективное количество также представляет собой количество, при котором терапевтически полезный эффект антитела преобладает над токсическим или вредным эффектом. "Профилактически эффективное количество" относится к количеству, эффективному при дозировках и на протяжении периодов времени, необходимых для достижения желательного профилактического результата. Поскольку профилактическую дозу используют для индивидуумов до или на ранней стадии заболевания, то, типично, профилактически эффективное количество может быть меньшим, чем терапевтически эффективное количество.

Терапевтически эффективное или профилактически эффективное количество представляет собой, по крайней мере, минимальную дозу, но меньшую, чем токсическая доза активного агента, необходимую для обеспечения терапевтической пользы пациенту. С другой стороны, терапевтически эффективное количество антитела по изобретению представляет собой количество, которое у млекопитающих, предпочтительно людей, снижает биологическую активность IL-17, например связывание IL17R, где присутствие IL-17 вызывает или способствует нежелательным патологическим эффектам, или снижение уровней IL-17 вызывает благоприятный терапевтический эффект у млекопитающего, предпочтительно человека.

Путь введения антитела по изобретению может быть пероральным, парентеральным, путем ингаляции или местным. Предпочтительно антитела по изобретению могут быть включены в фармацевтическую композицию, пригодную для парентерального введения. Термин "парентеральный", как используется в данной заявке, включает внутривенное, внутримышечное, подкожное, ректальное, вагинальное или интраперитонеальное введение. Преимущественным является введение путем внутривенной или интраперитонеальной, или подкожной инъекции. Подходящие носители для таких инъекций непосредственно известны из уровня техники.

Фармацевтическая композиция, как указано в соответствующих руководствах, должна быть стерильной и стабильной в условиях производства и хранения в контейнере, который обеспечивается, включая, например, герметично закрытый флакон (ампула) или шприц. Поэтому фармацевтические композиции могут быть стерильно профильтрованными после получения состава либо сделаны микробиологически пригодными иным образом. Типичная композиция для внутривенной инфузии может иметь объем в 250-1000 мл жидкости, такой как стерильный раствор Рингера, физиологический раствор, раствор декстрозы и раствор Хенка, и терапевтически эффективную дозу (например, 1-100 мг/мл или более) концентрации антитела. Доза может варьировать в зависимости от вида и тяжести заболевания. Как хорошо известно из уровня техники в области медицины, дозировки для любого из пациентов зависят от многих факторов, включая размеры пациента, площадь поверхности тела, возраст, конкретное соединение, предназначенное для введения, пол, время и путь введения, общее состояние здоровья и другие лекарства, которые вводят одновременно. Типичная доза может находиться, например, в диапазоне 0,001-1000 мкг; однако, предвидятся дозы, находящиеся ниже или выше этого иллюстративного диапазона, особенно учитывая вышеуказанные факторы. Режим дозировок ежедневного парентерального введения может составлять от 0,1 мкг/кг до 100 мг/кг от общей массы тела, предпочтительно от 0,3 мкг/кг до 10 мг/кг и более предпочтительно от 1 мкг/кг до 1 мг/кг, даже более предпочтительно от 0,5 до 10 мг/кг массы тела в день. Процесс лечения можно контролировать путем периодической оценки состояния пациента. Для повторного введения в течение нескольких дней или дольше в зависимости от состояния пациента лечение повторяют до достижения желаемого ответа или подавления симптомов болезни. Однако также могут применяться другие режимы дозировок, которые не описаны в данной заявке. Желаемая дозировка может быть введена путем одноболюсного введения, множественных болюсных введений или путем непрерывного инфузионного введения антитела в зависимости от образца фармакокинетического распада, которого хочет достигнуть практикующий специалист.

Эти предположительные количества антитела в сильной степени зависят от решения терапевта. Ключевым фактором выбора соответствующей дозы и режима является желаемый результат. Факторы, рассматриваемые в данном контексте, включают конкретное заболевание, которое лечат, конкретное млекопитающее, которое лечат, клиническое состояние отдельного пациента, причину расстройства, место введения антитела, конкретный вид антитела, способ введения, режим введения и остальные факторы, известные практикующим специалистам-медикам.

Терапевтические агенты по изобретению могут быть заморожены либо лиофилизированы и восстановлены перед применением в подходящем стерильном носителе. Лиофилизирование и восстановление могут приводить к различным степеням потери активности антитела. Дозировки могут быть скорректированы для компенсации этой потери. В общем случае, преимущественными являются значения pH фармацевтической композиции от 6 до 8.

Готовые изделия

В другом из вариантов осуществления по изобретению обеспечивается готовое изделие, содержащее материалы, полезные для лечения или профилактики расстройств или состояний, описанных выше.

Готовое изделие содержит контейнер, содержащий фармацевтическую композицию с антителом, с обозначением и возможно инструкцию. Подходящие контейнеры включают, например, флаконы, ампулы, шприцы и аналитические пробирки. Контейнеры могут быть сделаны из ряда материалов, таких как стекло или полимерный материал. Контейнер содержит композицию согласно изобретению, которая является эффективной для лечения заболевания или нарушения, опосредованного IL-17A, и может иметь выход со стерильным доступом (например, контейнер может быть пакетом для внутривенного раствора или флаконом, имеющим пробку, проницаемую для гиподермальной иглы для инъекций). Активный агент в композиции является анти-IL-17-антителом согласно изобретению. Обозначение на контейнере и инструкция, присоединенная к нему, указывает на то, что композицию применяют для лечения выбранного заболевания. Готовое изделие может дополнительно содержать второй контейнер, содержащий фармацевтически приемлемый буфер, такой как фосфатно-буферный раствор, раствор Рингера и раствор декстрана. Он может дополнительно включать другие материалы, желательные с коммерческой и потребительской точки зрения, включая другие буферы, разбавители, фильтры, иглы, шприцы и вкладыши в упаковку с инструкциями по применению.

Следующие примеры приведены только в иллюстративных целях и не предназначены для ограничения области данного изобретения.

Примеры

Пример 1

Продукция рекомбинантных антигенов и антител в суспензионной культуре клеток млекопитающих

Антитела и антигены продуцировали в клетках постоянной клеточной линии, полученной из клеток яичника китайского хомячка (линия СНО-К1), согласно опубликованным протоколам [Biotechnol Bioeng. 2005 Sep 20; 91(6):670-677, Liao Metal., 2004; Biotechnol Lett. 2006 Jun; 28(11):843-848; Biotechnol Bioeng. 2003 Nov 5; 84(3):332-342]. Использовали клетки, конститутивно эспрессирующие ген белка EBNA1 (Epstein-Barrvirus nuclear antigen 1). Суспензионное культивирование осуществляли в колбах на орбитальном шейкере, с использованием бессывороточных сред производства компании Life Technologies Corporation и согласно инструкциям производителя. Для транзиентной экспрессии клетки в концентрации 2*106/мл трансфецировали с помощью линейного полиэтиленимина (ПЭИ «МАХ», компания «Polysciences»). Соотношение ДНК/ПЭИ составляло 1:3-1:10. Через 5-7 дней после трансфекции культуральную среду центрифугировали при 2000g в течение 20 минут и фильтровали через фильтр с размером пор 0,22 мкм. Целевые белки выделяли из культуральной жидкости с помощью аффинной хроматографии.

Рекомбинантный белок IL-17A, содержащий шесть аминокислот His на С-конце белка, выделили и очистили из культуральной жидкости, используя смолу Profinity IMAC Ni-charged (от компании Bio-Rad). До очистки в культуральную жидкость добавили NiCl2 до концентрации 1 мМ. Далее добавили в культуральную жидкость 5 мл смолы Profinity IMAC Ni-charged и перемешивали на качалке 1 час при комнатной температуре. Перенесли сорбент на колонку Thermo scientific Polypropylene columns объемом 5 мл, промыли 5 колоночными объемами ФСБ, чтобы вымыть неспецифически связывающие компоненты. Связанный антиген элюировали, используя 0,3 М имидазол, pH 8, 150 мМ NaCl. Далее белок перевели в ФСБ (pH 7,4) с помощью диализа, используя технологию SnakeSkin Dialysis Tubing, профильтровали (0,22 мкм), перенесли в пробирки и хранили при -70°C. Чистоту полученного раствора белка оценивали с помощью SDS-гель-электрофореза (Рис.1).

Рекомбинантный белок IL-17A-Fc из культуральной жидкости выделили и очистили, используя колонку для аффинной хроматографии протеин А. Осветленную культуральную жидкость пропускали через колонку HiTrap rProtein A Sepharose FF объемом 5 мл (GE Healthcare), которая была уравновешена фосфатно-солевым буфером (ФСБ, pH 7,4). Затем колонку промыли 5 колоночными объемами ФСБ, чтобы вымыть неспецифически связывающие компоненты. Связанный антиген элюировали, используя 0,1 М глициновый буфер pH 3. Главный протеиновый пик элюции собрали и довели его pH до нейтральности с помощью 1 М буфера Tris (pH 8). Все стадии проводили при скорости потока 110 см/ч. Далее белок перевели в ФСБ (pH 7,4) с помощью диализа, используя технологию SnakeSkin Dialysis Tubing, профильтровали (0,22 мкм), перенесли в пробирки и хранили при -70°C. Чистоту полученного раствора белка оценили с помощью SDS-гель-электрофореза (Рис.2).

Антитела IgG1 очищали на колонке Hi Trap rProteinA FF объемом 1 мл (GE Healthcare) согласно методике, описанной выше для антигена IL-17A-Fc. Чистоту полученного раствора белка оценивали с помощью SDS-гель-электрофореза (Рис.3).

Пример 2

Иммунизация ламы IL-17A человека и создание Fab библиотеки фаговых антител ламы

Животное Lama Glama последовательно иммунизировали 5 раз путем подкожного введения антигенного материала, смешанного с равным объемом полного (в при первой инъекции) или неполного (при остальных инъекциях) адъюванта Фрейнда. В качестве антигена использовали смесь рекомбинантных белков (по 0,2 мг каждого из белков на 1 инъекцию), одним из которых был человеческий IL-17A (набор от R&D Systems). Вторую инъекцию (стадию иммунизации) проводили через 3 недели после первой, затем с интервалом в две недели проводили еще три иммунизации. Взятие крови (50 мл) проводили через 5 дней после каждой инъекции, начиная с третьей.

Кровь разводили в 2 раза раствором ФСБ, содержащим 1 мМ ЭДТА. 35 мл разбавленного раствора крови наслаивали на среду Histopaque® - 1077 (от Sigma) с плотностью 1,077 г/мл объемом 15 мл и проводили центрифугирование в течение 20 мин при 800g. Мононуклеарные клетки (лимфоциты и моноциты) отбирали из интерфазной зоны плазма/среда Histopaque, после чего промывали раствором ФСБ, содержащим 1 мМ ЭДТА.

Суммарную РНК мононуклеарных клеток ламы выделяли с помощью набора RNeasy Mini Kit согласно предлагаемому протоколу (QIAGEN). Концентрацию РНК определяли с помощью Nanovue (GE Healthcare) и проверяли качество выделенной РНК с помощью электрофореза в 1,5%-ном агарозном геле.

Реакцию обратной транскрипции проводили с использованием набора MMLV RT kit (от Evrogen) согласно рекомендуемому протоколу с использованием обратной транскриптазы MMuLV и рандом-гексамерных олигонуклеотидов в качестве затравки.

Продукты обратной транскрипции использовали в качестве матрицы в двухступенчатой полимеразной цепной реакции для получения генов вариабельных доменов, фланкированных сайтами рестрикции, с использованием набора олигонуклеотидов и протоколам авторов [J Biol Chem. 1999 Jim 25; 274(26):18218-30; WO 2010/001251]. Далее, соединение генов вариабельных доменов легких и тяжелых цепей в один фрагмент проводили путем последовательных реакций рестрикции, лигирования и амплификации, согласно схеме, приведенной на Рис 1. Гены тяжелых цепей соединяли с генами каппа и отдельно с генами лямбда легких цепей. При этом расчетное количество молекул матрицы во всех реакциях составляло не менее 1011. Полученный ДНК препарат VL-CK-VH обрабатывали рестриктазами NheI /Eco91I и лигировали в оригинальную фагмиду pH 5. Строение фагмиды показано на Рис.2. Продукты лигирования трансформировали в электрокомпетентные клетки штамма SS320, приготовленные согласно протоколам [Methods Enzymol. 2000; 328:333-63]. Репертуар производной каппа Fab библиотеки составил 5,1*108 и лямбда 3,7*108, соответственно. Препарат фага наивных библиотек был приготовлен согласно процедуре, описанной ранее [J Mol Biol. 1991 Dec 5; 222(3):581-97].

Пример 3

Селекция Fab-библиотек фаговых антител

Специфичные анти-IL17A фаговые Fab-антитела выделяли из фаговой Fab-дисплейной библиотеки на рекомбинантном IL-17A человека (набор от R&D Systems), осуществляя серии циклов селекции, как описано ранее (J Biol Chem. 1999 Jun 25; 274(26):18218-30; Nat Biotechnol. 1996 Mar; 14(3):309-14; J Mol Biol. 1991 Dec 5; 222(3):581-97). Для осуществления селекции методом пэннинга, IL-17A человека в 50 мМ карбонатном буфере (pH 9,5) адсорбировали в течение ночи при 4°C на поверхности сорбирующих пробирок HighSorb (Nunc). Пробирки промывали ФСБ (pH 7,4), затем блокировали раствором ФСБ (pH 7,4) - обезжиренное молоко (0,5% мас./об.) в течение 1 ч. Далее, 2-4 мл раствора фагов в ФСБ (pH 7,4) - обезжиренное молоко (0,5% мас./об.), в концентрации 1012 фаговых частиц на мл добавляли в пробирку с антигеном и инкубировали в течение 1 ч при перемешивании. Несвязавшиеся фаги удаляли в ходе серий циклов промывки с использованием раствора ФСБ (pH 7,4) - Твин 20 (0,1% об./об.). Количество отмывок увеличивали от первого раунда к треьему раунду 20-30-40 раз, соответственно. Оставшиеся связанными фаговые частицы элюировали 100 мМ раствором Gly-HCl (pH 2,5) в течении 15 мин при перемешивании, затем нейтрализовали 1 М TRIS-HCl (pH 7.6). Бактерии штамма Е. coli TG1 инфицировали полученными фагами, затем фаги выделяли и использовали в следующем цикле селекции.

Пример 4

Конструирование библиотек химерных Fab фаговых антител

Суммарную РНК В-лимфоцитов из крови пятисот пятидесяти человеческих доноров выделяли с помощью набора RNeasy Mini Kit согласно предлагаемому протоколу (от QIAGEN). Концентрацию РНК определяли с помощью набора Nanovue (от GE Healthcare) и проверяли качество выделенной РНК с помощью электрофореза в 1,5%-ном агарозном геле. Реакцию обратной транскрипции проводили с использованием набора MMLV RT kit (от Evrogen) согласно рекомендуемому протоколу с использованием обратной транскриптазы MMuLV и рандом-гексамерных олигонуклеотидов в качестве затравки.

Продукты обратной транскрипции использовали в качестве матрицы в двухступенчатой полимеразной цепной реакции для получения генов вариабельных доменов, фланкированных сайтами рестрикции, с использованием набора олигонуклеотидов и протоколам авторов [J Biol Chem. 1999 Jim 25; 274(26):18218-30]. Создание химерных Fab, специфичных против IL-17A, проводили согласно технологии, описанной в международной публикации WO 93/06213, на основе оригинальной фагмиды pH 5, описанной выше. Для этого, соединение генов вариабельных доменов легких цепей доноров человека с геном вариабельного домена тяжелой цепи антитела А1 ламы в один фрагмент проводили путем последовательных реакций рестрикции, лигирования и амплификации, согласно схеме, приведенной на Рис.6А. Аналогично, соединение гена вариабельного домена легкой цепи антитела клона А1 ламы с генами вариабельных доменов тяжелых цепей доноров человека с геном вариабельного домена тяжелой цепи антитела клона А1 ламы в один фрагмент проводили путем последовательных реакций рестрикции, лигирования и амплификации, согласно схеме, приведенной на Рис.6B. При этом расчетное количество молекул матрицы генов вариабельных доменов человека во всех реакциях составляло не менее 1012. Полученный ДНК препарат VL-CK-VH обрабатывали рестриктазами NheI /Eco91I и лигировали в оригинальную фагмиду pH 5. Продукты лигирования трансформировали в электрокомпетентные клетки штамма SS320, приготовленные согласно протоколам [Methods Enzymol. 2000; 328:333-63.]. Репертуар химерной Fab-библиотеки chAlVH/hVL на основе тяжелой цепи клона А1 и смешанных каппа и лямбда цепей человека составил 2,8*109 трансформантов. Репертуар химерной Fab-библиотек chAlVL/hVH на основе легкой цепи клона А1 и тяжелых цепей человека составил 1,1*1010. Препараты фага химерных Fab-библиотек были приготовлены согласно процедуре, описанной ранее [J Mol Biol. 1991 Dec 5; 222(3):581-97].

Селекции полученных фаговых химерных Fab-библиотек проводили в условиях аналогичных, описанным выше (см. селекция фаговых Fab библиотек).

После второго раунда селекции на IL-17A, обе библиотеки показали значительное обогащение. Результирующие пулы клонов обогащенных химерных Fab-библиотек были использованы в качестве источника для комбинации генов вариабельных доменов VH и VK/VL человека специфичных против IL-17A.

Пример 5

Конструирование библиотеки Fab фаговых антител человека, специфичных против IL-17A

Для создания Fab-фаговых антител человека, специфичных против IL-17A, пулы клонов из обогащенных химерных Fab-библиотек были использованы в качестве источника для комбинации генов вариабельных доменов VH и VK/VL человека, специфичных против IL-17A. Для этого гены легких цепей человека были амплифицированы со специфическими праймерами из обогащенной после второго раунда библиотеки chAlVH/hVL, а гены тяжелых цепей человека были амплифицированы со специфическими праймерами из обогащенной после второго раунда библиотеки chAlVL/hVH. Оба пула генов вариабельных доменов цепей человека были комбинированы последовательно реакцией рестрикции с рестриктазой SfiI, лигирования и амплификации, согласно схеме, приведенной на Рис.7. Полученный ДНК препарат VL-CK-VH обрабатывали рестриктазами NheI/Eco91I и лигировали в оригинальную фагмиду pH5. Продукты лигирования трансформировали в электрокомпетентные клетки штамма SS320, приготовленные согласно протоколам [Methods Enzymol. 2000; 328:333-63]. Репертуар Fab-библиотеки на основе тяжелых и легких цепей человека составил 8,6*108. Препараты фага химерных Fab-библиотек были приготовлены согласно процедуре, описанной ранее [Mol Biol. 1991 Dec5; 222(3): 581-97].

Селекции полученных фаговых химерных Fab-библиотек проводили в условиях аналогичных, описанным выше (см. селекция фаговых Fab-библиотек).

После второго раунда селекции на IL-17A, проведенный ИФА анализ препарата поликлонального фага показал значительное обогащение. Результирующий пул клонов, обогащенных Fab человека, специфичных против IL-17A, был реклонирован в экспрессионную плазмиду.

Пример 6А

Анализ специфического связывания Fab с IL-17A-Fc человека ИФА (ELISA) используют для измерения связывания исследуемых Fab-фрагментов с IL-17A человека. В качестве позитивного контроля использовали Fab с опубликованной последовательностью AIN457 (от Novartis). Для анализа специфического связывания лунки планшетов ELISA (от Nunc ImmunoMaxisorp) покрывали 50 мкл (0,5 мкг/мл в 1X покрывающем карбонатном буфере) IL-17A-Fc, герметично закрывали и инкубировали в течение ночи при 4°C. Все последующие этапы проводили по стандартному ИФА протоколу с использованием высокопроизводительной автоматизированной платформы на базе роботизированных систем GenetixQ-pix2×t (от Molecular Device) и Tecan Freedom EVO 200 (от Tecan). Для блокирования неспецифического связывания добавляют блокирующий буфер ВВ (200 мкл 0,5% нежирного молока в ФСБ). Планшеты инкубировали на шейкере в течение часа при комнатной температуре. После отмывок ФСБ-Твином добавляли по 50 мкл на лунку тестируемого клеточного супернатанта, содержащего исследуемый Fab, смешанного с равным объемом ВВ. Планшеты снова инкубировали, встряхивая, один час при комнатной температуре, после чего каждую лунку планшетов пять раз промывали буфером ФСБ-Твин. После промывания добавляли (50 мкл/лунку) анти-человеческого Fab HRP-конъюгированного вторичного антитела (от Pierce-ThermoScientific) в соотношении 1:5000 в ФСБ-Твин. Планшеты встряхивали на ротационном шейкере (50 мин, комнатная температура) и промывали пять раз буфером ФСБ-Твин, как описано выше.

Колориметрический сигнал развивали добавлением ТМВ (100 мкл/лунку) до насыщения (в среднем 3-5 мин), затем дальнейшее развитие останавливали добавлением стопового раствора (100 мкл/лунку, 10% серная кислота). Цветовой сигнал измеряли при длине волны 450 нм, используя подходящий планшет-ридер Tecan-Sunrise (от Tecan). Степень связывания антитела была пропорциональна продуцированию цветового сигнала.

Для примера приведены результаты ИФА скрининга с одного планшета Fab-ламы, после второго раунда селекции (Рис.8). На приведенной гистограмме можно видеть ряд позитивных клонов, давших сигнал выше или ниже контрольного Fab (AIN457) (отмечен красным) или вообще не взаимодействующих с иммобилизованным антигеном (значения в интервале 0,1-0,2 отн. ед.).

Пример 6Б

Конкурентный ИФА анализ блокирования взаимодействия IL17A лиганда и IL17R рецептора

Конкурентный ИФА (ELISA) был использован для проверки антагонистической способности отобранных ранее специфичных Fab против IL-17A-Fc человека. В качестве позитивного контроля антагониста использовали Fab с опубликованной последовательностью AIN457 (от Novartis). Рецептор IL-17RA-Fc (от R&D Systems) иммобилизовали в лунки планшетов ELISA (от Nunc Immuno Maxisorp) по 50 мкл с концентрацией 1 мкг/мл в IX покрывающем карбонатном буфере и инкубировали в течение ночи при 4°C. Все последующие этапы проводили по стандартным ИФА протоколам с использованием высокопроизводительной автоматизированной платформы на базе роботизированных систем GenetixQ-pix2×t (от Molecular Device) и Tecan FreedomEVO 200 (от Tecan). Для блокирования неспецифического связывания добавляли блокирующий буфер ВВ (200 мкл 0,5% нежирного молока в ФСБ). Планшеты инкубировали на шейкере в течение часа при комнатной температуре.

Параллельно 50 мкл тестируемого клеточного супернатанта, содержащего исследуемый Fab, смешивали в несвязывающем 96-луночном планшете с 50 мкл IL-17A-His6-Flag с концентрацией 0,4 мкг/мл в 1% молоке на ФСБ-Твин. Инкубировали 1 час при 37°C и шейкинге при 500 об/мин.

После отмывок от ВВ планшета, содержащего IL-17RA-Fc рецептор, туда переносили описанную выше реакционную смесь Fab и IL-17A-His6-Flag лиганда в расчете 90 мкл на лунку. Планшеты снова инкубировали, встряхивая, 45 мин при комнатной температуре, после чего каждую лунку планшетов пять раз промывали буфером ФСБ-Твин. Добавляли 50 мкл/лунку анти-FLAG мышиного М2 антитела (от Sigma) при концентрации 1 мкг/мл. Инкубировали 45 мин при комнатной температуре, после чего каждую лунку планшетов пять раз промывали буфером ФСБ-Твин. Добавляли 50 мкл/лунку антимышиного-IgG HRP-конъюгированного вторичного антитела (от Pierce-ThermoScientific) в разведении 1:5000 в ФСБ-Твин. Планшеты встряхивали на ротационном шейкере 45 мин при комнатной температуре и промывали пять раз буфером ФСБ-Твин, как описано выше. Колориметрический сигнал развивали добавлением ТМВ (100 мкл/лунку) до насыщения (в среднем 3-5 мин), затем дальнейшее развитие останавливали добавлением стопового раствора (100 мкл/лунку, 10% серная кислота). Цветовой сигнал измеряли при длине волны 450 нм, используя подходящий планшет-ридер Tecan-Sunrise (от Tecan). Степень связывания антитела была пропорциональна продуцированию цветового сигнала.

Для примера приведены результаты ИФА скрининга с одного планшета Fab-ламы, после второго раунда селекции (Рис.9). Можно видеть ряд позитивных клонов, давших сигнал блокирования соизмеримый (значения в интервале 0,05-0,1 отн. ед) с контрольным Fab (AIN457) (отмеченный красным) или не блокирующих взаимодействие IL-17A/IL-17R с сигналом на уровне контролей прямого взаимодействия лиганда и рецептора (отмечен темно-синим).

Пример 7

Сравнительный скрининг анти-IL-17А Fab кандидатов человека по koff

Koff представляет собой скрининг анти-IL-17А Fab-кандидатов. Koff - скрининг производился с использованием прибора Pall Forte Bio Octet Red 96. Анти FABCH1 биосенсоры в течение 30 минут регидратировались в рабочем буфере, содержащем 10 мМ ФСБ, pH 7.2-7.4, 0.1% Твин-20, 0,1% БСА. В исследуемые образцы супернатантов Е coli добавляли 10х-рабочий буфер до конечной концентрации 1х. Затем анти FABCH1 биосенсоры погружались в супернатанты Е. coli, содержащие Fab-фрагменты кандидатов антител, на 12 часов при 4°C. Сенсоры с иммобилизованными на поверхности Fab-фрагментами переносились в лунки с рабочим буфером, где прописывалась базовая линия (60 с.). Далее сенсоры переносились в лунки с раствором аналита (IL-17A, 30 мкг/мл) для ассоциации комплекса антиген-антитело (300 с.). Затем сенсоры возвращали в лунки, содержащие рабочий буфер, для последующей стадии диссоциации (300 с.). После каждого эксперимента использованные сенсоры регенерировались путем трехкратного помещения их в буфер для регенерации (Gly-HCl, pH 1,7) после чего могли быть использованы в следующем эксперименте. Анализ полученных кривых проводился с помощью программного обеспечения Octet Data Analysis (версия 7.0) согласно стандартной процедуре с использованием модели взаимодействия 1:1.

Результаты koff-скрининга анти-IL-17А Fab кандидатов человека представлены на Рис.10.

Пример 8

Сканирующий мутагенез CDR вариабельных доменов и выбор более высокоаффинного кандидата

Для введения мутаций в индивидуальные позиции CDR-участков кандидата была использована методика NNK кодоновой рандомизации [Appl Environ Microbiol. 2006 Feb; 72(2):1141-7; MAbs.2012 May-Jun; 4(3):341-8] с помощью Q5® Site-Directed Mutagenesis Kit (от NEB) согласно протоколу, в качестве матрицы используя плазмиду A1-Fab-pLL. Продукты ПЦР после фракционировали на легкоплавкой агарозе и очищали на колонках. После реакции лигирования ДНК трансформировали в E.coli экспрессирующий штамм BL21gold (от Stratagene). Полученные индивидуальные клоны наращивали в условиях Fab-экспрессии в 96 луночных планшетах, как описано ранее. Супернатанты, содержащие мутантные Fab, анализировали в условиях ИФА, описанных ранее, с использованием высокопроизводительной автоматизированной платформы на базе роботизированных систем Genetix Q-pix2×t и Tecan Freedom EVO200. Концентрация иммобилизованного IL-17A составляла 0,2 мкг/мл. Окрашивание связанных Fab проводили с разведенным 1:5000 конъюгатом Goat anti-Human IgG (Fab′)2 (HRP) (от Pierce) и краской ТМБ+H2O2/ H2SO4 с последующим измерением оптической плотности при длине волны 450 нм.

Результаты сканирующего мутагенеза (состав положительных мутантов, позиции соответствуют позициям антитела BCD085, указанным в формуле изобретения):

а) в вариабельном домене тяжелой цепи: N31D, N31K, N31L, N31P, N31T, Y32F, A33G, A33N, A33S, А33Т, A33V, M34I, S35G, S35N, S35T, R50G, R50I, R50L, R50M, R50S, D52E, G52aM, G52bL, G52bR, G52bV, I53L, S55T, S55L, S55R, S55W, S56T, S56S, S56Y, T57S, T57L, T57R, T57W, Y58T, Y58L, Y58K, V94R, V94A, V94I, N95E, N95L, N95S, N95T, N95V, Y97F, Y97V, G98S, М99А, M99F, M99L, М99Р, M99Y, Y100F, Y100H, Y100I, Y100S, Y100W, Y100aA, Y10aI, Y100aN, Y100aR, Y100aS, Y100aV,

б) в вариабельном домене легкой цепи: E28N, E28R, D29S, V30L, V30R, G31V, F32Y, F32L, F32S, F32T, F32V, G33L, G33V, N34S, N34P, N34R, Y35W, Y35A, Y35L, R50E, R50L, V51S, V51L, N52G, T53I, Т53К, T53L, T53R, T53W, A89S, S90G, S90T, Y91F, Y91A, Y91I, R92K, A93S, G94F, G95H, Y95bI, Y95bL, Y95bW,

Эти мутации соответствуют не более чем на 30% уменьшению сигнала связывания мутантных Fab с IL-17A человека в сравнении с "дикой" последовательностью.

Таким образом, проведен скрининг аминокислотных позиций CDR регионов антител BCD085 толерантных к заменам на другие аминокислоты. В результате обнаружено, что данный набор аминокислотных замен значительно не меняют силы связывания антитела с IL-17Ачеловека. Набор таких позиций может быть использован для оптимизации различных свойств кандидата.

Пример 9

Создание стабильной клеточной линии, продукция и очистка антитела

Стабильная клеточная линия продуцент моноклонального антитела BCD085 была получена путем трансфекции родительской суспензионной клеточной линии CHO-S векторными конструкциями, содержащими легкие и тяжелые цепи антитела в оптимизированном соотношении. Клональные линии с высоким уровнем (более 100 мг/л) были получены с использованием роботизированной платформы ClonePix (Molecular Devices). Анализ продуктивности отобранных клонов проводился на базе автоматизированной системы Biomek FX robotics (Beckman Coulter) и аналитической системы Octet RED96 (Pall Life Sciences). Для культивирования продуцента использовали бессывороточные среды, не содержащие белков животного происхождения. Наработку препарата BCD085 для предклинических исследований проводили в ферментере HyClone single-use bioreactor (Thermoscientific) рабочим объемом 200 л.

Фильтрацию культуральной жидкости проводили через глубинный фильтр "Zeta Plus Maximizer 4516701 60М02" с помощью перистальтического насоса. Первичную очистку антитела проводили на аффинном сорбенте с белком A MabSelect (от GE Healthcare Life Sciences). Осветленную глубинной фильтрацией культуральную жидкость наносили на сорбент, уравновешенный буфером, содержащем 50 мМ HCl-Трис (pH 7.5) и 150 мМ NaCl. После нанесения сорбент промывали буфером уравновешивания с последующей промывкой HCl-Трис с низкой кондуктивностью. Элюировали белок буфером Gly-HCl (pH 3.5). Полученный элюат выдерживали в кислом pH в течение 30 минут для вирусной инактивации, а затем нейтрализовали 1М раствором Трис-осн. до значения pH 6.8. Белковый раствор после доведения pH фильтровали при помощи фильтрующих систем STERICUP с мембраной MilliporeExpressPlus® (от PVDF) с диаметром пор 0,22 мкм. Для финальной очистки от ДНК, белков продуцента, а также отщепленного лиганда аффинного сорбента, полученный раствор белка пропускали через подготовленный сорбент Q Sepharose FF (от GE HealthCare), pH 7.0, при низком значении кондуктивности (<2 мС/см2). Очищенный белок подвергали противовирусной фильтрации с использованием фильтра для вирусной фильтрации «UltiporeVF filter» (от PALL), концентрированию и диафильтрации против конечного буфера, содержащего His/HisHCl (pH 6.0-6.5), Твин-80 и трегалозу. Концентрация полученного белка составляла 50 мг/мл и более. Результат очистки полученного раствора белка оценили с помощью SDS-гель-электрофореза (Рис.11).

Кроме того оценивали агрегационный состав препарата ВЭЖХ гель фильтрацией.

Хроматографию проводили на системе ВЭЖХ Agilent 1100 на колонке Tosoh TSK-Gel G3000SWXL 7.8 мм × 30 см, кат.№08541 с предколонкой Tosoh TSKgel Guard SWXL 6.0 мм × 4.0 см, с диаметром частиц 7 мкм, кат.№08543. Элюирование проводилось в изократическом режиме подвижной фазой: 50 мМ NaФб, 0,3 М NaCl, pH 7.0, на скорости потока 0,5 мл/мин. Детектирование проводилось на длинах волн 214 и 280 нм. Образцы антител были разведены буфером ФСБ, pH 7.5, до концентрации ~1 мг/мл. Объем вводимой пробы - 10 мкл. Предварительно была хроматографирована калибровочная смесь Gel filtration standard (от Bio-Rad), кат.№151-1901.

Результаты гельфильтрационного анализа приведены на рис.13. Содержание агрегатов в субстанции BCD085 составило 0,312%.

Пример 10

Клеточный тест блокирования функции IL-17A индуцировать продукцию IL-6

Способность IL-17 индуцировать производство IL-6 человеческими клетками линии НТ1080 (АТСС:CCL-121) использовали для анализа нейтрализующей активности BCD085 в отношении человеческого рекомбинантного IL-17. Клетки выращивали в питательной среде ДМЕМ с добавлением 10% инактивированной эмбриональной сыворотки, гентамицином и глутамином. По 5*104 клеток на лунку высевали в 96-луночные плоскодонные планшеты для культуры клеток. Оставляли клетки прикрепиться в течение 5 часов. Смесь рекомбинантного 40 нг/мл IL-17 и 20 нг/мл ФНО-α инкубировали с разведениями антитела BCD085 в течение часа при 37°C. Затем смесь цитокина и антитела добавляли к клеткам и оставляли на ночь. Производство IL-6 в культуре клеток НТ1080 было пропорционально добавленному количеству IL-17. Количество высвобожденного EL-6 в клеточных супернатантах определяли методом ELISA с помощью системы «DuoSet ELISA developmentsysternhuman IL6» (от RD System, Cat. №DY206). Результаты анализа антагонистических свойств кандидата BCD085 приведены на рис.13 в сравнении с AIN457 (анти-IL-17А антитело от Novartis). Средняя величина IC50 для этого кандидата про серии опытов составляет 40±15 пМ.

Пример 11

Определение аффинности BCD085 к IL-17A из различных видов организмов

Анализ аффинности связывания BCD085 к IL-17A человека, макаки и крысы производился на приборе OctetRed 96 (от ForteBio). BCD085 был неспецифически иммобилизован на поверхность аминореактивных сенсоров второго поколения (от AR2G) по стандартному протоколу согласно инструкции производителя, для подготовки и иммобилизации AR2G сенсоров. Анализ был произведен при 30°C с использованием ФСБ, содержащим 0,1% Твин-20 и 0,1% БСА в качестве рабочего буфера.

Титрование IL-17A человека, макаки и крысы производили с использованием рабочего буфера от концентрации 126 нМ до 2 нМ с шагом 2.

Кривые связывания с вычетом референсного сигнала анализировали с помощью программного обеспечения Octet Data Analysis (версия 7.0) согласно стандартной процедуре с использованием модели взаимодействия 1:1. Результаты приведены на Рис.14А и 14B.

BCD085 связывается с рекомбинантным препаратом IL-17A человека с пикомолярной аффинностью, что в тысячу раз сильнее по сравнению с аффинностью к IL-17A макаки, имеющую наномолярную величину. Кроме того, кандидат не взаимодействует с IL-17A крысы (кривые не приведены).

Пример 12

Определение агрегационной стабильности BCD085 в условиях термостресса

Препарат антитела BCD085 с концентрацией 9 мг/мл в ФСБ буфере прогревался в течении 6 часов при температуре 50°C. Определение агрегации после термостресса проводили методом гель-фильтрационной высокоэффективной хроматографии. Хроматографию проводили на системе ВЭЖХ (Agilent) 1100 на колонке Tosoh TSK-Gel G3000SWXL, 7.8 мм × 30 см, кат. №08541 с предколонкой Tosoh TSKgel Guard SWXL, 6.0 мм × 4.0 см, с диаметром частиц 7 мкм, кат. №08543. Элюирование проводилось в изократическом режиме подвижной фазой: 50 мМ NаФб, 0,3 М NaCl, pH 7.0 на скорости потока 0,5 мл/мин. Детектирование проводилось на длинах волн 214 и 280 нм. Образцы антител были разведены буфером ФСБ, pH 7.5, до концентрации ~1 мг/мл. Объем вводимой пробы - 10 мкл. Предварительно была хроматографирована калибровочная смесь Gel filtration standard (от Bio-Rad), кат. №151-1901.

Представленные на Рис.15 результаты показывают, что антитело BCD085 стабильно в условиях термостресса, где образование агрегатов составило менее 5%.

Пример 13

Исследование фармакокинетики моноклонального антитела BCD085 против IL-17A при однократном подкожном введении обезьянам

Моноклональное антитело BCD085 против IL-17A вводили однократно подкожно обезьянам макакам резус (Масаса mulatta) в дозе 40 мг/кг. Через определенные промежутки времени после введения (через 0,5, 1, 3, 6, 12, 24, 36, 48, 60, 72, 96, 120, 168, 264, 336, 432, 504, 672, 840 и 1008 часов) у животных отбирали кровь и получали сыворотку стандартным методом. Уровень антитела BCD085 в сыворотке крови оценивался с помощью метода твердофазного иммуноферментного анализа (ИФА), на иммобилизованном IL-17A человека (от R&D Systems), где связанное антитело детектировалось с использованием поликлональных антител козы против Fc-фрагмента IgG антител человека (от Pierce-ThermoScientific).

Результаты определения концентрации моноклонального антитела против IL-17A в сыворотках после однократного подкожного введения обезьянам представлены на Рис.16. Из результатов следует, что BCD085 обладает значительным пролонгированным эффектом или длительным временем циркуляции в крови. При однократном подкожном введении препарата, максимальное содержание моноклонального антитела против IL-17A в крови животных наблюдалось через 72-168 часов и этот уровень сохранялся в течение 400 часов и только затем происходило очень медленное снижение, так, что даже после 1000 часов концентрация BCD085 была значительно выше контрольного уровня. Расчетные фармакокинетические параметры для BCD085 при однократном подкожном введении обезьянам приведены в Табл.1. Из представленных результатов видно, что величина клиренса (Cl) заявляемого моноклонального антитела против IL-17A составляла 0.25±0.08 мл/час/кг, что обеспечивало его длительную циркуляцию в крови (более 42 дней). Время пребывания в организме и период полувыведения моноклонального антитела против IL-17A составляли в среднем 946±374 час и 632±253 час, соответственно.

Пример 14

Получение фармацевтической композиции, содержащей антитела согласно изобретению

Концентрация антитела к IL-17 (BCD085) 10-50 мг/мл
Буфер цитратный 10 мМ до pH 6,0-7,0
Хлорид натрия 50-150 мМ
Сахароза, трегалоза 0,3-0,5%
Вода для инъекций до 1 мл.

Пример 15

Набор, содержащий фармацевтическую композицию с антителами

Для выпуска наборов с лекарственной формой, содержащей композицию с антителами против IL-17, фармацевтическую композицию, полученную согласно примеру 14 запаивают в ампулы или шприцы объемом 1 мл в стерильных условиях, маркируют и упаковывают в контейнеры из пластикового или картонного материала.

Также в контейнер с ампулой вкладывают инструкцию по применению.

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

При указании аминокислот использована общепринятая система буквенного обозначения кислот. При указании ряда возможных аминокислотных замен подразумевается, что выбирается одна из аминокислот, указанных в ряду возможных замен.

1. Выделенное моноклональное антитело или его антигенсвязывающий фрагмент, обладающие способностью специфически связываться с IL-17A человека, характеризующиеся тем, что:
а) вариабельный домен их тяжелой цепи (VH) содержит 3 гипервариабельных участка HCDR1, HCDR2 и HCDR3, в которых:
HCDR1 включает аминокислотную последовательность (согласно номенклатуре Kabat) FTFS-X31-X32-X33-X34-X35, где Х31, Х32, Х33, Х34 и Х35 представляют собой аминокислоту N, Y, А, М, S соответственно;
HCDR2 включает аминокислотную последовательность X50-I-X52-X52a-X52b-X53-X55-Х56-Х57-Х58, где Х52, Х52а, X52b, Х53, Х55, Х56, Х57 и Х58 представляют собой аминокислоту R, D, G, G, I, S, S, Т и Y соответственно;
HCDR3 включает аминокислотную последовательность CA-X94-X95-Y-X97-X98-X99-Х100-Х100а, где Х94, Х95, Х97, Х98, Х99, X100 и X100a представляют собой аминокислоту V, N, Y, G, М, Y и Y соответственно;
б) вариабельный домен их легкой цепи (VL) содержит 3 гипервариабельных участка LCDR1, LCDR2 и LCDR3, в которых:
LCDR1 включает аминокислотную последовательность TGTS-X28-X29-X30-X31-X32-Х33-Х34-Х35, где Х28, Х29, Х30, Х31, Х32, Х33, Х34 и Х35 представляют собой Е, D, V, G, F, G, N и Y соответственно;
LCDR2 включает аминокислотную последовательность X50-X51-X52-X53-R-P-S, где Х50, Х51, Х52 и Х53 представляют собой аминокислоту R, V, N и Т соответственно;
LCDR3 включает аминокислотную последовательность С-Х89-Х90-Х91-Х92-Х93-Х94-Х95-Х95а-X95b, где Х89, Х90, Х91, Х92, Х93, Х94, Х95, Х95а и Х95 представляют собой аминокислоту A, S, Y, R, A, G, G, Т и Y соответственно;
при этом они необязательно содержат мутации в упомянутых гипервариабельных участках HCDR1, HCDR2 и/или HCDR3 вариабельного домена тяжелой цепи, выбранные из группы, включающей: N31D, N31K, N31L, N31P, N31T, Y32F, A33G, A33N, A33S, А33Т, A33V, M34I, S35G, S35N, S35T, R50G, R50I, R50L, R50M, R50S, D52E, G52aM, G52bL, G52bR, G52bV, I53L, S55T, S55L, S55R, S55W, S56T, S56S, S56Y, T57S, T57L, T57R, T57W, Y58T, Y58L, Y58K, V94R, V94A, V94I, N95E, N95L, N95S, N95T, N95V, Y97F, Y97V, G98S, M99A, M99F, M99L, M99P, M99Y, Y100F, Y100H, Y100I, Y100S, Y100W, Y100aA, Y100aI, Y100aN, Y100aR, Y100aS и/или Y100aV,
и необязательно содержат мутации в упомянутых гипервариабельных участках LCDR1, LCDR2 и/или LCDR3 вариабельного домена легкой цепи, выбранные из группы, включающей: E28N, E28R, D29S, V30L, V30R, G31V, F32Y, F32L, F32S, F32T, F32V, G33L, G33V, N34S, N34P, N34R, Y35W, Y35A, Y35L, R50E, R50L, V51S, V51L, N52G, T53I, Т53К, T53L, T53R, T53W, A89S, S90G, S90T, Y91F, Y91A, Y91I, R92K, A93S, G94F, G95H, Y95bI, Y95bL и/или Y95bW.

2. Фрагмент антитела по п.1, характеризующийся тем, что он выбран из группы, включающей F(ab′)2, F(ab)2, Fab′, Fab.

3. Фрагмент антитела по п.1, характеризующийся тем, что он выбран из группы, включающей Fv и scFv.

4. Антитело или его фрагмент п.1 , характеризующиеся тем, что они представляют собой гуманизированное антитело или антитело человека или их фрагменты.

5. Антитело по п.1, характеризующееся тем, что оно представляет собой IgG1, или IgG2, или IgG3, или IgG4, или IgA, или IgD, или IgY.

6. Антитело по п.1, характеризующееся тем, что оно имеет аффинность связывания с IL-17A человека с KD не более 10-10 М.

7. Антитело по п.1, характеризующееся тем, что кинетическая константа его ассоциации kon(1/Ms) для IL-17A человека составляет не менее 105 1/Мс.

8. Антитело по п.1, характеризующееся тем, что кинетическая константа его диссоциации dis(1/s) для IL-17A человека составляет не более 10-5 1/с.

9. Антитело по п.1, характеризующееся тем, что оно способно ингибировать не менее чем на 50% активность IL-17A человека.

10. Антитело по п.1, характеризующееся тем, что его продуцируют в клетках млекопитающих, дрожжевых или бактериальных клетках.

11. Фрагмент антитела по п.1, характеризующийся тем, что он представляет собой Fab и получен посредством продукции в клетках млекопитающих, дрожжевых или бактериальных клетках.

12. Фрагмент антитела по п.1, характеризующийся тем, что он представляет собой Fab′ и получен посредством продукции в клетках млекопитающих, дрожжевых или бактериальных клетках.

13. Фрагмент антитела по п.1, характеризующийся тем, что он представляет собой Fv (вариабельный фрагмент) и получен посредством продукции в клетках млекопитающих, дрожжевых или бактериальных клетках.

14. Фрагмент антитела по п.1, характеризующийся тем, что он представляет собой F(ab′)2 и получен посредством продукции в клетках млекопитающих, дрожжевых или бактериальных клетках.

15. Фрагмент антитела по п.1, характеризующийся тем, что он представляет собой F(ab)2 и получен посредством продукции в клетках млекопитающих, дрожжевых или бактериальных клетках.

16. Фрагмент антитела по п.1, характеризующийся тем, что он представляет собой scFv (одноцепочечный Fv-фрагмент) и получен посредством продукции в клетках млекопитающих, дрожжевых или бактериальных клетках.

17. ДНК, кодирующая антитело или его активный фрагмент по любому из пп.1-16.

18. Экспрессионный вектор для получения антитела или его активного фрагмента по любому из пп.1-16, содержащий ДНК по п.17.

19. Клеточная линия, содержащая в клетках вектор по п.18 и способная продуцировать антитела или их фрагменты по любому из пп.1-16.

20. Способ получения моноклонального антитела или его активного фрагмента по любому из пп.1-16, заключающийся в культивировании клеток клеточной линии по п.19 в культуральной среде в условиях, достаточных для получения указанного антитела или его фрагмента, с последующим выделением и очисткой полученного антитела или его активного фрагмента.

21. Фармацевтическая композиция для лечения опосредуемого IL-17A заболевания или нарушения, содержащая в эффективном количестве антитело по п.1, в сочетании с одним или несколькими фармацевтически приемлемыми эксципиентами, разбавителями или носителями, где указанное антитело содержит:
а) вариабельный домен тяжелой цепи (VH) антитела, который содержит 3 гипервариабельных участка HCDR1, HCDR2 и HCDR3, где
HCDR1 включает аминокислотную последовательность, представленную SEQ ID NO: 1: FTFSNYAMS;
HCDR2 включает аминокислотную последовательность SEQ ID NO: 2: RIEGGIGSSTYAVDSVKD;
HCDR3 включает аминокислотную последовательность SEQ ID NO: 3: CAVNYYGMYY;
б) вариабельный домен легкой цепи (VL) антитела, который содержит 3 гипервариабельных участка LCDR1, LCDR2 и LCDR3, где
LCDR1 включает аминокислотную последовательность представленную SEQ ID NO: 4: TGTSEDVGFGNYVS;
LCDR2 включает аминокислотную последовательность SEQ ID NO: 5: RVNTRPS;
LCDR3 включает аминокислотную последовательность SEQ ID NO: 6: CSSYKAGGTY.

22. Композиция по п.21, характеризующаяся тем, что она дополнительно содержит действующие вещества, выбранные из блокаторов ФНО-α или других антител к IL-17A.

23. Композиция по п.21, характеризующаяся тем, что она предназначена для лечения опосредуемого IL-17A заболевания или нарушения.

24. Композиция по п.23, характеризующаяся тем, что упомянутое опосредуемое IL-17А заболевание или нарушение выбрано из ревматоидного артрита, остеоартрита, ювенильного хронического артрита, септического артрита, артрита Лайма, псориатического артрита, реактивного артрита, спондилоартропатии, системной красной волчанки, болезни Крона, язвенного колита, воспалительного заболевания кишечника, инсулинзависимого сахарного диабета, тиреоидита, астмы, аллергических заболеваний, псориаза, дерматита, склеродермии, реакции "трансплантат против хозяина", отторжения трансплантата органа, острого или хронического иммунного заболевания, связанного с трансплантацией органа, саркоидоза, атеросклероза, диссеминированного внутрисосудистого свертывания, болезни Кавасаки, болезни Грэйвса, нефротического синдрома, синдрома хронической усталости, гранулематоза Вегенера, пурпуры Шенлейна-Геноха, микроскопического васкулита почек, хронического активного гепатита, увеита, септического шока, синдрома токсического шока, септического синдрома, кахексии, инфекционных заболеваний, паразитарных заболеваний, синдрома приобретенного иммунодефицита, острого поперечного миелита, хореи Гентингтона, болезни Паркинсона, болезни Альцгеймера, инсульта, первичного билиарного цирроза, гемолитической анемии, злокачественных опухолей, сердечной недостаточности, инфаркта миокарда, болезни Аддисона, спорадического полигландулярного дефицита типа I и полигландулярного дефицита типа II, синдрома Шмидта, взрослого (острого) респираторного дистресс-синдрома, алопеции, очаговой алопеции, серонегативной артропатии, артропатии, болезни Рейтера, псориатической артропатии, связанной с язвенным колитом артропатии, энтеропатического синовита, связанной с хламидиями, иерсиниями и сальмонеллами артропатии, спондилоартропатии, атероматозного заболевания/артериосклероза, атопической аллергии, аутоиммунного буллезного заболевания, пемфигуса обыкновенного, листовидного пемфигуса, пемфигоида, болезни линейных IgA, аутоиммунной гемолитической анемии, Кумбс-положительной гемолитической анемии, приобретенной перниционзой анемии, ювенильной перниционзой анемии, миалгического энцефалита/синдрома хронической усталости, хронического кожно-слизистого кандидоза, гигантоклеточного артериита, первичного склерозирующего гепатита, криптогенного аутоиммунного гепатита, синдрома приобретенного иммунодефицита, связанных с приобретенным иммунодефицитом заболеваний, гепатита В, гепатита С, вариабельного неклассифицируемого иммунодефицита (вариабельной неклассифицируемой гипогаммаглобулинемии), кардиомиопатии с дилятацией, женского бесплодия, недостаточности яичников, преждевременного угасания функции яичников, фиброзного заболевания легких, криптогенного фиброзного альвеолита, поствоспалительного интерстициального заболевания легких, интерстициального пневмонита, связанного с болезнью соединительной ткани интерстициального заболевания легких, связанного со смешанной болезнью соединительной ткани заболевания легких, связанного с системной склеродермией заболевания легких, связанного с ревматоидным артритом интерстициального заболевания легких, связанного с системной красной волчанкой заболевания легких, связанного с дерматомиозитом/полимиозитом заболевания легких, связанного с болезнью Шегрена заболевания легких, связанного с анкилозирующим спондилитом заболевания легких, васкулитного диффузного заболевания легких, связанного с гемосидерозом заболевания легких, индуцированного лекарственным средством интерстициального заболевания легких, фиброза, связанного с радиацией фиброза, облитерирующего бронхиолита, хронической эозинофильной пневмонии, заболевания легких с инфильтрацией лимфоцитов, постинфекционного интерстициального заболевания легких, подагрического артрита, аутоиммунного гепатита, аутоиммунного гепатита I типа (классического аутоиммунного или люпоидного гепатита), аутоиммунного гепатита II типа (гепатита, связанного с антителом против LKM), опосредуемой аутоиммунным заболеванием гипогликемии, устойчивости к инсулину типа В с акантокератодермией, гипопаратиреоза, острого иммунного заболевания, связанного с трансплантацией органа, хронического иммунного заболевания, связанного с трансплантацией органа, остеоартроза, первичного склерозирующего холангита, псориаза I типа, псориаза II типа, идиопатической лейкопении, аутоиммунной нейтропении, NOS-болезни почек, гломерулонефрита, микроскопического васкулита почек, болезни Лайма, дискоидной красной волчанки, идиопатического или NOS-мужского бесплодия, аутоиммунитета к сперматозоидам, рассеянного склероза (все подтипы), симпатической офтальмии, легочной гипертензии, вторичной для болезни соединительной ткани, синдрома Гудпасчера, легочного проявления узелкового полиартериита, острой ревматической атаки, ревматоидного спондилита, болезни Стилла, системной склеродермии, синдрома Шенгрена, болезни/артериита Такаясу, аутоиммунной тромбоцитопении, идиопатической тромбоцитопении, аутоиммунного заболевания щитовидной железы, гипертиреоидизма, зобного аутоиммунного гипотиреоза (болезнь Хашимото), атрофического аутоиммунного гипотиреоза, первичной микседемы, факогенного увеита, первичного васкулита, витилиго, острого заболевания печени, хронического заболевания печени, алкогольного цирроза, индуцированного алкоголем повреждения печени, холестаза, идиосинкразического заболевания печени, индуцированного лекарственным средством гепатита, неалкогольного стеатогепатита, аллергии и астмы, стрептококковой инфекции группы В (GBS), психических расстройств (включая депрессию и шизофрению), опосредуемых типом Th2 и типом Th1 заболеваний, острой и хронической боли (различные формы боли) и злокачественных опухолей, таких как рак легкого, молочной железы, желудка, мочевого пузыря, толстого кишечника, поджелудочной железы, яичника, предстательной железы и прямой кишки и гемопоэтические злокачественные опухоли (лейкоз и лимфома), абеталипопротеинемии, акроцианоза, острых и хронических паразитарных и инфекционных процессов, острого лейкоза, острого лимфобластного лейкоза, острого миелоидного лейкоза, острой или хронической бактериальной инфекции, острого панкреатита, острой почечной недостаточности, аденокарцином, эктопической систолы предсердий, СПИД-дементного комплекса, индуцированного алкоголем гепатита, аллергического конъюнктивита, аллергического контактного дерматита, аллергического ринита, отторжения аллотрансплантата, дефицита альфа-1-антитрипсина, бокового амиотрофическего склероза, анемии, стенокардии, дегенерации клеток передних рогов спинного мозга, терапию против CD3, антифосфолипидного синдрома, реакций гиперчувствительности против рецепторов, аортальных и периферических аневризм, расслоения аорты, артериальной гипертензии, артериосклероза, артериовенозного свища, атаксии, фибрилляции предсердий (постоянной или пароксизмальной), трепетания предсердий, атриовентрикулярной блокады, В-клеточной лимфомы, отторжения трансплантата кости, отторжения трансплантата костного мозга (ВМТ), блокады пучка Гиса, лимфомы Беркитта, ожогов, аритмий сердца, синдрома оглушения сердца, опухолей сердца, кардиомиопатии, воспалительных ответов на искусственное кровообращение, отторжения трансплантата хряща, дегенерации коры головного мозга, нарушений мозжечка, хаотической или многоочаговой тахикардии предсердий, связанных с химиотерапией нарушений, хронического миелоцитарного лейкоза (CML), хронического алкоголизма, хронических воспалительных патологий, хронического лимфоцитарного лейкоза (ХЛЛ), хронического обструктивного заболевания легких (ХОЗЛ), хронической интоксикации салицилатами, карциномы ободочной и прямой кишки, застойной сердечной недостаточности, конъюнктивита, контактного дерматита, легочного сердца, болезни коронарных артерий, болезни Крейтцфельда-Якоба, культурально-негативного сепсиса, кистозного фиброза, связанных с цитокиновой терапией нарушений, деменции боксеров, демиелинизирующих заболеваний, геморрагической лихорадки денге, дерматита, дерматологических состояний, диабета, сахарного диабета, диабетического атеросклеротического заболевания, диффузного заболевания с тельцами Леви, застойной кардиомиопатии с дилятацией, нарушений базальных ганглиев, синдрома Дауна в среднем возрасте, двигательных нарушений, индуцированных лекарственным средством, которое блокирует дофаминовые рецепторы ЦНС, чувствительности к лекарственным средствам, экземы, энцефаломиелита, эндокардита, эндокринопатии, эпиглоттита, инфекции вирусом Эпштейна-Барр, эритромелалгии, экстрапирамидных и мозжечковых нарушений, семейного гематофагоцитарного лимфогистиоцитоза, отторжения имплантата эмбрионального тимуса, наследственной атаксии Фридрейха, функциональных нарушений периферических артерий, грибкового сепсиса, газовой гангрены, язвы желудка, гломерулонефрита, отторжения трансплантата любого органа или ткани, грамотрицательного сепсиса, грамположительного сепсиса, гранулем вследствие внутриклеточных организмов, волосатоклеточного лейкоза, болезни Галлервордена-Шпатца, тиреоидита Хашимото, сенной лихорадки, отторжения трансплантата сердца, гемахроматоза, гемодиализа, гемолитическоого уремического синдрома/тромболитической тромбоцитопенической пурпуры, кровопотери, гепатита (А), аритмий пучка Гиса, ВИЧ-инфекции/ВИЧ-невропатии, болезни Ходжкина, гиперкинетических двигательных нарушений, реакций гиперчувствительности, связанного с гиперчувствительностью пневмонита, гипертензии, гипокинетических двигательных нарушений, обследования гипоталамо-гипофизарно-надпочечниковой системы, идиопатической болезни Аддисона, идиопатическоого фиброза легких, опосредуемой антителами цитотоксичности, астении, младенческой спинальной мышечной атрофии, воспаления аорты, вируса гриппа А, облучения ионизирующей радиацией, иридоциклита/увеита/оптического неврита, повреждения при ишемии-реперфузии, ишемического инсульта, ювенильного ревматоидного артрита, ювенильной спинальной мышечной атрофии, саркомы Капоши, отторжения трансплантата почки, легионеллеза, лейшманиоза, лепры, повреждений кортикоспинальной системы, жирового отека, отторжения трансплантата печени, лимфатического отека, малярии, злокачественной лимфомы, злокачественного гистиоцитоза, злокачественной меланомы, менингита, менингококкемии, метаболических/идиопатических заболеваний, мигрени, митохондриального полисистемного нарушения, смешанной болезни соединительной ткани, моноклональной гаммапатии, множественной миеломы, полисистемной дегенерации (Менцеля, Дежерина-Тома, Шая-Дрейджера и Мачадо-Джозефа), миастении, внутриклеточных Mycobacterium avium, Mycobacterium tuberculosis, миелодиспластического синдрома, инфаркта миокарда, ишемических нарушений миокарда, карциномы носоглотки, хронического заболевания легких новорожденных, нефрита, нефроза, нейродегенеративных заболеваний, нейрогенных мышечных атрофий I, нейтропенической лихорадки, неходжкинских лимфом, окклюзии брюшного отдела аорты и ее ветвей, окклюзионных нарушений артерий, терапии ОКТ3®, орхита/эпидидимита, орхита/возвратных процедур после вазэктомии, органомегалии, остеопороза, отторжения трансплантата поджелудочной железы, карциномы поджелудочной железы, паранеопластического синдрома/гиперкальцемии при злокачественной опухоли, отторжения трансплантата паращитовидной железы, воспалительного заболевания органов таза, круглогодичного ринита, заболевания перикарда, периферического артериосклеротического заболевания, периферических сосудистых нарушений, перитонита, пернициозной анемии, пневмонии Pneumocystis carinii, пневмонии, синдрома POEMS (полиневропатия, органомегалия, эндокринопатия, моноклональная гаммапатия и синдром кожных изменений), постперфузионного синдрома, синдрома после искусственного кровообращения, посткардиотомного синдрома после инфаркта миокарда, преэклампсии, прогрессирующего супрануклеарного паралича, первичной гипертензии легких, лучевой терапии, феномена и болезни Рейно, болезни Рейно, болезни Рефсума, регулярной тахикардии с узким комплексом QRS, вазоренальной гипертензии, реперфузионного повреждения, рестриктивной кардиомиопатии, сарком, склеродермии, сенильной хореи, сенильной деменции с тельцами Леви, серонегативных артропатий, шока, серповидно-клеточной анемии, отторжения аллотрансплантата кожи, синдрома кожных изменений, отторжения трансплантата тонкого кишечника, солидных опухолей, специфических аритмий, спинальной атаксии, спиномозжечковых дегенераций, стрептококкового миозита, структурных повреждений мозжечка, подострого склерозирующего панэнцефалита, обмороков, сифилиса сердечно-сосудистой системы, системной анафилаксии, синдрома системного воспалительного ответа, ювенильного ревматоидного артрита с системным началом, Т-клеточного или FAB ALL, телеангиэктазии, облитерирующего тромбоангита, тромбоцитопении, токсичности, трансплантации, травмы/кровопотери, реакций гиперчувствительности типа III, гиперчувствительности типа IV, нестабильной стенокардии, уремии, уросепсиса, крапивницы, заболеваний клапанов сердца, варикоза вен, васкулита, заболеваний вен, венозного тромбоза, фибрилляции желудочков, вирусных и грибковых инфекций, энцефалита с высоким риском смертельного исхода/асептического менингита, гемофагоцитарного синдрома с высоким риском смертельного исхода, синдрома Вернике-Корсакова, болезни Вилсона, отторжения ксенотрансплантата любого органа или ткани, острого коронарного синдрома, острого идиопатического полиневрита, острой воспалительной демиелинизирующей полирадикулоневропатии, острой ишемии, болезни Стилла взрослых, очаговой алопеции, анафилаксии, синдрома антифосфолипидных антител, апластической анемии, артериосклероза, атопической экземы, атопического дерматита, аутоиммунного дерматита, аутоиммунногонарушения, связанного со стрептококковой инфекцией, аутоиммунной энтеропатии, аутоиммунной потери слуха, аутоиммунного лимфопролиферативного синдрома, аутоиммунного миокардита, аутоиммунного преждевременного угасания функции яичников, блефарита, бронхоэктазов, буллезного пемфигоида, сердечно-сосудистого заболевания, катастрофического антифосфолипидного синдрома, глютеиновой болезни, шейного спондилеза, хронической ишемии, рубцового пемфигоида, клинически изолированного синдрома (cis) с риском рассеянного склероза, конъюнктивита, психиатрического нарушения с началом в детском возрасте, хронического обструктивного заболевания легких (ХОЗЛ), дакриоцистита, дерматомиозита, диабетической ретинопатии, сахарного диабета, грыжи межпозвоночного диска, пролапса межпозвоночного диска, индуцированной лекарственным средством иммунной гемолитической анемии, эндокардита, эндометриоза, эндофтальмита, эписклерита, полиформной эритемы, тяжелой полиформной эритемы, гестационного пемфигоида, синдрома Гийена-Барре, сенной лихорадки, синдрома Хьюза, идиопатической болезни Паркинсона, идиопатической интерстициальной пневмонии, опосредуемой IgE аллергии, иммунной гемолитической анемии, миозита с тельцами включения, инфекционного воспалительного заболевания глаз, воспалительного демиелинизирующего заболевания, воспалительного заболевания сердца, воспалительного заболевания почек, идиопатического пневмосклероза/ идиопатического легочного фиброза, ирита, кератита, сухого кератоконъюнктивита, болезни Куссмауля или болезни Куссмауля-Мейера, паралича Ландри, гистиоцитоза клеток Лангерганса, синдрома мраморной кожи, дегенерации желтого пятна, микроскопического полиангиита, болезни Бехтерева, нарушений двигательных нейронов, пемфигоида слизистых оболочек, полиорганной недостаточности, миастении, миелодиспластического синдрома, миокардита, нарушений корешков нервов, невропатии, не-А- не-В-гепатита, оптического неврита, остеолизиса, рака яичника, олигоартикулярного ювенильного ревматоидного артрита, окклюзионого заболевания периферических артерий, заболевания периферических сосудов, заболевания периферических артерий (PAD), флебита, узелкового полиартериита (или нодозного полиартериита), полихондрита, ревматической полимиалгии, полиоза, полиартикулярного ювенильного ревматоидного артрита, синдрома полиэндокринной недостаточности, полимиозита, ревматической полимиалгии (PMR), синдрома после искусственного кровообращения, первичного паркинсонизма, рака предстательной железы и прямой кишки и гемопоэтических злокачественных опухолей (лейкоз и лимфому), простатита, истинной эритроцитарной аплазии, первичной недостаточности надпочечников, рецидивирующего оптического нейромиелита, рестеноза, ревматической болезни сердца, SAPHO (синовит, акне, пустулез, гиперостоз и остеит), склеродермии, вторичного амилоидоза, шокового легкого, склерита, ишиаса, вторичной недостаточности надпочечников, связанного с кремнийорганическими соединениями заболевания соединительных тканей, дерматоза Снеддона-Уилкинсона, анкилозирующего спондилита, синдрома Стивенса-Джонсона, синдрома системного воспалительного ответа, височного артериита, токсоплазменного ретинита, токсического эпидермального некролиза, поперечного миелита, TRAPS (связанный с рецептором фактора некроза опухоли периодический синдром), аллергической реакции I типа, диабета типа II, крапивницы, обычной интерстициальной пневмонии (UIP), васкулита, весеннего конъюнктивита, вирусного ретинита, синдрома Фогта-Коянаги-Харада (синдром VKH), влажной дегенерации желтого пятна, заживления ран и связанной с иерсиниями и сальмонеллами артропатии.

25. Способ лечения опосредованного IL-17A заболевания или нарушения, включающий введение антитела по п.1 пациенту, нуждающемуся в таком лечении, в терапевтически эффективном количестве, где указанное антитело содержит:
а) вариабельный домен тяжелой цепи (VH) антитела, который содержит 3 гипервариабельных участка HCDR1, HCDR2 и HCDR3, где
HCDR1 включает аминокислотную последовательность, представленную SEQ ID NO: 1: FTFSNYAMS;
HCDR2 включает аминокислотную последовательность SEQ ID NO: 2: RIEGGIGSSTYAVDSVKD;
HCDR3 включает аминокислотную последовательность SEQ ID NO: 3: CAVNYYGMYY;
б) вариабельный домен легкой цепи (VL) антитела, который содержит 3 гипервариабельных участка LCDR1, LCDR2 и LCDR3, где
LCDR1 включает аминокислотную последовательность, представленную SEQ ID NO: 4: TGTSEDVGFGNYVS;
LCDR2 включает аминокислотную последовательность SEQ ID NO: 5: RVNTRPS;
LCDR3 включает аминокислотную последовательность SEQ ID NO: 6: CSSYKAGGTY.

26. Способ по п.25, характеризующийся тем, что указанное опосредованное IL-17 заболевание или нарушение выбирают из выбранного из ревматоидного артрита, остеоартрита, ювенильного хронического артрита, септического артрита, артрита Лайма, псориатического артрита, реактивного артрита, спондилоартропатии, системной красной волчанки, болезни Крона, язвенного колита, воспалительного заболевания кишечника, инсулинзависимого сахарного диабета, тиреоидита, астмы, аллергических заболеваний, псориаза, дерматита, склеродермии, реакции "трансплантат против хозяина", отторжения трансплантата органа, острого или хронического иммунного заболевания, связанного с трансплантацией органа, саркоидоза, атеросклероза, диссеминированного внутрисосудистого свертывания, болезни Кавасаки, болезни Грэйвса, нефротического синдрома, синдрома хронической усталости, гранулематоза Вегенера, пурпуры Шенлейна-Геноха, микроскопического васкулита почек, хронического активного гепатита, увеита, септического шока, синдрома токсического шока, септического синдрома, кахексии, инфекционных заболеваний, паразитарных заболеваний, синдрома приобретенного иммунодефицита, острого поперечного миелита, хореи Гентингтона, болезни Паркинсона, болезни Альцгеймера, инсульта, первичного билиарного цирроза, гемолитической анемии, злокачественных опухолей, сердечной недостаточности, инфаркта миокарда, болезни Аддисона, спорадического полигландулярного дефицита типа I и полигландулярного дефицита типа II, синдрома Шмидта, взрослого (острого) респираторного дистресс-синдрома, алопеции, очаговой алопеции, серонегативной артропатии, артропатии, болезни Рейтера, псориатической артропатии, связанной с язвенным колитом артропатии, энтеропатического синовита, связанной с хламидиями, иерсиниями и сальмонеллами артропатии, спондилоартропатии, атероматозного заболевания/артериосклероза, атопической аллергии, аутоиммунного буллезного заболевания, пемфигуса обыкновенного, листовидного пемфигуса, пемфигоида, болезни линейных IgA, аутоиммунной гемолитической анемии, Кумбс-положительной гемолитической анемии, приобретенной пернициозной анемии, ювенильной пернициозной анемии, миалгического энцефалита/синдрома хронической усталости, хронического кожно-слизистого кандидоза, гигантоклеточного артериита, первичного склерозирующего гепатита, криптогенного аутоиммунного гепатита, синдрома приобретенного иммунодефицита, связанных с приобретенным иммунодефицитом заболеваний, гепатита В, гепатита С, вариабельного неклассифицируемого иммунодефицита (вариабельной неклассифицируемой гипогаммаглобулинемии), кардиомиопатии с дилятацией, женского бесплодия, недостаточности яичников, преждевременного угасания функции яичников, фиброзного заболевания легких, криптогенного фиброзного альвеолита, поствоспалительного интерстициального заболевания легких, интерстициального пневмонита, связанного с болезнью соединительной ткани интерстициального заболевания легких, связанного со смешанной болезнью соединительной ткани заболевания легких, связанного с системной склеродермией заболевания легких, связанного с ревматоидным артритом интерстициального заболевания легких, связанного с системной красной волчанкой заболевания легких, связанного с дерматомиозитом/полимиозитом заболевания легких, связанного с болезнью Шегрена заболевания легких, связанного с анкилозирующим спондилитом заболевания легких, васкулитного диффузного заболевания легких, связанного с гемосидерозом заболевания легких, индуцированного лекарственным средством интерстициального заболевания легких, фиброза, связанного с радиацией фиброза, облитерирующего бронхиолита, хронической эозинофильной пневмонии, заболевания легких с инфильтрацией лимфоцитов, постинфекционного интерстициального заболевания легких, подагрического артрита, аутоиммунного гепатита, аутоиммунного гепатита I типа (классического аутоиммунного или люпоидного гепатита), аутоиммунного гепатита II типа (гепатита, связанного с антителом против LKM), опосредуемой аутоиммунным заболеванием гипогликемии, устойчивости к инсулину типа В с акантокератодермией, гипопаратиреоза, острого иммунного заболевания, связанного с трансплантацией органа, хронического иммунного заболевания, связанного с трансплантацией органа, остеоартроза, первичного склерозирующего холангита, псориаза I типа, псориаза II типа, идиопатической лейкопении, аутоиммунной нейтропении, NOS-болезни почек, гломерулонефрита, микроскопического васкулита почек, болезни Лайма, дискоидной красной волчанки, идиопатического или NOS-мужского бесплодия, аутоиммунитета к сперматозоидам, рассеянного склероза (все подтипы), симпатической офтальмии, легочной гипертензии, вторичной для болезни соединительной ткани, синдрома Гудпасчера, легочного проявления узелкового полиартериита, острой ревматической атаки, ревматоидного спондилита, болезни Стилла, системной склеродермии, синдрома Шенгрена, болезни/артериита Такаясу, аутоиммунной тромбоцитопении, идиопатической тромбоцитопении, аутоиммунного заболевания щитовидной железы, гипертиреоидизма, зобного аутоиммунного гипотиреоза (болезнь Хашимото), атрофического аутоиммунного гипотиреоза, первичной микседемы, факогенного увеита, первичного васкулита, витилиго, острого заболевания печени, хронического заболевания печени, алкогольного цирроза, индуцированного алкоголем повреждения печени, холестаза, идиосинкразического заболевания печени, индуцированного лекарственным средством гепатита, неалкогольного стеатогепатита, аллергии и астмы, стрептококковой инфекции группы В (GBS), психических расстройств (включая депрессию и шизофрению), опосредуемых типом Th2 и типом Th1 заболеваний, острой и хронической боли (различные формы боли), и злокачественных опухолей, таких как рак легкого, молочной железы, желудка, мочевого пузыря, толстого кишечника, поджелудочной железы, яичника, предстательной железы и прямой кишки и гемопоэтические злокачественные опухоли (лейкоз и лимфома), абеталипопротеинемии, акроцианоза, острых и хронических паразитарных и инфекционных процессов, острого лейкоза, острого лимфобластного лейкоза, острого миелоидного лейкоза, острой или хронической бактериальной инфекции, острого панкреатита, острой почечной недостаточности, аденокарцином, эктопической систолы предсердий, СПИД-дементного комплекса, индуцированного алкоголем гепатита, аллергического конъюнктивита, аллергического контактного дерматита, аллергического ринита, отторжения аллотрансплантата, дефицита альфа-1-антитрипсина, бокового амиотрофическего склероза, анемии, стенокардии, дегенерации клеток передних рогов спинного мозга, терапию против CD3, антифосфолипидного синдрома, реакций гиперчувствительности против рецепторов, аортальных и периферических аневризм, расслоения аорты, артериальной гипертензии, артериосклероза, артериовенозного свища, атаксии, фибрилляции предсердий (постоянной или пароксизмальной), трепетания предсердий, атриовентрикулярной блокады, В-клеточной лимфомы, отторжения трансплантата кости, отторжения трансплантата костного мозга (ВМТ), блокады пучка Гиса, лимфомы Беркитта, ожогов, аритмий сердца, синдрома оглушения сердца, опухолей сердца, кардиомиопатии, воспалительных ответов на искусственное кровообращение, отторжения трансплантата хряща, дегенерации коры головного мозга, нарушений мозжечка, хаотической или многоочаговой тахикардии предсердий, связанных с химиотерапией нарушений, хронического миелоцитарного лейкоза (ХМЛ), хронического алкоголизма, хронических воспалительных патологий, хронического лимфоцитарного лейкоза (ХЛЛ), хронического обструктивного заболевания легких (ХОЗЛ), хронической интоксикации салицилатами, карциномы ободочной и прямой кишки, застойной сердечной недостаточности, конъюнктивита, контактного дерматита, легочного сердца, болезни коронарных артерий, болезни Крейтцфельда-Якоба, культурально-негативного сепсиса, кистозного фиброза, связанных с цитокиновой терапией нарушений, деменции боксеров, демиелинизирующих заболеваний, геморрагической лихорадки денге, дерматита, дерматологических состояний, диабета, сахарного диабета, диабетического атеросклеротического заболевания, диффузного заболевания с тельцами Леви, застойной кардиомиопатии с дилятацией, нарушений базальных ганглиев, синдрома Дауна в среднем возрасте, двигательных нарушений, индуцированных лекарственным средством, которое блокирует дофаминовые рецепторы ЦНС, чувствительности к лекарственным средствам, экземы, энцефаломиелита, эндокардита, эндокринопатии, эпиглоттита, инфекции вирусом Эпштейна-Барр, эритромелалгии, экстрапирамидных и мозжечковых нарушений, семейного гематофагоцитарного лимфогистиоцитоза, отторжения имплантата эмбрионального тимуса, наследственной атаксии Фридрейха, функциональных нарушений периферических артерий, грибкового сепсиса, газовой гангрены, язвы желудка, гломерулонефрита, отторжения трансплантата любого органа или ткани, грамотрицательного сепсиса, грамположительного сепсиса, гранулем вследствие внутриклеточных организмов, волосатоклеточного лейкоза, болезни Галлервордена-Шпатца, тиреоидита Хашимото, сенной лихорадки, отторжения трансплантата сердца, гемахроматоза, гемодиализа, гемолитическоого уремического синдрома/тромболитической тромбоцитопенической пурпуры, кровопотери, гепатита (А), аритмий пучка Гиса, ВИЧ-инфекции/ВИЧ-невропатии, болезни Ходжкина, гиперкинетических двигательных нарушений, реакций гиперчувствительности, связанного с гиперчувствительностью пневмонита, гипертензии, гипокинетических двигательных нарушений, обследования гипоталамо-гипофизарно-надпочечниковой системы, идиопатической болезни Аддисона, идиопатическоого фиброза легких, опосредуемой антителами цитотоксичности, астении, младенческой спинальной мышечной атрофии, воспаления аорты, вируса гриппа а, облучения ионизирующей радиацией, иридоциклита/увеита/оптического неврита, повреждения при ишемии-реперфузии, ишемического инсульта, ювенильного ревматоидного артрита, ювенильной спинальной мышечной атрофии, саркомы Капоши, отторжения трансплантата почки, легионеллеза, лейшманиоза, лепры, повреждений кортикоспинальной системы, жирового отека, отторжения трансплантата печени, лимфатического отека, малярии, злокачественной лимфомы, злокачественного гистиоцитоза, злокачественной меланомы, менингита, менингококкемии, метаболических/идиопатических заболеваний, мигрени, митохондриального полисистемного нарушения, смешанной болезни соединительной ткани, моноклональной гаммапатии, множественной миеломы, полисистемной дегенерации (Менцеля, Дежерина-Тома, Шая-Дрейджера и Мачадо-Джозефа), миастении, внутриклеточных Mycobacterium avium, Mycobacterium tuberculosis, миелодиспластического синдрома, инфаркта миокарда, ишемических нарушений миокарда, карциномы носоглотки, хронического заболевания легких новорожденных, нефрита, нефроза, нейродегенеративных заболеваний, нейрогенных мышечных атрофий I, нейтропенической лихорадки, неходжкинских лимфом, окклюзии брюшного отдела аорты и ее ветвей, окклюзионных нарушений артерий, терапии ОКТ3®, орхита/эпидидимита, орхита/возвратных процедур после вазэктомии, органомегалии, остеопороза, отторжения трансплантата поджелудочной железы, карциномы поджелудочной железы, паранеопластического синдрома/гиперкальцемии при злокачественной опухоли, отторжения трансплантата паращитовидной железы, воспалительного заболевания органов таза, круглогодичного ринита, заболевания перикарда, периферического артериосклеротического заболевания, периферических сосудистых нарушений, перитонита, пернициозной анемии, пневмонии Pneumocystis carinii, пневмонии, синдрома POEMS (полиневропатия, органомегалия, эндокринопатия, моноклональная гаммапатия и синдром кожных изменений), постперфузионного синдрома, синдрома после искусственного кровообращения, посткардиотомного синдрома после инфаркта миокарда, преэклампсии, прогрессирующего супрануклеарного паралича, первичной гипертензии легких, лучевой терапии, феномена и болезни Рейно, болезни Рейно, болезни Рефсума, регулярной тахикардии с узким комплексом QRS, вазоренальной гипертензии, реперфузионного повреждения, рестриктивной кардиомиопатии, сарком, склеродермии, сенильной хореи, сенильной деменции с тельцами Леви, серонегативных артропатий, шока, серповидно-клеточной анемии, отторжения аллотрансплантата кожи, синдрома кожных изменений, отторжения трансплантата тонкого кишечника, солидных опухолей, специфических аритмий, спинальной атаксии, спиномозжечковых дегенераций, стрептококкового миозита, структурных повреждений мозжечка, подострого склерозирующего панэнцефалита, обмороков, сифилиса сердечно-сосудистой системы, системной анафилаксии, синдрома системного воспалительного ответа, ювенильного ревматоидного артрита с системным началом, Т-клеточного или FAB ALL, телеангиэктазии, облитерирующего тромбоангита, тромбоцитопении, токсичности, трансплантации, травмы/кровопотери, реакций гиперчувствительности типа III, гиперчувствительности типа IV, нестабильной стенокардии, уремии, уросепсиса, крапивницы, заболеваний клапанов сердца, варикоза вен, васкулита, заболеваний вен, венозного тромбоза, фибрилляции желудочков, вирусных и грибковых инфекций, энцефалита с высоким риском смертельного исхода/асептического менингита, гемофагоцитарного синдрома с высоким риском смертельного исхода, синдрома Вернике-Корсакова, болезни Вилсона, отторжения ксенотрансплантата любого органа или ткани, острого коронарного синдрома, острого идиопатического полиневрита, острой воспалительной демиелинизирующей полирадикулоневропатии, острой ишемии, болезни Стилла взрослых, очаговой алопеции, анафилаксии, синдрома антифосфолипидных антител, апластической анемии, артериосклероза, атопической экземы, атопического дерматита, аутоиммунного дерматита, аутоиммунного нарушения, связанного со стрептококковой инфекцией, аутоиммунной энтеропатии, аутоиммунной потери слуха, аутоиммунного лимфопролиферативного синдрома, аутоиммунного миокардита, аутоиммунного преждевременного угасания функции яичников, блефарита, бронхоэктазов, буллезного пемфигоида, сердечно-сосудистого заболевания, катастрофического антифосфолипидного синдрома, глютеиновой болезни, шейного спондилеза, хронической ишемии, рубцового пемфигоида, клинически изолированного синдрома (cis) с риском рассеянного склероза, конъюнктивита, психиатрического нарушения с началом в детском возрасте, хронического обструктивного заболевания легких (ХОЗЛ), дакриоцистита, дерматомиозита, диабетической ретинопатии, сахарного диабета, грыжи межпозвоночного диска, пролапса межпозвоночного диска, индуцированной лекарственным средством иммунной гемолитической анемии, эндокардита, эндометриоза, эндофтальмита, эписклерита, полиформной эритемы, тяжелой полиформной эритемы, гестационного пемфигоида, синдрома Гийена-Барре, сенной лихорадки, синдрома Хьюза, идиопатической болезни Паркинсона, идиопатической интерстициальной пневмонии, опосредуемой IgE аллергии, иммунной гемолитической анемии, миозита с тельцами включения, инфекционного воспалительного заболевания глаз, воспалительного демиелинизирующего заболевания, воспалительного заболевания сердца, воспалительного заболевания почек, идиопатического пневмосклероза/ идиопатического легочного фиброза, ирита, кератита, сухого кератоконъюнктивита, болезни Куссмауля или болезни Куссмауля-Мейера, паралича Ландри, гистиоцитоза клеток Лангерганса, синдрома мраморной кожи, дегенерации желтого пятна, микроскопического полиангиита, болезни Бехтерева, нарушений двигательных нейронов, пемфигоида слизистых оболочек, полиорганной недостаточности, миастении, миелодиспластического синдрома, миокардита, нарушений корешков нервов, невропатии, не-А- не-В-гепатита, оптического неврита, остеолизиса, рака яичника, олигоартикулярного ювенильного ревматоидного артрита, окклюзионого заболевания периферических артерий, заболевания периферических сосудов, заболевания периферических артерий (ЗПА), флебита, узелкового полиартериита (или нодозного полиартериита), полихондрита, ревматической полимиалгии, полиоза, полиартикулярного ювенильного ревматоидного артрита, синдрома полиэндокринной недостаточности, полимиозита, ревматической полимиалгии (РПМ), синдрома после искусственного кровообращения, первичного паркинсонизма, рака предстательной железы и прямой кишки и гемопоэтических злокачественных опухолей (лейкоз и лимфому), простатита, истинной эритроцитарной аплазии, первичной недостаточности надпочечников, рецидивирующего оптического нейромиелита, рестеноза, ревматической болезни сердца, SAPHO (синовит, акне, пустулез, гиперостоз и остеит), склеродермии, вторичного амилоидоза, шокового легкого, склерита, ишиаса, вторичной недостаточности надпочечников, связанного с кремнийорганическими соединениями заболевания соединительных тканей, дерматоза Снеддона-Уилкинсона, анкилозирующего спондилита, синдрома Стивенса-Джонсона (SJS), синдрома системного воспалительного ответа, височного артериита, токсоплазменного ретинита, токсического эпидермального некролиза, поперечного миелита, TRAPS (связанный с рецептором фактора некроза опухоли периодический синдром), аллергической реакции I типа, диабета типа II, крапивницы, обычной интерстициальной пневмонии, васкулита, весеннего конъюнктивита, вирусного ретинита, синдрома Фогта-Коянаги-Харада (синдром VKH), влажной дегенерации желтого пятна, заживления ран и связанной с иерсиниями и сальмонеллами артропатии.

27. Способ по п.25, характеризующийся тем, что он дополнительно включает в себя введение блокаторов ФНО-α или других антител к IL-17A.



 

Похожие патенты:

Настоящее изобретение относится к области биотехнологии и может быть использовано для рекомбинантной экспрессии иммуномодуляторных белков. Конструируют вектор, содержащий полинуклеотид, кодирующий генный переключатель, при этом указанный полинуклеотид содержит (1) по меньшей мере одну последовательность фактора транскрипции, которая функционально связана с промотором, при этом указанная по меньшей мере одна последовательность фактора транскрипции кодирует лиганд-зависимый фактор транскрипции, и (2) полинуклеотид, кодирующий полипептид IL-12 и один или более иммуномодуляторных полипептидов, выбранных из IL-2, IL-7, IL-15, IL-18, IL-21, GM-CSF, CCL3 (MIP-1a), CCL5 (RANTES), CCL7 (MCP3), XCL1 (лимфотактин), CCL19 (MIP-3b), CXCL9 (MIG), CXCL10 (IP-10), CXCL12 (SDF-1), CCL21 (6Ckine) или TNF-альфа.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Предложенное изобретение относится к области иммунологии. Предложено антитело против CXCR4 человека или его функциональный фрагмент, которые характенизуются тем, что содержат легкую и тяжелую цепи, содержащие по 3 соответствующих CDR.

Изобретение относится к области биотехнологии, конкретно к химерным полипептидам фактора роста фибробластов (FGF), и может быть использовано в медицине для лечения ожирения, диабета, высокого содержания глюкозы в крови, метаболического синдрома и гиперхолестеринемии.

Настоящее изобретение относится к области иммунологии и биотехнологии. Предложена нуклеиновая кислота, кодирующая биспецифическое одноцепочечное антитело, направленное против CD3 и CEA человека.

Изобретение относится к биотехнологии и иммунологии. Предложены варианты выделенного антитела или его фрагмента, которые специфично связываются с внеклеточным доменом CXCR5 человека.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антигенсвязывающий фрагмент, способные связываться с дельта-подобным лигандом 4 (DLL4) человека, в том числе в форме меченого антитела или его антигенсвязывающего фрагмента, конструкции с константным доменом иммуноглобулина, конъюгата с терапевтическим или цитотоксическим средством и в кристаллизованной форме.

Изобретение относится к биотехнологии. Предложены: клещевой аллерген домашней пыли, представляющий собой полипептид, содержащий определенную аминокислотную последовательность, приведенную в описании в перечне списка последовательностей; кодирующая полипептид молекула ДНК; экспрессирующий вектор на её основе и трансформированная им рекомбинантная клетка для экспрессии полипептида.

Настоящее изобретение относится к области иммунологии. Предложена коллекция антител (или их функциональных фрагментов), содержащих эмбриональные каркасные участки.

Изобретение относится к области молекулярной биологии. Предложен способ получения постоянной линии клеток-амниоцитов человека, включающий трансфекцию зародышевых клеток-амниоцитов человека молекулой нуклеиновой кислоты, содержащей последовательность нуклеиновой кислоты, кодирующую продукты генов аденовирусов Е1А и Е1В, причем указанную последовательность нуклеиновой кислоты получают из серотипа 5 аденовируса человека, и последующую трансфекцию постоянной линии клеток-амниоцитов человека, полученной на первом этапе, молекулой нуклеиновой кислоты, содержащей последовательность нуклеиновой кислоты, кодирующую большой SV40 Т-антиген.

Изобретение касается способа получения рекомбинантного белка SAV-RGD, где SAV - мономер стрептавидина, RGD - меланома-адресующий олигопептид, имеющий аминокислотную последовательность Ser-Arg-Ala-Gly-Ala-Asp-Gly-Phe-Pro-Gly-Cys-Arg-Gly-Asp-Cys-Ser-Gln-Glu.

Предложенное изобретение относится к области биотехнологии, а именно к вирусоподобной частице (VLP) для применения в вакцинах или антигенных композициях для лечения или профилактики инфекции вируса бешенства (RV), а также способам их получения и применения.

Изобретение относится к биотехнологии и представляет собой выделенный вариант субтилизина Bacillus. Изобретение относится также к выделенной нуклеиновой кислоте, кодирующей вариант субтилизина, вектору экспрессии, содержащему нуклеиновую кислоту, клетке-хозяину, способной экспрессировать вариант субтилизина, а также к чистящей композиции, содержащей вариант субтилизина и способу очистки.

Изобретение относится к области биохимии, в частности к cпособу получения двухвалентного биспецифического антитела, который включает трансформацию клетки-хозяина векторами, содержащими молекулы нуклеиновых кислот, кодирующих первую легкую цепь и первую тяжелую цепь двухвалентного биспецифического антитела, и векторами, содержащими молекулы нуклеиновых кислот, кодирующих вторую легкую цепь и вторую тяжелую цепь двухвалентного биспецифического антитела, культивирование клетки-хозяина в условиях, которые обеспечивают синтез молекулы двухвалентного биспецифического антитела и выделение молекулы двухвалентного биспецифического антитела из указанной культуры.

Изобретение относится к области биохимии, в частности к антителу, которое специфически связывает TSLP человека. Также раскрыты изолированная нуклеиновая кислота, кодирующая вышеуказанное антитело, экспрессирующий вектор, содержащий указанную нуклеиновую кислоту, и клетка-хозяин, содержащая указанный вектор, для экспрессии вышеуказанного антитела.

Группа изобретений относится к биотехнологии. Предложены рекомбинантные штамм гриба Penicillium verruculosum ВКМ F-4587D и штамм гриба Penicillium verruculosum ВКМ F-4586D, являющиеся продуцентами высокоактивного комплекса целлюлолитических ферментов гриба P.

Настоящее изобретение относится к области биотехнологии и может быть использовано для рекомбинантной экспрессии иммуномодуляторных белков. Конструируют вектор, содержащий полинуклеотид, кодирующий генный переключатель, при этом указанный полинуклеотид содержит (1) по меньшей мере одну последовательность фактора транскрипции, которая функционально связана с промотором, при этом указанная по меньшей мере одна последовательность фактора транскрипции кодирует лиганд-зависимый фактор транскрипции, и (2) полинуклеотид, кодирующий полипептид IL-12 и один или более иммуномодуляторных полипептидов, выбранных из IL-2, IL-7, IL-15, IL-18, IL-21, GM-CSF, CCL3 (MIP-1a), CCL5 (RANTES), CCL7 (MCP3), XCL1 (лимфотактин), CCL19 (MIP-3b), CXCL9 (MIG), CXCL10 (IP-10), CXCL12 (SDF-1), CCL21 (6Ckine) или TNF-альфа.

Предложенное изобретение относится к области иммунологии. Предложено антитело против CXCR4 человека или его функциональный фрагмент, которые характенизуются тем, что содержат легкую и тяжелую цепи, содержащие по 3 соответствующих CDR.

Изобретение относится к области биотехнологии, конкретно к химерным полипептидам фактора роста фибробластов (FGF), и может быть использовано в медицине для лечения ожирения, диабета, высокого содержания глюкозы в крови, метаболического синдрома и гиперхолестеринемии.

Настоящее изобретение относится к области иммунологии и биотехнологии. Предложена нуклеиновая кислота, кодирующая биспецифическое одноцепочечное антитело, направленное против CD3 и CEA человека.

Настоящее изобретение относится к области биотехнологии. Предложен способ повышения антагонистической активности моноклонального антитела, содержащего константную область IgG1 человека и направленного против специфической молекулы-мишени, включающий модификацию аминокислотной последовательности шарнирной области.
Наверх