Полустабильное получение лентивирусных векторов



Полустабильное получение лентивирусных векторов
Полустабильное получение лентивирусных векторов
Полустабильное получение лентивирусных векторов
Полустабильное получение лентивирусных векторов
Полустабильное получение лентивирусных векторов
Полустабильное получение лентивирусных векторов
Полустабильное получение лентивирусных векторов
Полустабильное получение лентивирусных векторов

 


Владельцы патента RU 2577982:

МОЛМЕД СПА (IT)

Изобретения касаются системы стабильной экспрессии лентивирусных структурных и регуляторных белков, полустабильной линии пакующих клеток и способа получения лентивирусных векторов (LV) с использованием такой линии пакующих клеток. Представленная система стабильной экспрессии лентивирусных белков состоит из гибридного вектора, содержащего бакуловирусный остов, содержащий, в свою очередь, кассету интеграции, фланкированную ITR AAV, включающую в себя две кассеты экспрессии, и экспрессирущей плазмиды, содержащей открытую рамку считывания (ORF) Rep AAV. Причем первая кассета экспрессии кодирует лентивирусные гены gag и pol, а вторая кассета кодирует rev и селектируемый маркер. Система позволяет получать линию клеток, содержащую структурные и регуляторные белки ВИЧ gag/pol и rev, используемую для продукции LV. Представленные изобретения могут быть использованы в генной терапии. 3 н. и 16 з.п. ф-лы, 3 ил., 4 табл., 3 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к получению лентивирусных векторов (LV) для генной терапии. Более конкретно, изобретение относится к полустабильным линиям пакующих лентивирусы клеток и способам получения линий пакующих клеток с использованием гибридного бакуло-аденоассоциированного вирусного (AAV) вектора для стабильной интеграции структурных и регуляторных лентивирусных белков.

Уровень техники

После самого первого клинического испытания LV фазы I против СПИДа в 2001 контролирующими органами были рассмотрены результаты 38 испытаний фазы I-II и два испытания фазы II-III, в которых использовали основанные на ВИЧ LV в качестве носителей для доставки генов; три из них еще находятся на рассмотрении. Наибольшее количество испытаний включает моногенные расстройства, некоторые из которых встречаются с высокой частотой, такие как анемия Кули или большая β-талассемия (4 испытания). Далее следуют злокачественные опухоли и инфекционные болезни, главным образом инфекция ВИЧ-1. Обычно количество пациентов, набираемых для испытаний, ограничено в фазе I/II, но не ограничено в фазе III. Таким образом существует неотложная необходимость в стабильных линиях пакующих клеток для 2-го (основанного на LTR) и 3-го (основанного на SIN) поколения LV, чтобы обеспечить неотложную потребность в крупномасштабном получении LV для испытаний фазы III, которые, как следует надеяться, могут быть осуществлены в будущем в большом количестве. Получение LV, основанное на временных протоколах, в действительности является непригодным для широкого применения с точки зрения безопасности, затрат и воспроизводимости.

Возрастающее количество доказательств свидетельствует о том, что LV, совсем недавно разработанные вирусные интегрирующиеся векторы для генной терапии, широко применимы для трансдукции либо окончательно дифференцированных, либо делящихся клеток, идеальны для поддержания долговременной экспрессии трансгена и более безопасны, чем предполагали вначале. Опыт, накопленный при использовании гамма-ретровирусных векторов (γ-RV) на основе вируса лейкоза мышей Молони (MoMLV) в последние два десятилетия, привел к быстрому прогрессу в создании LV-систем доставки, разработка которых началась в связи с необходимостью преодолеть неспособность ретровируса трансдуцировать неделящиеся клетки. В частности, создание самоинактивируемых (SIN) векторов для переноса делает более вероятными планы широкого применения LV в клинических испытаниях на человеке1 при условии расширения и оптимизации такого эффективного способа производства. Однако в отличие от γRV, который может быть продуцирован несколькими коммерчески доступными линиями пакующих клеток человека и мыши, LV в настоящее время получают не только со степенью чистоты для исследований, но также со степенью чистоты, соответствующей стандарту GMP, почти исключительно в результате временной трансфекции. Такая методика является дорогостоящей, ее трудно стандартизовать и масштабировать и она требует многочисленных подтверждающих тестов в ходе выполнения. Кроме того, риск появления компетентных по репликации лентивирусов (RCL), вероятно возникающих в результате рекомбинации между вирусными последовательностями в пакующей конструкции и конструкции вектора для переноса, является редким, но более вероятным событием в ходе временной продукции, чем в ходе стабильной продукции.

Разработка стабильной линии пакующих клеток для LV, эквивалентной линии пакующих ретровирусы клеток, оказалась более медленной и более трудной, так как, в отличие от гамма-ретровируса, экспрессия лентивирусных белков, таких как env, протеаза и некоторые вспомогательные белки, является токсичной для клеток человека. Чтобы преодолеть такую проблему, вспомогательные гены, присутствующие в наиболее ранних вариантах пакующих клеток, затем в последних поколениях были удалены. Основанные на SIV- и ВИЧ линии пакующих LV клеток первого поколения получали из прикрепляющихся клеток либо Vero обезьян, либо COS, HeLa и 293 человека2-5, сконструированных с использованием лентивирусных геномов, несущих несколько важных модификаций, таких как удаление сигнала упаковки. Ген gp120 env и большинство вспомогательных генов фактически сохранялись. Получаемый титр LV был очень низким2-5 и, что более важно, возможное применение таких векторов неизбежно ограничено T-клетками CD4+ для способов направленной против СПИДа генной терапии. Позже gp120 env заменили гликопротеидом, полученным из вируса везикулярного стоматита (VSV-G), и все вспомогательные гены были удалены, поскольку, как было доказано, они являются необязательными для эффективной продукции LV. Чтобы предотвратить токсичность, также описанную для VSV-G, его экспрессию при определенных условиях индуцировали, используя множество различных систем, таких как Tet, экдизон, Rev и сочетание Tet и кумата6. Подобным образом, чтобы снизить токсический эффект вирусной протеазы во время клональной селекции, описана экспрессия гена gag-pol, обусловленная Tet и сочетанием лекарственных средств доксициклина и кумата6. Во всех таких системах гены gag-pol, rev и env были интегрированы посредством временной трансфекции плазмидной ДНК с последующим отбором с использованием лекарственных средств и клонированием клеток.

Одной важной проблемой при использовании действительно стабильной линии пакующих клеток является выбор наилучших носителей для доставки вирусных генов. Большинство исследователей интегрировали гены gag-pol, rev и env посредством временной трансфекции плазмидной ДНК с последующим отбором с использованием лекарственных средств и клонированием клеток2-9. Известно, что такая методика страдает таким недостатком, что с течением времени возникает сайленсинг генов и утрата генов10, что также может ставить под угрозу долговременную стабильность пакующего клона.

Альтернативные носители для доставки генов раскрыты, в частности, в случае линии пакующих клеток STAR11 и в случае недавно разработанной линии пакующих клеток GPRG-TL-2012, в которых гены gag, pol и rev были интегрированы в клетки HEK293T с помощью MLV-челночных векторов. Две копии регистрируемого гена gag-pol были стабильно интегрированы в STAR, тогда как для GPRG-TL-2012 подобная информация отсутствует. В отличие от STAR, где осуществляли трансфекцию гена env, в GPRG-TL-20 все сохраняемые вирусные гены были введены посредством SIN-MLV.

Существует несколько систем, которые обеспечивают стабильную интеграцию чужеродного генома в клетки-хозяева. Palombo с соавторами, 199813, описывают гибридный бакуловирусный-AAV-вектор для специфичной интеграции в клетки-хозяева. Такой вектор, по-видимому, является очень эффективным, если он содержит ген rep в том же гибридном бакуловирусном-AVV-векторе. В указанной публикации нет упоминания о конструкции согласно настоящему изобретению, не говоря уже о предложении использовать систему такого вида для продуцирования LV.

На протяжении последних почти двух десятилетий было предпринято несколько попыток создания стабильных линий клеток, пакующих LV. Несмотря на различные раскрытые методики, на сегодняшний день не одна из таких линий пакующих клеток еще не используется в клинических испытаниях и не вышла на рынок. Поэтому существует необходимость в новых системах для крупномасштабного получения LV, которые являются эффективными с точки зрения производительности и являются безопасными, рентабельными и воспроизводимыми.

Сущность изобретения

Настоящее изобретение относится к области получения LV. Проходит несколько клинических испытаний генной терапии с использованием LV в качестве носителей для доставки генов. Во всех таких испытаниях получение LV еще основано на временных протоколах.

Настоящее изобретение относится к новой методике создания основанной на ВИЧ-1 линии пакующих клеток. Такая методика основана на применении гибридного вектора, содержащего бакуловирусный остов, включающий в себя кассету интеграции, фланкированную инвертированными концевыми повторами AAV (ITR), так называемой гибридной системы бакуло-AAV, в сочетании с плазмидой, кодирующей белок rep. Такая система позволяет получать стабильную интеграцию структурных и регуляторных белков ВИЧ-1 gag/pol и rev. Система согласно настоящему изобретению включает в себя: a) гибридный вектор бакуло-AAV, отличающийся тем, что он содержит две кассеты экспрессии, одна из которых кодирует лентивирусные гены gag и pol, а другая кодирует лентивирусный rev и маркер селекции, и b) плазмиду, кодирующую белок rep. Предложенная система представляет собой новый и обладающий преимуществами путь доставки структурных и регуляторных белков ВИЧ, чтобы стабильно и эффективно сконструировать клетки-хозяева со структурными лентивирусными белками. Используя такую систему, получили первый промежуточный продукт, содержащий только структурные и регуляторные белки ВИЧ gag/pol и rev, применимый для получения полустабильной продукции LV или в качестве исходной точки для получения линий пакующих клеток 2-го и 3-го поколения, необязательно содержащих регуляторный белок (Tat) и представляющий интерес белок оболочки, а также линий клеток-продуцентов, также содержащих вектор для переноса.

Первый промежуточный продукт несет две копии рекомбинантной пакующейся конструкции бакуло-AAV, экспрессирующей гены ВИЧ-1 gag-pol и rev в трехцистронной конфигурации. Такой промежуточный продукт был назван PK-7 и упоминается как PK-7 в примерах. Геномной интеграции пакующегося вектора бакуло-AAV способствовала временная экспрессия белка AAV rep78, который, как известно, необходим для ITR-опосредованной интеграции вектора AAV14. Показано, что такой первый промежуточный продукт обладает неожиданной генетической стабильностью в течение 1 года культивирования, что свидетельствует о непрерывной продукции функционального LV после временной трансфекции оставшихся генетических элементов. Кроме того, в таких клетках не наблюдали явления сайленсинга. Кроме того, благодаря точному картированию сайта интеграции двух тандемно интегрированных пакующих векторов AAV в некодирующей межгенной транскрипционно активной области авторы получили аргумент в пользу безопасности и против возможной активации опасных генов, мРНК которых может быть включена в LV и в конечном итоге в клетки-хозяева, являющиеся мишенями.

Разработанная пакующая система на основе применения гибридного вектора бакуло-AAV для стабильной экспрессии лентивирусных gag-pol и rev была названа «MolPack». Система экспрессии, используемая в настоящем изобретении, успешно обеспечивает возможность стабильного и безопасного введения структурных (gag/pol) и регуляторных (rev) белков ВИЧ с использованием только одного раунда трансфекции и клонирования. Получение LV, в настоящее время используемых в клинических испытаниях, все еще основано на временной трансфекции всех требуемых белков. Напротив, промежуточный продукт, полученный с использованием системы экспрессии согласно настоящему изобретению, является стабильным без проявления явления сайленсинга, позволяет получать полустабильную продукцию LV, обеспечивая при этом большие преимущества с экономической точки зрения. Действительно, полустабильная продукция требует меньшего количества трансфицируемых конструкций для получения конечного продукта. Кроме того, также неожиданно было обнаружено, что при использовании полустабильной продукции согласно настоящему изобретению только одна треть количества ДНК, используемой для продуцирования в случае временной трансфекции, достаточна для получения LV, имеющих титр, сравнимый с титром временно продуцируемых LV. Кроме того, использование меньшего количества трансфицируемых конструкций уменьшает вероятность событий рекомбинации с образованием RCL, тем самым делая получение лентивирусных частиц более безопасным. Таким образом, система экспрессии, полустабильная линия пакующих клеток и способ получения согласно настоящему изобретению имеют большие преимущества по сравнению со средствами и способами, применяемыми в настоящее время в клинических испытаниях.

Основные положения изобретения

Согласно первому аспекту изобретения предлагается система для стабильной экспрессии лентивирусных структурных и регуляторных белков, состоящая из:

i) гибридного вектора, содержащего бакуловирусный остов, который содержит кассету интеграции, фланкированную ITR AAV, включающую в себя две кассеты экспрессии, при этом первая кассета экспрессии кодирует лентивирусные гены gag и pol, а вторая кассета экспрессии кодирует лентивирусный rev и селектируемый маркер, и

ii) экспрессирующей плазмиды, содержащей открытую рамку считывания (ORF) rep AAV под контролем промотора.

Предпочтительно две кассеты экспрессии гибридного вектора находятся в ориентации хвост-к-хвосту, и каждая кассета управляется конститутивным промотором и поли-A, предпочтительно промотор выбран из CMV, CMV IE, PGK, SV40, eF1α SFFV и RSV, более предпочтительно промотором является промотор CMV IE.

Предпочтительно селектируемый маркер выбран из гена резистентности к гигромицину, канамицину, неомицину, зеомицину, более предпочтительно селектируемым маркером является ген резистентности к гигромицину.

Более предпочтительно селектируемый маркер клонируют ниже участка внутренней посадки рибосомы (IRES).

Согласно другому аспекту изобретения предлагается полустабильная линия пакующих лентивирусы клеток, состоящая из клеток, стабильно экспрессирующих лентивирусные gag pol и rev, отличающаяся тем, что такие клетки содержат стабильно интегрированную в их геном, по меньшей мере, одну копию кассеты интеграции, фланкированную ITR AAV, включающую в себя две кассеты экспрессии, при этом первая кассета экспрессии кодирует лентивирусные гены gag и pol, а вторая кассета экспрессии кодирует лентивирусный rev и селектируемый маркер.

Предпочтительно клеткой является линия клеток человека, предпочтительно выбранная из HEK293, HEK293-T, HEK293-SF, TE671, HT1080 или HeLa, более предпочтительно линией клеток является HEK293-T.

Предпочтительно две кассеты экспрессии находятся в ориентации хвост-к-хвосту, и каждая кассета управляется конститутивным промотором и поли-A; предпочтительно промотор выбран из CMV, CMV IE, PGK, SV40, eF1α, SFFV и RSV, более предпочтительно конститутивным промотором является промотор CMV IE.

Предпочтительно селектируемый маркер выбран из гена резистентности к гигромицину, канамицину, неомицину, зеомицину; более предпочтительно селектируемым маркером является ген резистентности к гигромицину. Более предпочтительно селектируемый маркер клонируют ниже IRES.

Предпочтительно белок rep AAV выбран из rep78 или rep68. Более предпочтительно белком rep является rep78.

Согласно другому аспекту предлагается способ получения лентивирусных векторов, включающий в себя:

i) культивирование полустабильной линии пакующих лентивирусы клеток, состоящей из клеток, стабильно экспрессирующих лентивирусные gag, pol и rev, отличающихся тем, что такие клетки содержат стабильно интегрированную в их геном, по меньшей мере, одну копию кассеты интеграции, фланкированной ITR AAV, содержащей две кассеты экспрессии, при этом первая кассета экспрессии кодирует лентивирусные гены gag и pol, а вторая кассета экспрессии кодирует лентивирусный rev и селектируемый маркер;

ii) встраивание в полустабильную линию пакующих клеток гена env;

iii) встраивание в полустабильную линию пакующих клеток вектора переноса.

Предпочтительно две кассеты экспрессии находятся в ориентации хвост-к-хвосту, и каждая кассета экспрессии управляется конститутивным промотором и поли-A; предпочтительно промотор выбран из CMV, CMV IE, PGK, SV40, eF1α, SFFV и RSV, более предпочтительно конститутивным промотором является промотор CMV IE.

Предпочтительно селектируемый маркер выбран из гена резистентности к гигромицину, канамицину, неомицину, зеомицину; более предпочтительно селектируемым маркером является ген резистентности к гигромицину. Более предпочтительно селектируемый маркер клонируют ниже IRES.

Белок оболочки может быть встроен в клетки-хозяева с использованием вектора AAV, ретровирусного вектора, стабильной интеграции плазмиды или гомологичной рекомбинации. Предпочтительно ген env встраивают посредством временной трансфекции с использованием плазмиды.

Предпочтительно ген env выбран из env VSV-G, env MLV 4070, env D114, химерного белка оболочки RD114-TR, химерного белка оболочки RD114pro, бакуловирусного env GP64, или env GALV, или их производных, более предпочтительно геном env является ген, кодирующий RD114-TR.

Предпочтительно вектор для переноса встраивают с лентивирусным SIN-вектором.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Подробное описание предпочтительных признаков и вариантов осуществления изобретения будет приведено с использованием неограничивающих примеров.

Изобретение может быть применено на практике специалистом в данной области, который будет использовать, если не указано иное, обычные методики химии, молекулярной биологии, микробиологии, рекомбинантной ДНК и иммунологии. Все указанные методики раскрыты и подробно описаны в общедоступной литературе. Смотри, например, J. Sambrook, E. F. Fritsch and T. Maniatis, 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Books 1-3, Cold Spring Harbor Laboratory Press; Ausubel, F.M. et al. (1995 and periodic supplements; Current Protocols in Molecular Biology, ch. 9, 13 and 16, John Wiley & Sons, New York, N.Y.); Current Protocols in Immunology, ch. 12, John Wiley & Sons, New York, N.Y.); B. Roe, J. Crabtree and A. Kahn, 1996, DNA Isolation and Sequencing: Essential Techniques, John Wiley & Sons; J. M. Polak and James O'D. McGee, 1990, In Situ Hybridization: Principles and Practice; Oxford University Press; M. J. Gait (Editor), 1984, Oligonucleotide Synthesis: A Practical Approach, Irl Press and D. M. J. Lilley and J. E. Dahlberg, 1992, Methods of Enzymology: DNA Structure Part A: Synthesis and Physical Analysis of DNA Methods in Enzymology, Academic Press. Все указанные публикации включены в виде ссылки.

Гибридная бакуло-AAV-система

Настоящее изобретение относится к новой методике создания, основанной на ВИЧ-1 линии пакующих клеток. Оптимизация системы продуцирования LV является одной из важнейших проблем, которую необходимо решить для разработки генной терапии на основе LV-методики. Несмотря на растущее количество клинических испытаний, в которых используют такую методику, LV в таких испытаниях все еще получают, используя протоколы временной трансфекции. Таким образом, получение LV все еще является очень дорогостоящим и неподходящим для большего количества пациентов. По этой причине было предпринято множество попыток разработать стабильные линии пакующих клеток для LV. Одной из важных проблем при разработке стабильной линии пакующих лентивирусы клеток является выбор правильного носителя для конструирования клеток-хозяев. Во многих случаях клетки-хозяева конструировали, используя плазмиды, но в таких случаях также наблюдали нестабильность генома и явление сайленсинга генов. В двух других случаях использовали ретровирусные векторы, чтобы стабильно интегрировать гены gag/pol и rev. Не одну из разработанных до настоящего времени стабильных линий пакующих клеток не использовали в клинике.

Методика согласно настоящему изобретению основана на использовании системы стабильной экспрессии лентивирусных структурных и регуляторных белков ВИЧ, состоящей из гибридного вектора, содержащего бакуловирусный остов, который содержит кассету интеграции, фланкированную ITR AAV, включающую в себя две кассеты экспрессии, при этом первая кассета экспрессии кодирует лентивирусные гены gag и pol, а вторая кассета экспрессии кодирует лентивирусный rev и селектируемый маркер вместе с экспрессирующей плазмидой, содержащей ORF rep AAV под контролем промотора. Присутствие бакуловирусного остова позволяет хозяину принимать большую и сложную кассету интеграции, содержащую две кассеты экспрессии, кодирующие несколько разных белков. Полученный пакующий вектор бакуло-AAV позволяет конструировать клетки-хозяева с вирусными белками, которые необходимы для стабильной и эффективной продукции LV посредством только одного события инфекции.

Геномную интеграцию пакующего вектора бакуло-AAV получали в результате временной экспрессии белка rep AAV. Такая система позволила осуществлять интеграцию векторов AAV в некодирующую межгенную транскрипционно активную область, тем самым исключая активацию опасных генов, мРНК которых может быть включена в LV и в конечном итоге в клетки-хозяева, являющиеся мишенями.

Предложенная система представляет собой новый и обладающий преимуществами путь стабильного и эффективного конструирования клетки-хозяина со структурными и регуляторными лентивирусными белками.

В предпочтительном варианте две кассеты экспрессии, включенные в пакующую конструкцию бакуло-AAV, находятся в ориентации хвост-к-хвосту и каждая кассета экспрессии управляется конститутивным промотором и поли-A, предпочтительно промотор выбран из CMV, CMV IE, PGK, SV40, eF1α, SFFV и RSV, более предпочтительно промотором является промотор CMV IE. Согласно предпочтительному аспекту изобретения селектируемый маркер, включенный в пакующий AAV-вектор, выбран из гена резистентности к гигромицину, канамицину, неомицину, зеомицину; предпочтительно маркером является ген резистентности к гигромицину; более предпочтительно селектируемый маркер клонирован ниже IRES.

Геномную интеграцию пакующего вектора бакуло-AAV получали в результате временной экспрессии белка rep AAV для ITR-опосредованной интеграции AAV-вектора. В предпочтительном варианте белок rep выбран из rep78 и rep68, более предпочтительно белком является rep78.

С использованием указанной системы можно получать клетки, сконструированные для стабильной экспрессии белков ВИЧ-1 gag/pol и rev, такие клетки названы полустабильной линией пакующих клеток. В частности, в настоящем изобретении раскрыты и заявлены такие сконструированные клетки и их применение для полустабильной продукции LV.

Полустабильная линия пакующих клеток

Полустабильная линия пакующих клеток согласно настоящему изобретению состоит из клеток-хозяев, несущих, по меньшей мере, одну копию рекомбинантной пакующей конструкции бакуло-AAV, экспрессирующей гены ВИЧ-1 gag-pol и rev. Геномную интеграцию пакующего вектора бакуло-AAV получили в результате временной экспрессии белка rep AAV, чтобы получить ITR-опосредованную интеграцию AAV-вектора. Предпочтительно две кассеты экспрессии находятся в ориентации хвост-к-хвосту, и каждая кассета экспрессии управляется конститутивным промотором и поли-A, предпочтительно промотор выбран из CMV, CMV IE, PGK, SV40, eF1α, SFFV и RSV. Более предпочтительно конститутивным промотором является промотор CMV IE.

Согласно предпочтительному аспекту изобретения селектируемый маркер выбран из гена резистентности к гигромицину, канамицину, неомицину, зеомицину; предпочтительно селектируемым маркером является ген резистентности к гигромицину, более предпочтительно селектируемый маркер клонируют ниже IRES.

Предпочтительно белок rep AAV выбран из rep78 и rep68. Более предпочтительно белком rep является rep78. Линии клеток-хозяев, которые могут быть сконструированы для получения полустабильной линии пакующих клеток, представляют собой линии клеток, выбранные из HEK293, HEK293-T, HEK293-SF, TE671, HT1080 или HeLa, более предпочтительно линией клеток является HEK293-T.

Такая полустабильная линия пакующих клеток подходит для получения большого разнообразия LV с разными env и разными векторами для переноса в полустабильной системе продуцирования. Поэтому она дает большое преимущество с точки зрения более эффективной продукции LV, так как позволяет снизить затраты, она не требует использования плазмидной ДНК со степенью чистоты, соответствующей стандарту GMP, кодирующей gag-pol и rev, и при этом снижен риск образования RCL на фоне событий рекомбинации между плазмидами в ходе временной трансфекции. Полустабильная линия пакующих клеток является универсальным средством, которое является безопасным и экономически более выгодным, чем другие средства, используемые в настоящее время в клинических испытаниях для получения LV.

Показано, что полустабильная линия пакующих клеток согласно настоящему изобретению обладает неожиданной генетической стабильностью в течение 1 года культивирования, что свидетельствует о непрерывной продукции функционального LV после временной трансфекции оставшихся генетических элементов. Кроме того, по сути не наблюдается явление сайленсинга и титр и инфекционность LV, получаемых с использованием такого промежуточного продукта, сохраняются неизменными спустя 1 год. Такие данные были подтверждены как в присутствии, так и в отсутствие давления отбора. Следует отметить, что сопоставимые данные в отношении стабильности интеграции кассеты, опосредованной ITR AAV, в литературе отсутствуют. Единственная соответствующая информация относится к тому, что полученная из костного мозга человека линия подобных фибробластам клеток (клетки Раддла Детройт 6), инфицированных AAV дикого типа серотипа 2 (AVV-2), сохраняла вирусные последовательности в латентном состоянии в течение, по меньшей мере, 47 и 118 пассажей. Как показано в примерах, полустабильная линия пакующих клеток согласно настоящему изобретению сохранялась в течение, по меньшей мере, 102 пассажей.

Таким образом, настоящее изобретение относится к способу получения LV, включающему в себя:

i) культивирование полустабильной линии пакующих клеток, которая описана выше;

ii) встраивание в полустабильную линию пакующих клеток гена env;

iii) встраивание в полустабильную линию пакующих клеток вектора переноса.

Белок оболочки может быть встроен в клетки-хозяева с использованием вектора AAV, ретровирусного вектора, стабильной интеграции плазмиды или гомологичной рекомбинации. Предпочтительно ген env встраивают посредством временной трансфекции с использованием плазмиды.

Предпочтительно ген env выбран из env VSV-G, env MLV 4070, env D114, химерного белка оболочки RD114-TR, химерного белка оболочки RD114pro, бакуловирусного env GP64 или env GALV или их производных. Более предпочтительно в настоящем изобретении используют химерный белок оболочки RD114-TR env, в котором цитоплазматический хвост RD114 был заменен цитоплазматическим хвостом оболочки MLV. Предпочтительно вектор переноса встраивают с SIN-LV.

Полустабильная линия пакующих клеток согласно настоящему изобретению способна продуцировать LV, которые в отношении инфекционности «качественно» равны LV, продуцируемым при временной трансфекции. Очень важная проблема, которую необходимо учитывать в случае применения полустабильной продукции LV, заключается в том, что полустабильная линия пакующих клеток не утрачивала способность легко подвергаться трансфекции. Действительно, клетки PK-7 подвергались трансфекции на том же уровне, что и родительская линия клеток HEK293T. Указанный признак довольно часто утрачивается после генетической модификации и клонирования клеток HEK293 с пакующей конструкцией. Напротив, система экспрессии, используемая в настоящем изобретении для стабильной интеграции gag/pol и rev, не создает никаких проблем в отношении способности к трансфекции полустабильной линии пакующих клеток.

Кроме того, полустабильная линия пакующих клеток и ее применение в способе получения LV имеют важные преимущества в отношении затрат на получение. В частности, только три дополнительных конструкции, например плазмиды (каждая из которых кодирует tat, env и вектор переноса), необходимы для получения LV 2-го поколения или две конструкции (кодирующих env и вектор переноса) для получения LV 3-го поколения. Напротив, способы GMP, используемые в настоящее время в клинических испытаниях, требуют использования двух дополнительных конструкций, кодирующих gag/pol и rev соответственно, в дополнение к конструкциям, используемым в случае полустабильной линии пакующих клеток согласно настоящему изобретению.

Кроме того, уменьшенное количество конструкций, трансфицируемых способами и средствами согласно настоящему изобретению, также обеспечивает дополнительное преимущество в отношении безопасности LV, как описано выше.

Кроме того, также примечательно, что было обнаружено, что в случае применения полустабильного получения согласно настоящему изобретению только одна треть общего количества ДНК, используемой для продуцирования при временной трансфекции, достаточна для получения лентивирусов, имеющих титр, сравнимый с титром временно продуцируемых лентивирусов. Таким образом, система экспрессии, полустабильная линия пакующих клеток и способ получения согласно настоящему изобретению обеспечивают большие преимущества по сравнению со средствами и способами, применяемыми в настоящее время в клинике.

Описание фигур

Фигура 1. Схемы разработки RD-MolPack. (a) Схематичное представление ДНК-плазмид, используемых в данном исследовании. pPolh, промотор полиэдрина; attB1, присоединение B1; ITR, инвертированный концевой повтор; CMV, промотор цитомегаловируса; In, интрон; RRE, элемент ответа на rev; A, поли-A-последовательность; IRES, участок внутренней посадки рибосомы; SD, донор сплайсинга; SA, акцептор сплайсинга; ψ, сигнал упаковки; WPRE, элемент посттраскрипционной регуляции вируса гепатита сурков; cPPT, центральный полипуриновый тракт; hPGK, промотор фосфоглицераткиназы человека; (b) Графическое изображение Rep78-опосредованной геномной интеграции вектора AAV-GPR. Rep 78 AAV стимулирует эксцизию ITR-фланкированной кассеты AAV-GPR и способствует ее интеграции в хромосомы человека; (c) Схема продуцирования полустабильной линией пакующих клеток. GOI, представляющий интерес ген.

Фигура 2. Характеристика клонов PK. (a) Саузерн-блот-анализ интеграции вектора AAV-GPR. Чтобы установить количество копий и целостность кассеты, геномную ДНК (10 мкг), полученную из клонов PK, расщепляли двумя разными ферментами рестрикции, BamHI и SnaBI соответственно; (b) Вестерн-блот-анализ вирусных белков, продуцируемых с кассеты GPR. Левая панель, клеточные экстракты (50 мкг/дорожку), полученные из клонов PK, гибридизовали с антисывороткой человека против ВИЧ, узнающей белки ВИЧ-1. Затем мембрану гибридизовали со специфичными анти-rev-Ат. Правая панель, 30 нг p24gag-эквивалента вирусоподобных частиц (VLP), полученных из клонов PK, обрабатывали идентично обработке клеточных экстрактов; (c) Схематичное картирование интеграции GPR-кассеты способом ОЛ-ПЦР (опосредованной лигированием ПЦР), которое выявляет точку разрыва ДНК в длинном плече хромосомы 2 в положении 2q32.1. (d) Совместная локализация кассеты AAV-GPR и гена Hox4 человека в хромосоме 2. Гибридизацию in situ метафазных хромосом PK-7 осуществляли, используя gag-специфичный (красный) и Hox4-специфичный (зеленый) зонды соответственно, (e) Схематичное представление перестройки двух интегрированных кассет GPR в клоне PK-7 и их ориентация хвост-к-хвосту.

Фигура 3. Контрольные эксперименты в отношении возможной интеграции бакуло-AAV-GPR и Rep78. (a) Саузерн-блот-анализ рекомбинантной ДНК бакуловирус-AAV. ДНК экстрагировали из бакуловирусных частиц, расщепляли в течение ночи ферментом рестрикции MluI и после кипячения исследовали, используя специфичный для кассеты GPR зонд длиной 11 т.п.н. Пустую плазмиду GPR (1 пг) и бакуловирусную пустую ДНК (100 нг) загружали в качестве позитивного и негативного контроля соответственно; (b) Выявление предполагаемой интеграции остаточной плазмидной ДНК rep78 в клетки PK-7 клетки. Rep78-специфичную ПЦР осуществляли, используя геномную ДНК PK-7 в качестве матрицы образца и плазмиду CMV-rep78 (1 пг) в качестве позитивного контроля.

Примеры

Пример I: Общие способы

Плазмиды

Гены ВИЧ-1 дикого типа gag, pol и rev вырезали при расщеплении MluI/NarI и MluI/NotI из плазмид pCG719-pKLgagpol (далее называемой CMV-GPR для простоты) (фигура 1a, схема 9) и pCG720-pKrev (CMV-Rev) (фигура 1a, схема 5) соответственно25. Вирусные гены встраивали в челночный вектор Gateway® pENTR™4 (Invitrogen, Co., Carlsbad, CA) в двух отдельных кассетах экспрессии, расположенных в ориентации хвост-к-хвосту, при этом каждая кассета управляется промотором CMV IE и несет поли-A-последовательность. Первая кассета экспрессирует гены gag и pol, тогда как вторая кассета экспрессирует ген rev и селектируемый маркерный ген резистентности к гигромицину (hygro); hygro клонировали ниже IRES, чтобы обеспечить возможность бицистронной трансляции. Две единицы экспрессии вводили в сайт XbaI рекомбинантной плазмиды pSUB201, несущей инфекционный геном AAV17. Затем полученную кассету 5'ITR-CMV-gagpol-polyA-polyA-hygro-IRES-rev-CMV-ITR3' вырезали и встраивали в челночный вектор Gateway® pENTR™4 (Invitrogen, Co., Carlsbad, CA). Рекомбинантный гибридный пакующий вектор бакуло-AAV (бакуло-AAV-GPR) (фигура 1a, схема 1) получали с помощью сайт-специфичной системы рекомбинации бактериофага лямбда между исходным челночным вектором pENTRTM4, содержащим две кассеты, и линейной ДНК BaculoDirect (системы бакуловирусной экспрессии BaculoDirectTM, Invitrogen, Co.). При этом в ходе гомологичной рекомбинации ген полиэдрина бакуловирусной ДНК заменяли двойной кассетой GPR. Экспрессирующую плазмиду pABCMV-rep78 (CMV-AAV-rep78) получали клонированием ORF AAV-rep78 под контролем промотора CMV IE экспрессирующего вектора pABS.43, как описано Recchia с соавторами, 200418 (фигура 1a, схема 4). Плазмида pMD.G (CMV-VSV-G)19 кодирует гликопротеид оболочки вируса везикулярного стоматита (VSV-G) (фигура 1a, схема 6). Вектор переноса 3-го поколения pCCLsin.PPT.hPGK.eGFP.WPRE.Amp (SIN-eGFP)20 экспрессирует ген eGFP под контролем конститутивного промотора hPGK (фигура 1a, схема 2). Вектор переноса PΔN-Chim3 2-го поколения, экспрессирующий трансген Chim3 против ВИЧ-1, описан Porcellini с соавторами, 2009 и 201021,22 (фигура 1a, схема 3). Плазмида pCMV-RD114-TR (CMV-RD114-TR) (фигура 1a, схема 7) кодирует химерный белок оболочки RD114-TR, образованный из внеклеточного и трансмембранного доменов белка RD114 оболочки эндогенного ретровируса кошачьих и цитоплазматического хвоста (TR) A-MLVenv 4070A23. Пакующая конструкция pCMV-ΔR8.74 (CMV-GPRT) 2-го поколения (фигура 1a, схема 8) кодирует гены gag, pol, rev и tat ВИЧ-119.

Клетки

Клетки насекомых Spodoptera frugiperda (Sf9) (Invitrogen, Co.) выращивали в суспензии в среде TC-100 (Invitrogen, Co.) с добавлением 10% FCS (EuroClone Ltd., UK) и в сочетания пенициллина-стрептомицина и глутамина (PSG) при 27°C в отсутствие CO2. Клетки эмбриональной почки человека 293T (HEK293T) и производный от них клон (PK-7) размножали в модифицированной Дульбекко среде Игла (DMEM) с добавлением 10% FCS и PSG. T-лимфобластоидные клетки CEM A3.01 и SupT1 выращивали в RPMI 1640 с добавлением 10% FCS и PSG. Гемопоэтические стволовые клетки (HSC) CD34+ и неонатальные лейкоциты очищали из пуповинной крови (UCB) центрифугированием в градиенте плотности фикола-гипака (Lymphoprep, Nycomed Pharma AS, Oslo, Norway). После разделения в градиенте HSC CD34+ выделяли из собранного кольца мононуклеарных клеток UCB в результате позитивной селекции с использованием набора микрошариков CD34 и колонок для сепаратора MiniMACS (Miltenyi Biotec, Sunnyvale, CA). Чистоту клеток CD34+ (>92%) устанавливали в анализе FACS (FACSCalibur BD Bioscience, San Jose, CA) и с помощью компьютерной программы FlowJo (Tree Star, Inc., Ashland, OR), используя анти-CD34-PE-Ат (BD PharmingenTM, San Diego, CA). Клетки CD34+ предварительно стимулировали в течение 24 часов в среде Дульбекко, модифицированной по способу Искова (IMDM), с 20% сыворотки, содержащей фактор стволовых клеток человека (h-SCF) 100 нг/мл (R&D Systems, Minneapolis, MN), h-Flt3L 100 нг/мл (Peprotech, Rocky Hill, NJ), h-IL-6 20 нг/мл (R&D Systems) и тромбопоэтин человека (h-Tpo) 20 нг/мл (Peprotech), и поддерживали в такой среде во время трансдукции. Неонатальные лейкоциты стимулировали в течение 48 часов растворимым антителом против CD3 человека (30 нг/мл) (Orthoclone OKT3, Janssen-Cilag, UK) и рекомбинантным IL-2 человека (rhIL-2) 50 единиц/мл (Chiron, Emeryville, CA) в RPMI и затем хранили в RPMI с добавлением 10% FCS, PSG и rhIL-2.

Получение бакловирусов и инфекция бакуло-GPR клеток HEK293T

Бакуловирус, несущий рекомбинантный гибридный ДНК-геном бакуло-AAV-GPR, получали, следуя способу BaculoDirect, с использованием адаптированной для бакуловирусной ДНК системы Gateway® (Invitrogen, Co.). Титр рекомбинантного бакуловируса оценивали в анализе бляшек, и титр соответствовал 1×1011 БОЕ/мл после трех пассажей для амплификации вирусов в клетках Sf9. Клон PK-7 получали трансфекцией 1,5×106 клеток HEK293T с использованием 4 мкг экспрессирующей плазмиды AAV-rep78 и через 24 часа инфицировали рекомбинантным бакуло-AAV-GPR при MOI 1000. Клетки поддерживали без гигромицина в течение 4 дней и затем высевали 5×105 клеток на 22 чашки диаметром 10 см в присутствии гигромицина (100 мкг/мл) в серийно разведенных концентрациях. 22 чашки подвергали скринингу в ELISA в отношении продуцирования p24gag. Только в одной чашке, в которой высевали 3,7×104 клеток/чашку, высвобождалось достаточное количество p24gag в надосадок. Чашка содержала 40 колоний, которые все собирали и подвергали скринингу. Три из них, которые были оценены позитивно в отношении продукции p24gag, характеризовали дополнительно.

Получение и титрование лентивирусных векторов (LV)

Псевдотипированные LV, продуцируемые в клетках HEK293T, получали в результате временной котрансфекции следующих плазмид: пакующих конструкций CMV-GPR (3-го поколения) [или CMV-GPRT (2-го поколения)], конструкций оболочки VSV-G или RD114-TR и вектора переноса SIN-eGFP24 3-го поколения или вектора переноса PΔN-Chim321 2-го поколения. Соотношение конструкций пакующей:оболочки:вектора переноса составляло 6,5:3,5:10 мкг ДНК, если не указано иное. LV из клона PK-7 создавали в результате котрансфекции env-экспрессирующей плазмиды и вектора переноса. Временные трансфекции осуществляли либо стандартным основанным на Ca++-фосфате способом, либо с помощью системы FugeneTM6, следуя инструкции производителя (Roche Diagnostics Corporation, Indianapolis, IN), получая сходные результаты. Надосадки собирали через 48 часов после трансфекции и фильтровали через фильтр 0,45 мкм. Титр вычисляли на SupT1, CEM A3.01, первичных активированных мононуклеарных клетках периферической крови (PBMC) и полученных из пуповинной крови HSC CD34+ в зависимости от типа экспериментов. Коротко, SupT1 и активированные первичные мононуклеарные клетки трансдуцировали, используя два цикла спинокуляции (1,240 g в течение 1 часа) в присутствии полибрена (8 мкг/мл) (Sigma-Aldrich, St Louis, MO), разделенных фазой покоя в течение ночи; HSC CD34+ трансдуцировали в течение 24 часов на планшетах, покрытых ретронектином (Takara Bio, Otsu, Japan) без полибрена. Эффективность трансдукции контролировали на основании проточно-цитометрического анализа (FACS Calibur BD Bioscience, San Jose, CA) экспрессии eGFP (SIN-eGFP) или экспрессии ΔLNFGR (PΔN- Chim3), как описано Porcellini с соавторами, 2009 и 201021,22, используя компьютерную программу FlowJo (Tree Star, Inc., Ashland, OR). Использовали только значения трансдукции в диапазоне от 5 до 20% позитивных клеток для расчета титра каждого препарата LV согласно следующей формуле: TU = [количество клеток × (%GFP/100)]/добавленный объем (в мл).

Саузерн-блот-анализ

Геномную ДНК (гДНК) выделяли, используя набор QIAamp Mini (QIAGEN GmbH, Germany) согласно инструкциям производителя. Бакуловирусную ДНК экстрагировали из вирусных частиц, используя микронабор для получения ДНК QIAamp (QIAGEN). После расщепления в течение ночи указанными ферментами рестрикции 10 мкг гДНК разгоняли в 0,8% агарозном геле, посредством капиллярного Саузерн-блоттинга переносили на нейлоновые мембраны (Duralon, Stratagene, TX, USA) и затем гибридизовали с меченой 32P (1×106 распадов в минуту/мл) случайно праймированной либо CMV 600 п.н., либо GPR-кассетой 11 т.п.н.

Аналитический ПЦР-анализ

ПЦР-анализ для скрининга интеграции остаточной плазмиды AAV-Rep78 в клетки PK-7 осуществляли на 300 нг геномной гДНК, используя набор праймеров: AAV-Rep78 прямой: 5'-CGG GCT GCT GGC CCA CCA GG-3'; AAV-Rep78 обратный: 5'-ATG CCG GGG TTT TAC GAG ATT GTG-3' и следующие условия ПЦР: 98°C в течение 7 минут, 30 циклов 94°C в течение 30 секунд, 66°C в течение 30 секунд и 72°C в течение 1,5 минут.

Чтобы установить ориентацию двух кассет GPR, осуществляли ПЦР-амплификацию на 300 нг гДНК, используя набор праймеров: rev прямой: 5'-CTT GAG GAG GTC TTC GTC GC-3'; бета-глобин обратный: 5'-CCC TGT TAC TTC TCC CCT TCC-3'; rev прямой гнездовой: 5'-TGT CTC CGC TTC TTC CTG CC-3'; бета-глобин гнездовой обратный: 5'-TTA ACC ATA GAA AAG AAG GGG-3' и следующие условия: 94°C в течение 2 минут, 35 циклов при 94°C в течение 30 секунд, 52°C в течение 30 секунд и 72°C в течение 1,5 минут.

ELISA p24gag

Физическую продукцию LV измеряли в надосадках культуры с использованием набора для ELISA антигена p24 ВИЧ-1 Alliance (Perkin Elmer Life and Analytical Sciences, Inc. Waltham, MA), следуя инструкциям производителя, полагая, что 1 пг p24gag соответствует 1×104 физических частиц.

Вестерн-блот-анализ

Экстракты целых клеток и ядер, полученные из клеток PK-7, и вирусные белки, полученные из изолированных бесклеточных VLP или LV, готовили, как описано ранее21,22. Белки фракционировали по размеру в SDS-ПААГ и посредством электроблоттинга переносили на нитроцеллюлозные мембраны Hybond ECL (GE Healthcare, Life Sciences, UK Ltd, UK). Мембраны блокировали в 5% растворе обезжиренного сухого молока и затем инкубировали с соответствующими первыми Ат. Антисыворотку против ВИЧ, полученную от пациента со СПИДом, использовали в разведении 1:2000; моноклональные Ат против rev ВИЧ-1 (Rev-6, sc-69730 S. Cruz Biotechnology, Inc., S. Cruz, CA) в разведении 1:200. Связывание Ат визуализировали, используя систему усиленной хемилюминесценции ECL (ECL, Amersham), следуя инструкциям производителя.

Определение количества копий ДНК LV с использованием ПЦР TaqMan в реальном времени

Количество копий интегрированного вектора GPR устанавливали посредством количественной TaqMan-ПЦР, используя прибор ABI Prism 7,900 FAST (Applied Biosystems, Foster City, CA), и анализировали с использованием компьютерной программы SDS 2.3 (Applied Biosystems). Геномную ДНК (гДНК) амплифицировали с использованием следующих праймеров и зонда, полученного из гена gag: прямой: 5'-ACA TCA AGC AGC CAT GCA AAT-3'; обратный: 5'-ATC TGG CCT GGT GCA ATA GG-3'; зонд: FAM 5'-CAT CAA TGA GGA AGC TGC AGA ATG GGA TAG A-3' TAM RA. Использовали следующие условия ПЦР: 2 минуты при 50°C и 5 минут при 95°C с последующими 40 циклами 15 секунд при 95°C и 15 секунд при 60°C с повышением температуры на 0,1°C/цикл.

Опосредованная лигированием (ОЛ) ПЦР

Геномную ДНК экстрагировали из клеток PK-7, используя набор QIAamp DNA Mini (QIAGEN), согласно инструкциям производителя и расщепляли BglII и BamHI при 37°C в течение ночи. Лигирование адаптерного олигонуклеотидного линкера длиной 76 п.н., совместимого с липкими концами 5'-GATC-3', осуществляли в стандартных условиях. ОЛ-ПЦР осуществляли, используя следующую пару гнездовых праймеров: ITR прямой: 16s: 5'-GTA GCA TGG CGG GTT AAT CA-3' и 17s/длинный гнездовой: 5'-TTA ACT ACA AGG AAC CCC TAG TGA TGG-3'; обратные линкерные праймеры: линкер-1: 5'-GTA ATA CGA CTC ACT ATA GGG C-3' и линкер-2 гнездовой: 5'-AGG GCT CCG CTT AAG GGA C-3'. Линкерные последовательности соответствовали 5'-GAT CGT CCC TTA AGC GGA GCC CTA TAG TGA GTC GTA TTA CCA GGG AAT TCG CCT CGG GAT ATC ACT CAG CAT AAT G-3'. Осуществляли два раунда ОЛ-ПЦР, используя ДНК-полимеразу AmpliTaq Gold (Applied Biosystems), каждый из которых включал в себя 30 циклов (95°C в течение 30 секунд, 52°C в течение 30 секунд, 72°C в течение 2 минут). ПЦР-ампликоны клонировали, используя набор для клонирования TOPO® (Invitrogen, Co.), и колонии плазмид, несущих вставки длиной примерно 100-200 п.н., отбирали для секвенирования. Гомологию последовательностей выявляли при поиске с использованием алгоритма BLAST, NCBI.

Флуоресцентная гибридизация in situ (FISH)

Метафазные хромосомы получали обработкой клеток PK-7 колхицином (10 мкг/мл) (Sigma № C9754) в течение 2 часов при 37°C. После промывки фосфатно-солевым буфером (PBS) клетки выдерживали в гипотоническом растворе (75 мМ KCl) в течение 6 минут при комнатной температуре (КТ), фиксировали 4 промывками в метаноле/уксусной кислоте (3:1) и затем распределяли на чистом предметном стекле. Цитогенетические образцы денатурировали в 70% растворе формамида в течение 2 минут при 72°C, обезвоживали последовательными промывками холодным 70%, 85% и 95% этанолом и затем сушили на воздухе. Специфичные зонды получали следующим образом: плазмидную ДНК длиной 13 т.п.н., содержащую кассету GPR, метили, используя набор для мечения случайно праймированной ДНК (Roche Applied Science, Indianapolis, IN) SpectrumOrangeTM-dUTP (Vysis, Inc., Downers Grove, IL), тогда как контрольную космидную ДНК длиной 30 т.п.н., содержащую ген hox4 человека, метили, используя набор для мечения нуклеиновых кислот FISHSBrigtTM (Kreatech Biotechnology, Amsterdam, The Netherlands). Гибридизацию осуществляли в результате инкубации 5 нг/мкл каждого зонда в 250 мкл 50% формамида, 2×SSC и 10% сульфата декстрана и 50 нг/мкл ДНК C0T-1 человека (Invitrogen) в буфере для гибридизации. Образцы покрывали денатурированными зондами на 10 минут при 75°C, накрывали парафильмом M и инкубировали в течение ночи при 37°C во влажной камере. Образцы промывали один раз в 0,4×SSC, pH=7, при 72°C в течение 2 минут, один раз в 4×SSC, pH=7, содержащем 0,0025% Твин-20, в течение 30 секунд при комнатной температуре и два раза в PBS 1 в течение 1 минуты при комнатной температуре. Предметные стекла контрастно красили, используя 0,02 мкг/мкл 49,6-диамидино-2-фенилиндола (DAPI) (Sigma). Визуализацию и фотографические изображения получали с помощью прямого микроскопа Nikon 80i (Nikon Instruments S.p.A., Италия), используя фильтрованное освещение для зеленого (ФИТЦ) и оранжевого спектра (спектральный оранжевый). Изображения обрабатывали, используя компьютерную программу Genikon (Nikon).

Пример II: Создание первого промежуточного клона PK-7

Чтобы получить линию пакующих клеток RD-MolPack для непрерывной продукции LV либо 2-го, либо 3-го поколения, получали несколько производных от HEK293T промежуточных клонов. Первый клон был назван PK-7 и был получен в результате стабильной интеграция генов ВИЧ-1 gag, pol и rev с помощью рекомбинантного гибридного вектора бакуло-AAV (rhBaculo-AAV-GPR) (фигура 1a, схема 1). В такой системе доставки использована активность интегразы белка AAV-rep78, осуществляемой временно, чтобы вырезать и интегрировать фланкированные ITR AAV кассеты интеграции в хромосомы человека (фигура 1b). Вектор rh-baculo-AAV создавали в результате гомологичной рекомбинации между линейной ДНК BaculoDirect и исходной плазмидой Gateway® pENTRTM4, содержащей ITR-фланкированные кассеты GPR (фигура 1a, схема 1). После 3 циклов (p3) амплификации рекомбинантного бакуловируса в клетках насекомых Sf9 проверяли титр и возможные события рекомбинации гибридной ДНК бакуло-AAV в анализе бляшек и в Сайзерн-блот-анализе вирусной геномной ДНК соответственно. Титр в p3 соответствовал 6×1010 БОЕ/мл, и Саузерн-блот-анализ выявил одну отчетливую полосу, доказывающую отсутствие событий рекомбинации в ходе процесса амплификации вируса (фигура 3).

Затем тщательно определяли дозу и время трансфекции плазмидой AAV-Rep78 и инфекции rh-baculo-AAV и условия клонирования инфицированных клеток HEK293T (фигура 1c). Действительно, выяснилось, что выбор таких экспериментальных условий является важным. Таким образом, после тестирования широкого диапазона условий в конце концов было установлено, что одна доза плазмидной ДНК AAV-rep78, трансфицированной за 24 часа до инфекции rh-baculo-AAV при MOI 1000, соответствовала наилучшему дизайну эксперимента. Кроме того, обнаружено, что посев всего 5×105 клеток, которые распределяли на 22 чашках Петри диаметром 90 мм, при этом посев на каждую чашку осуществляли в разных концентрациях и добавление гигромицина в концентрации 100 мкг/мл через 4 дня после посева обеспечивал наилучшие условия для сбора наибольшего количества клонов клеток. Только три из 360 подсчитанных клонов, PK-7, PK-17 и PK-18, экспрессировали p24gag выше установленного порога 100 пг/мл. Саузерн-блот-анализ клонов показал, что каждый клон содержит две копии правильного по размеру вектора (фигура 2a). Чтобы исключить возможную интеграцию остаточной плазмидной ДНК AAV-rep78, осуществляли rep78-специфичную ПЦР на гДНК PK-7, которая не выявила позитивного сигнала (фигура 3b). Картину экспрессии белков ВИЧ-1, полученной с кассеты GPR, контролировали, используя Вестерн-блот трех клонов PK и соответствующих им вирусоподобных частиц (VLP), высвобождаемых в среду. Все вирусные белки были правильным образом процессированы, имели правильный размер и присутствовали в правильном относительном соотношении (фигура 2b). Будущий рабочий клон PK отбирали, вычисляя на клетках SupT1 эффективность LV, продуцируемых тремя клонами после котрансфекции плазмидой VSV-G и вектором переноса SIN-eGFP 3-го поколения (таблица 1). Следует отметить, что, хотя титр контрольных LV в HEK293T, полученный в результате временной трансфекции, был в 5 раз более высоким, чем в случае LV PK-7 и PK-18, их инфекционность была почти идентичной инфекционности LV PK, что свидетельствует о том, что клоны PK образуют LV, которые с точки зрения «качества» сравнимы с LV, полученными обычными способами (таблица 1). Хотя эффективность LV PK-7 и PK-18 была сходной, клон PK-7 был отобран для дальнейших генетических операций, поскольку его морфология, рост, жизнеспособность и оцененные значения продукции p24gag были лучше, чем указанные параметры в случае клона PK-18 (таблица 1).

Таблица 1
Эффективность VSV-G-псевдотипированных LV, продуцируемых клонами PK
Клоны Титр (те/мл)a
PK-7" 1,1×107
PK-17 5,4×106
PK-18 1,0×107
HEK-293T 5,8×107
p24Gag (нг/мл)
PK-7 406
PK-17 636
PK-18 326
HEK-293T 1694
Инфекционность (те/мл p24Gag)
PK-7 2,7×104
PK-17 8,4×103
PK-18 3,0×104
HEK-293T 3,4×104
a Титр вычисляли на клетках SupT1 через 3 дня после трансдукции. Клетки трансфицировали плазмидами VSV-G и SIN-eGFP.
b Жирным шрифтом указан отобранный клон.

Затем интеграцию ITR-фланкированной кассеты GPR подробно характеризовали в клоне PK-7, используя количественную ОЛ-ПЦР, ПЦР TaqMan (фигура 2c) и методику FISH (фигура 2d). Чтобы точно картировать участок интеграции, осуществляли исследования с использованием ОЛ-ПЦР, которые привлекли внимание к точке разрыва в хромосоме 2, 2q32.1 (фигура 2c). Полученный результат был подтвержден при использовании гибридизации in situ со специфичным GPR-зондом, которая выявила одно пятно на хромосоме 2 на основании длины плеча и положения центромеры (фигура 2d). Чтобы подтвердить определение такого положения, использовали зонд HOX4, который, как известно, картирован в хромосоме 2q31.2. Так как клетки HEK293T являются триплоидными, HOX4 правильным образом выявляли во всех трех хромосомах 2 (фигура 2d). Наконец, с использованием количественной TaqMan-ПЦР подтвердили, что были интегрированы две копии, и с помощью гнездовой ПЦР с праймерами соответствующего дизайна (фигура 2e) подтвердили, что две копии были в тандемной ориентации хвост-к-хвосту. Ориентация хвост-к-хвосту является природной конфигурацией, также наблюдаемой в случае интеграции AAV дикого типа и большинства конкатемеров вектора rAAV в геном клетки-хозяина16. Анализ последовательности ампликона, охватывающего соединение хвост-к-голове, выявил, что фрагмент длиной 910 п.н., содержащий 303 п.н. 3'-CMV-промотора первой кассеты вместе с обоими ITR первой и второй кассет и полным 5'-CMV-промотором второй кассеты, был утрачен (фигура 2e, красный прямоугольник). Большинство событий векторно-клеточной рекомбинации фактически происходит в последовательностях ITR вектора. Такая перегруппировка вызывала в клетках PK-7 утрату транскрипции гена gag-pol второй кассеты и вероятно утрату транскрипции генов rev и hygro первой кассеты. Однако заслуживает внимания, что область длиной 285 п.н. слева от делетированного промотора CMV (фигура 2e, серый треугольник в центре схемы) еще содержит TATA-бокс, который может быть достаточным для управления транскрипцией генов rev и hygro. В заключение необходимо отметить, что PK-7 содержит две интегрированные кассеты, которые вместе транскрибируют один ген gag-pol и один или два гена rev и hygro.

Чтобы продемонстрировать стабильность клона PK-7 в течение времени, клетки культивировали в присутствии или в отсутствие гигромицина в течение 350 дней, что соответствует примерно 420 удвоениям клеток, и измеряли продукцию p24gag в расчете на клетку (таблица 2). Средняя продукция в присутствии гигромицина соответствует 15,34±8,47 SD нг p24gag/1 ×106 клеток, тогда как в отсутствие антибиотика составляет 6,70±3,51 SD нг p24gag/1 ×106 клеток (таблица 2).

Такое различие, вероятно, возникает в связи с тем фактом, что под давлением лекарственного средства гигромицина сохраняется «включенное» состояние транскрипции гена резистентности hygro и тем самым также и хроматина. Это может благоприятствовать более высокой транскрипции генов gag-pol. Чтобы оценить, были ли VLP, образованные клоном PK-7, функциональными даже после нескольких сотен удвоений, клетки PK-7 котрансфицировали в p60 и p102 конструкцией VSV-G оболочки и вектором переноса SIN-eGFP и вычисляли эффективность LV на клетках SupT1. Удивительно, что титр и инфекционность LV, продуцируемых как в присутствии, так и в отсутствие лекарственного средства для селекции, еще сохранялись на нормальном уровне после такого продолжительного периода времени (таблица 2). Полученные данные показывают отсутствие генетической нестабильности кассеты GPR независимо от присутствия или отсутствия давления лекарственного средства и позволили авторам избежать применения гигромицина при дальнейшей характеристике. Сопоставимые данные в отношении стабильности интеграции кассеты, опосредованной ITR AAV, в литературе отсутствуют. Единственная соответствующая информация относится к тому, что полученная из костного мозга человека линия подобных фибробластам клеток (клетки Раддла Детройт 6), инфицированных AAV дикого типа серотипа 2 (AVV-2), сохраняла вирусные последовательности в латентном состоянии в течение, по меньшей мере, 47 пассажей и 118 пассажей22,23. В частности, клетки PK-7 выживали в течение по меньшей мере 102 пассажей.

Таблица 2
Стабильность клона PK-7 с течением времени
Гигромицин Без гигромицина
Пассаж p24Gag нг/106a p24Gag нг/106a
P2 10,00 8,10
P6 7,00 4,80
P10 11,40 4,00
P16 5,00 4,80
P20 9,30 5,20
P24 7,20 6,50
P28 9,20 4,40
P32 6,20 8,80
P36 11,00 9,60
P40 18,00 10,00
P44 4,30 8,40
P48 37,50 3,80
P52 7,00 3,20
P56 11,00 6,70
P60 19,00 4,40
P64 22,00 18,70
P68 15,20 8,00
P72 16,50 4,90
P76 17,80 7,60
P80 30,00 11,00
P84 27,00 8,40
P88 23,20 3,50
P92 23,00 7,50
P98 16,70 1,36
P102 19,00 3,85
среднее±SD 15,34±8,47 6,70±3,51
Титр (те/мл)b
P60 3,2×106 2,0×106
P102 2,7×106 1,3×106
p24Gag (нг/мл)b
P60 86 38
P102 80 13
Инфекционность (те/мл p24Gag)b
P60 4,2×104 5,2×104
P102 3,3×104 1,0×105
a Уровень p24Gag, выраженный в виде нг/1×106 клеток
b Значения эффективности VSV-G-псевдотипированных LV, продуцируемых после трансфекции клеток PK-7 плазмидами SIN-eGFP и VSV-G и тестированных на клетках SupT1 через 3 дня после трансдукции.

Пример III: Применение клона PK-7 для полустабильной продукции LV

Чтобы лучше выяснить, была ли полустабильная продукция LV клоном PK-7 в целом сравнима с временной продукцией LV клетками HEK293T, оба типа клеток трансфицировали одинаковым количеством необходимых плазмид и измеряли процент трансфекции и эффективность соответствующих LV на разных клетках-мишенях (таблица 3). В таких условиях средний процент трансфекции из 11 экспериментов с клетками HEK293T составил 90,54±3,6 SEM и средний процент трансфекции из 12 экспериментов с клетками PK-7 составил 91±5,3 SEM, что свидетельствует о том, что клетки PK-7 сохраняли свою способность к трансфекции на высоком уровне. Затем вычисляли титр LV в клетках SupT1, в качестве стандартного эталонного типа клеток, в полученных из пуповинной крови HSC CD34+ и активированных анти-CD3/IL-2 мононуклеарных клетках пуповинной крови (указаны как T-лимфоциты в таблице 3) (таблица 3).

Таблица 3
Эффективность VSV-G-псевдотипированных LV 3-го и 2-го поколения, продуцируемых в клоне PK-7, вычисленная для разных типов клеток-мишеней
SupT1 CD34+ T-лимфоциты
Вектор Продуцент Титр (те/мл)
SIN-eGFP PK-7a 5,7×106 2,4×104 2,3×105
HEK-293Tb 5,6×107 3,0×105 1,3×106
p24Gag (нг/мл)
PK-7 45 45 23
HEK-293T 350 350 279
Инфекционность (те/мл p24Gag)
PK-7 1,2×105 5,3×102 1,0×104
HEK-293T 1,6×104 8,6×102 4,6×103
SupT1 CD34+ CEM A3.01
PΔN-Chim3 Титр (те/мл)
PK-7a 2,2×106 1,4×104 3,7×106
HEK-293Tb 5,8×106 1,6×104 8,8×106
p24Gag (нг/мл)
PK-7 27 27 27
HEK-293T 114 114 114
Инфекционность (те/мл p24Gag)
PK-7 8,1×104 5,1×102 1,3×105
HEK-293T 5,0×104 1,4×102 7,7×104
a VSV-G-псевдотипированные LV получали после трансфекции клеток PK-7 с использованием плазмид SIN-eGFP, PΔN-Chim3 и VSV-G оболочки.
b VSV-G-псевдотипированные LV получали после трансфекции клеток HEK-293T с использованием плазмид CMV-GPR, SIN-eGFP (или PΔN-Chim3) и VSV-G оболочки.
LV тестировали на клетках-мишенях после 3-5 дней трансдукции.

Следует отметить, что инфекционность LV 3-го поколения, SIN-eGFP, образованных в клетках PK-7, была примерно на 1-log ниже и почти равной инфекционности контрольных LV, когда титр определяли на клетках SupT1 и CD34+ соответственно, тогда как она была на половину log выше на активированных T-лимфоцитах. Инфекционность LV 2-го поколения, PΔN-Chim3, образованных в клетках PK-7, была почти равной инфекционности контрольных LV, когда титр определяли либо на клетках SupT1, либо на клетках CD34+, либо на клетках CEM A3.01. Полученные данные, вместе взятые, показывают, что клон PK-7 продуцирует LV, «качественно» равные LV, продуцируемым временно котрансфицированными клетками HEK293T. Очень важная проблема, которую необходимо учитывать в случае применения PK-7 для полустабильной продукции LV, заключается в том, что клон PK-7 не теряет способности легко подвергаться трансфекции. Указанный признак довольно часто утрачивается после генетической модификации и клонирования клеток 293 с пакующей конструкцией.

Эксперименты по титрованию осуществляли для установления дозы суммарной ДНК оболочечной плазмиды и вектора переноса, которую необходимо использовать для оптимальной продукции LV в клетках PK-7. Причем было установлено, что даже менее чем одна треть от общего количества ДНК (0,3 мг) была достаточной для образования LV с титром, сравнимым с титром LV, продуцируемых в случае стандартного количества ДНК (1 мг) в линиях клеток SupT1 и CEM A3.01. Таким образом, применение PK-7 для полустабильной продукции LV вместо клеток HEK293T будет существенно снижать высокую стоимость плазмидной ДНК GMP-степени очистки.

Таблица 4
Снижение общего количества плазмидной ДНК (в небольшом масштабе)
Плазмидная ДНК 0,3 мг 0,6 мг 1 мг
SupT1 CEM A3.01 SupT1 CEM A3.01 SupT1 CEM A3.01
Титр (те/мл)а 1,2×107 4,9×106 1,1×107 3,5×106 1,0×107 4,1×106
p24Gag (нг/мл) 111 111 105 105 85 85
Инфекционность (те/мл p24Gag) 1,0×105 4,4×104 1,0×105 3,3×105 1,1×105 4,8×104
a Титр LV, полученный после трансфекции клеток PK-7 с использованием векто
ра PΔN-eGFP вектора и VSV-G оболочки.

Ссылки

1. Schambach A, Baum C. Clinical application of lentiviral vectors - concepts and practice. Curr Gene Ther. 2008;8:474-482.

2. Carroll R, Lin JT, Dacquel EJ, Mosca JD, Burke DS, St Louis DC. A human immunodeficiency virus type 1 (HIV-1)-based retroviral vector system utilizing stable HIV-1 packaging cell lines. J Virol. 1994;68:6047-6051.

3. Yu H, Rabson AB, Kaul M, Ron Y, Dougherty JP. Inducible human immunodeficiency virus type 1 packaging cell lines. J Virol. 1996;70:4530-4537.

4. Poeschla E, Corbeau P, Wong-Staal F. Development of HIV vectors for anti-HIV gene therapy. Proc Natl Acad Sci USA. 1996; 93:11395-11399.

5. Corbeau P, Kraus G, Wong-Staal F. Efficient gene transfer by a human immunodeficiency virus type 1 (HIV-1)-derived vector utilizing a stable HIV packaging cell line. Proc Natl Acad Sci USA. 1996;93:14070-14075.

6. Broussau S, Jabbour N, Lachapelle G, et al. Inducible packaging cells for large-scale production of lentiviral vectors in serum-free suspension culture. Mol Ther. 2008; 16:500-507.

7. Srinivasakumar N, Chazal N, Helga-Maria C, Prasad S, Hammarskjold ML, Rekosh D. The effect of viral regulatory protein expression on gene delivery by human immunodeficiency virus type 1 vectors produced in stable packaging cell lines. J Virol. 1997;71:5841-5848.

8. Kaul M, Yu H, Ron Y, Dougherty JP. Regulated lentiviral packaging cell line devoid of most viral cis-acting sequences. Virology. 1998;249:167-174.

9. Cockrell AS, Ma H, Fu K, McCown TJ, Kafri T. A trans-lentiviral packaging cell line for high-titer conditional self-inactivating HIV-1 vectors. Mol Ther. 2006;14:276-284.

10. Bestor TH. Gene silencing as a threat to the success of gene therapy. J Clin Invest. 2000;105:409-411.

11. Ikeda Y, Takeuchi Y, Martin F, Cosset FL, Mitrophanous K, Collins M. Continuous high-titer HIV-1 vector production. Nat Biotechnol. 2003;21:569-572.

12. Throm RE, Ouma AA, Zhou S, et al. Efficient construction of producer cell lines for a SIN lentiviral vector for SCID-X1 gene therapy by concatemeric array transfection. Blood. 2009;113:5104-5110.

13. Palombo F, Monciotti A, Recchia A, Cortese R, Ciliberto G, La Monica N. Site-specific integration in mammalian cells mediated by a new hybrid baculovirus-adeno-associated virus vector. J Virol. 1998;72:5025- 5034.

14. Smith RH. Adeno-associated virus integration: virus versus vector. Gene Ther. 2008;15:817-822.

15. Berns Kl, Kort J, Fife KH, Grogan EW, Spear I. Study of the fine structure of adeno-associated virus DNA with bacterial restriction endonucleases. J Virol. 1975;16:712-719.

16. Cheung AK, Hoggan MD, Hauswirth WW, Berns Kl. Integration of the adeno-associated virus genome into cellular DNA in latently infected human Detroit 6 cells. J Virol. 1980;33:739-748.

17. Samulski RJ, Chang LS, Shenk T. A recombinant plasmid from which an infectious adeno-associated virus genome can be excised in vitro and its use to study viral replication. J Virol. 1987;61:3096-3101.

18. Recchia A, Perani L, Sartori D, Olgiati C, Mavilio F. Site-specific integration of functional transgenes into the human genome by adeno/AAV hybrid vectors. Mol Ther. 2004;10:660-670.

19. Zufferey R, Nagy D, Mandel RJ, Naldini L, Trono D. Multiply attenuated lentiviral vector achieves efficient gene delivery in vivo. Nat Biotechnol. 1997;15:871-875.

20. Follenzi A, Ailles LE, Bakovic S, Geuna M, Naldini L. Gene transfer by lentiviral vectors is limited by nuclear translocation and rescued by HIV-1 pol sequences. Nat Genet. 2000;25:217-222.

21. Porcellini S, Alberici L, Gubinelli F, et al. The F12-Vif derivative Chim3 inhibits HIV-1 replication in CD4+ T lymphocytes and CD34+-derived macrophages by blocking HIV-1 DNA integration. Blood. 2009;113:3443- 3452.

22. Porcellini S, Gubinelli F, Alberici L, Piovani BM, Rizzardi GP, Bovolenta C. Chim3 confers survival advantage to CD4+ T cells upon HIV-1 infection by preventing HIV-1 DNA integration and HIV-1-induced G2 cell-cycle delay. Blood. 2010;115:4021-4029.

23. Sandrin V, Boson B, Salmon P, et al. Lentiviral vectors pseudotyped with a modified RD114 envelope glycoprotein show increased stability in sera and augmented transduction of primary lymphocytes and CD34+ cells derived from human and nonhuman primates. Blood. 2002; 100:823-832.

24. Di Nunzio F, Piovani B, Cosset FL, Mavilio F, Stornaiuolo A. Transduction of human hematopoietic stem cells by lentiviral vectors pseudotyped with the RD114-TR chimeric envelope glycoprotein. Hum Gene Ther. 2007; 18:811-820.

25. Dull, T., Zufferey, R., Kelly, M., Mandel, R. J., Nguyen, M., Trono, D., Naldini, L. A third-generation lentivirus vector with a conditional packaging system. J Virol, 1998; 72: 8463-71.

1. Система стабильной экспрессии лентивирусных структурных и регуляторных белков, состоящая из:
i) гибридного вектора, содержащего бакуловирусный остов, содержащий кассету интеграции, фланкированную ITR AAV, включающую в себя две кассеты экспрессии, при этом первая кассета экспрессии кодирует лентивирусные гены gag и pol, а вторая кассета экспрессии кодирует лентивирусный rev и селектируемый маркер; и
ii) экспрессирующей плазмиды, содержащей открытую рамку считывания (ORF) Rep AAV под контролем промотора.

2. Система по п. 1, в которой две кассеты экспрессии гибридного вектора находятся в ориентации хвост-к-хвосту и каждая кассета экспрессии управляется конститутивным промотором и поли-A.

3. Система по п. 1 или 2, в которой промотор выбран из CMV, CMV IE, PGK, SV40, eF1α, SFFV и RSV.

4. Система по п. 3, в которой промотором является промотор CMV IE.

5. Система по любому из пп. 1, 2 или 4, в которой селектируемый маркер выбран из гена резистентности к гигромицину, канамицину, неомицину, зеомицину.

6. Система по п. 5, в которой селектируемым маркером является ген резистентности к гигромицину.

7. Система по любому из пп. 1, 2, 4 или 6, в которой селектируемый маркер клонирован ниже участка внутренней посадки рибосомы (IRES).

8. Система по пп. 1, 2, 4 или 6, в которой белком rep является белок rep78.

9. Полустабильная линия клеток, пакующих лентивирусы, состоящая из клеток, стабильно экспрессирующих лентивирусные gag pol и rev, отличающаяся тем, что такие клетки содержат стабильно интегрированную в их геном по меньшей мере одну копию кассеты интеграции, фланкированную ITR AAV, включающую в себя две кассеты экспрессии, при этом первая кассета экспрессии кодирует лентивирусные гены gag и pol, а вторая кассета экспрессии кодирует лентивирусный rev и селектируемый маркер.

10. Полустабильная линия клеток, пакующих лентивирусы, по п. 9, в которой клеткой является линия клеток человека, выбранная из HEK293, HEK293-T, HEK293-SF, TE671, HT1080 или HeLa.

11. Полустабильная линия клеток, пакующих лентивирусы, по любому из пп. 9 или 10, в которой две кассеты экспрессии находятся в ориентации хвост-к-хвосту и каждая кассета экспрессии управляется конститутивным промотором и поли-A.

12. Полустабильная линия пакующих клеток по п. 11, в которой промотор выбран из CMV, CMV IE, PGK, SV40, eF1α, SFFV и RSV.

13. Полустабильная линия пакующих клеток по п. 12, в которой промотором является промотор CMV IE.

14. Полустабильная линия пакующих клеток по любому из пп. 9, 10, 12 или 13, в которой селектируемый маркер выбран из гена резистентности к гигромицину, канамицину, неомицину, зеомицину.

15. Полустабильная линия пакующих клеток по п. 14, в которой селектируемым маркером является ген резистентности к гигромицину.

16. Полустабильная линия пакующих клеток по любому из пп. 9, 10, 12, 13 или 15, в которой селектируемый маркер клонирован ниже участка внутренней посадки рибосомы (IRES).

17. Способ получения лентивирусных векторов, включающий в себя:
i) культивирование полустабильной линия пакующих клеток по любому из пп. 9-16;
ii) встраивание в полустабильную линию пакующих клеток гена env;
iii) встраивание в полустабильную линию пакующих клеток вектора переноса.

18. Способ по п. 17, в котором ген env выбран из env VSV-G, env MLV 4070, env RD114, химерного белка оболочки RD114-TR, химерного белка оболочки RD114-pro, бакуловирусного env GP64 или env GALV или их производных.

19. Способ по п. 17 или 18, в котором геном env является ген, кодирующий химерный белок оболочки RD114-TR.



 

Похожие патенты:

Изобретения касаются способов получения стабильной линии пакующих лентивирусы клеток (варианты), стабильной линии пакующих лентивирусы клеток, способа получения лентивирусных векторов, линии клеток-продуцентов и способа производства лентивирусных векторов.

Предложены рекомбинантный аденовирус, фармацевтическая композиция, содержащая такой вирус, и способ лечения рака с использованием такого вируса или композиции. Охарактеризованный рекомбинантный аденовирус содержит полинуклеотид, кодирующий комплекс рибозима, опосредующего транс-сплайсинг, и HSVtk (тимидинкиназы вируса простого герпеса человека), где рибозим, опосредующий транс-сплайсинг, представляет собой рибозим Rib67, и где мишенью рибозима, опосредующего транс-сплайсинг, является мРНК гена рак-специфичной TERT (обратной транскриптазы теломеразы) и противораковый терапевтический ген, кодирующий sPD-1 (растворимый белок программируемой гибели 1).

Изобретение относится к биотехнологии. Предложены дефектный по репликации доминантно-негативный рекомбинантный вирус простого герпеса 2, вакцина и способ иммунизации пациента против инфекции HSV-1 или HSV-2.

Изобретение относится к области ветеринарной вирусологии и генной инженерии. Предложен рекомбинантный штамм вируса африканской чумы свиней с заменой генов EP153R и EP402R, содержащий репортерный ген EGFP, кодирующий зеленый флюоресцентный белок.

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. Описан вирусный самоинактивирующийся (SIN) вектор на основе вируса саркомы и лейкоза птиц (ASLV) и расщепляющая-пакующая система.

Изобретение относится к области биотехнологии и касается рекомбинантного штамма вируса осповакцины. Охарактеризованный штамм сконструирован на основе штамма Л-ИВП вируса осповакцины и содержит встройку гена гранулоцитарно-макрофагального колониестимулирующего фактора (ГМ-КСФ) человека, структура которого соответствует кДНК матричной РНК ГМ-КСФ человека, представленной в GenBank под номером Ml 1220.1.

Настоящее изобретение относится к области молекулярной иммунологии, биотехнологии и медицины. Создана рекомбинантная псевдоаденовирусная частица, на основе генома аденовируса человека 5 серотипа, содержащая экспрессирующую кассету со вставкой гена модифицированного химерного наноантитела, связывающегося с микоплазмой M.

Изобретение относится к области биотехнологии и вирусологии. Предложен новый рекомбинантный полипептид вируса гриппа, представляющий собой гемагглютинин.

Изобретение относится к области биотехнологии, вирусологии и медицины. Предложен способ лечения пролиферативных заболеваний или заболеваний с повышенной активностью остеокластов.

Изобретение относится к биотехнологии и фундаментальной вирусологии. Предложен способ получения препаративных количеств вирусных частиц, имитирующих вирионы вируса скручивания листьев картофеля (ВСЛК).

Изобретения касаются способов получения стабильной линии пакующих лентивирусы клеток (варианты), стабильной линии пакующих лентивирусы клеток, способа получения лентивирусных векторов, линии клеток-продуцентов и способа производства лентивирусных векторов.

Настоящее изобретение относится к области иммунологии. Предложено моноклональное антитело и его антигенсвязывающий фрагмент, обладающие способностью специфически связываться с IL-17А человека и охарактеризованные последовательностями CDR.

Настоящее изобретение относится к области биотехнологии и может быть использовано для рекомбинантной экспрессии иммуномодуляторных белков. Конструируют вектор, содержащий полинуклеотид, кодирующий генный переключатель, при этом указанный полинуклеотид содержит (1) по меньшей мере одну последовательность фактора транскрипции, которая функционально связана с промотором, при этом указанная по меньшей мере одна последовательность фактора транскрипции кодирует лиганд-зависимый фактор транскрипции, и (2) полинуклеотид, кодирующий полипептид IL-12 и один или более иммуномодуляторных полипептидов, выбранных из IL-2, IL-7, IL-15, IL-18, IL-21, GM-CSF, CCL3 (MIP-1a), CCL5 (RANTES), CCL7 (MCP3), XCL1 (лимфотактин), CCL19 (MIP-3b), CXCL9 (MIG), CXCL10 (IP-10), CXCL12 (SDF-1), CCL21 (6Ckine) или TNF-альфа.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Предложенное изобретение относится к области иммунологии. Предложено антитело против CXCR4 человека или его функциональный фрагмент, которые характенизуются тем, что содержат легкую и тяжелую цепи, содержащие по 3 соответствующих CDR.

Изобретение относится к области биотехнологии, конкретно к химерным полипептидам фактора роста фибробластов (FGF), и может быть использовано в медицине для лечения ожирения, диабета, высокого содержания глюкозы в крови, метаболического синдрома и гиперхолестеринемии.

Настоящее изобретение относится к области иммунологии и биотехнологии. Предложена нуклеиновая кислота, кодирующая биспецифическое одноцепочечное антитело, направленное против CD3 и CEA человека.

Изобретение относится к биотехнологии и иммунологии. Предложены варианты выделенного антитела или его фрагмента, которые специфично связываются с внеклеточным доменом CXCR5 человека.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антигенсвязывающий фрагмент, способные связываться с дельта-подобным лигандом 4 (DLL4) человека, в том числе в форме меченого антитела или его антигенсвязывающего фрагмента, конструкции с константным доменом иммуноглобулина, конъюгата с терапевтическим или цитотоксическим средством и в кристаллизованной форме.

Изобретение относится к биотехнологии. Предложены: клещевой аллерген домашней пыли, представляющий собой полипептид, содержащий определенную аминокислотную последовательность, приведенную в описании в перечне списка последовательностей; кодирующая полипептид молекула ДНК; экспрессирующий вектор на её основе и трансформированная им рекомбинантная клетка для экспрессии полипептида.

Изобретения касаются способов получения стабильной линии пакующих лентивирусы клеток (варианты), стабильной линии пакующих лентивирусы клеток, способа получения лентивирусных векторов, линии клеток-продуцентов и способа производства лентивирусных векторов.
Наверх