Модифицированные пептиды melk и содержащие их вакцины



Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины
Модифицированные пептиды melk и содержащие их вакцины

 


Владельцы патента RU 2580035:

ОНКОТЕРАПИ САЙЕНС, ИНК. (JP)

Изобретение относится к области биотехнологии, конкретно к иммуногенным эпитопам MELK, и может быть использовано в медицине для лечения пациента, страдающего раком или эндометриозом. Получают модифицированные эпитопные пептиды MELK, которые связываются с HLA-A*2402 и обладают более высокой способностью индуцирования цитотоксических T-лимфоцитов (ЦТЛ), чем у эпитопного пептида MELK дикого типа. 12 н.п. ф-лы, 10 ил., 2 табл., 15 пр.

 

Область техники

[0001] Настоящее изобретение относится к области биологической науки, более конкретно, к области противораковой терапии. Конкретно, настоящее изобретение относится к новым пептидам, которые чрезвычайно эффективны в качестве противораковых вакцин, а также в качестве лекарственных средств для лечения и предотвращения опухолей (или заболеваний, связанных со сверхэкспрессией MELK).

Приоритет

Это заявка заявляет интересы предварительной заявки США № 61/297996 от 25.01.2010, содержание которой включено в данный документ ссылкой в полном объеме и для всех целей.

Уровень техники

[0002] Было продемонстрировано, что CD8-положительные цитотоксические Т-лимфоциты (ЦТЛ) распознают эпитопные пептиды, произошедшие из опухолеспецифических антигенов (TAA), обнаруженных на молекуле главного комплекса гистосовместимости (MHC) класса I, и затем убивают опухолевые клетки. После открытия семейства меланомных антигенов (MAGE) в качестве первого примера TAA, многие другие TAA были открыты посредством иммунологических методов (НПЛ 1, 2). Некоторые из этих TAA в настоящее время подвергаются клинической разработке в качестве иммунотерапевтических мишеней.

[0003] Предпочтительные TAA необходимы для пролиферации и жизнеспособности раковых клеток. Применение таких TAA в качестве мишеней для иммунотерапии может минимизировать хорошо описанный риск избегания раковыми клетками иммунного ответа, вызванного делецией, мутацией или отрицательной регуляцией TAA как следствия получаемой терапевтическими методами иммунной селекции. Соответственно, идентификация новых TAA, способных индуцировать мощный и специфичный противоопухолевый иммунный ответ, обеспечивает продолжение дальнейших разработок и клинических исследований стратегии пептидной вакцинации для различных типов рака (НПЛ 3-10). К настоящему времени, существует несколько сообщений о клинических испытаниях с использованием этих пептидов, произошедших из TAA (НПЛ 11-13). Хотя в этой области наблюдается некоторый успех, при этом сохраняется необходимость создания новых TAA в качестве иммунотерапевтических мишеней.

[0004] MELK, материнская эмбриональная киназа с доменом "лейциновая застежка", ранее была идентифицирована в качестве нового члена семейства серин-треониновых киназ snf1/AMPK, которые вовлечены в эмбриональное развитие млекопитающих (НПЛ 14). Было продемонстрировано, что этот ген играет важную роль в процессе возобновления стволовых клеток (НПЛ 15), в развитии клеточного цикла (НПЛ 16, 17) и в сплайсинге мРНК-предшественника (НПЛ 18). В этой связи с помощью профиля генной экспрессии с использованием полномасштабного геномного кДНК-микроэррея, содержащего 23040 генов, авторы настоящего изобретения идентифицировали MELK, который положительно регулируется при раке груди (НПЛ 19).

[0005] MELK положительно регулируется в некоторых раковых клетках, например, в раковых клетках легкого, мочевого пузыря, лимфомы и шейки матки. Нозерн-блот анализ множества человеческих тканей и раковых клеточных линий продемонстрировал, что MELK сверхэкспрессируется на значительно высоком уровне в огромном большинстве случаев рака груди и в клеточных линиях рака груди, но при этом не экспрессируется в нормальных жизненно важных органах, таких как сердце, печень, легкое и почки. Кроме того, что особенно важно, было продемонстрировано, что супрессия экспрессии MELK с помощью киРНК (siRNA) приводит в результате к росту клеток рака груди человека.

Опубликовано множество исследований на тему модификации аминокислотных остатков пептидов, которые являются критическими для взаимодействия с MHC или с Т-клеточным рецептором, для повышения иммуногенности пептидов (НПЛ 20, 21).

Список процитированной литературы

Документы патентной литературы

[0006] [ПТЛ 1] WO2005/073374

Непатентная литература

[0007] [НПЛ 1] Boon T, Int J Cancer 1993 May 8, 54(2): 177-80

[НПЛ 2] Boon T & van der Bruggen P, J Exp Med 1996 Mar 1, 183(3): 725-9

[НПЛ 3] Harris CC, J Natl Cancer Inst 1996 Oct 16, 88(20): 1442-55

[НПЛ 4] Butterfield LH et al., Cancer Res 1999, 59(13): 3134-42

[НПЛ 5] Vissers JL et al., Cancer Res 1999 Nov 1, 59(21): 5554-9

[НПЛ 6] van der Burg SH et al., J Immunol 1996 May 1, 156(9): 3308-14

[НПЛ 7] Tanaka F et al., Cancer Res 1997 Oct 15, 57(20): 4465-8

[НПЛ 8] Fujie T et al., Int J Cancer 1999 Jan 18, 80(2): 169-72

[НПЛ 9] Kikuchi M et al., Int J Cancer 1999 May 5, 81(3): 459-66

[НПЛ 10] Oiso M et al., Int J Cancer 1999 May 5, 81(3): 387-94

[НПЛ 11] Belli F et al., J Clin Oncol 2002 Oct 15, 20(20): 4169-80

[НПЛ 12] Coulie PG et al., Immunol Rev 2002 Oct, 188: 33-42

[НПЛ 13] Rosenberg SA et al., Nat Med 2004 Sep, 10(9): 909-15

[НПЛ 14] Heyer BS et al., Dev Dyn. 1999 Aug 215(4):344-51

[НПЛ 15] Nakano I et al., J Cell Biol. 2005 Aug 1, 170(3):413-27)

[НПЛ 16] Blot J et al., Dev Biol. 2002 Jan 15, 241(2):327-38

[НПЛ 17] Seong HA et al., Biochem J. 2002 Feb 1, 361(Pt 3):597-604

[НПЛ 18] Vulsteke V et al., J Biol Chem. 2004 Mar 5, 279(10):8642-7. Epub 2003 Dec 29

[НПЛ 19] Lin ML et al., Breast Cancer Res. 2007; 9 (1):R17

[НПЛ 20] Valmori D, et al., J Immunol. 1998 Feb 15;160(4):1750-8

[НПЛ 21] Salazar E, et al., Int J Cancer. 2000 Mar 15;85(6):829-38

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

[0008] Настоящее изобретение частично основано на открытии новых пептидов, которые могут служить в качестве подходящих мишеней иммунотерапии. Так как TAA, как правило, воспринимаются иммунной системой как "свои", и поэтому часто они не обладают иммуногенностью, поэтому открытие соответствующих мишеней имеет чрезвычайную важность. Осознавая, что MELK (как описано, например, в SEQ ID NO: 47, (кодируемый с помощью гена с регистрационным номером GenBank No.NM_014791 (SEQ ID NO: 46)) был идентифицирован по его положительной регуляции в тканях эндометриоза и в тканях рака, включающих, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, хронический миелоидный лейкоз (CML), колоректальный рак, рак пищевода, рак желудка, рак печени, немелкоклеточный рак легкого (NSCLC), лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и мелкоклеточный рак легкого (SCLC) (WO2010/013485), настоящее изобретение фокусируется на MELK в качестве мишени противораковой иммунотерапии.

[0009] Для этой цели, настоящее изобретение направлено, по меньшей мере, частично на идентификацию специфических модифицированных эпитопных пептидов MELK, которые обладают способностью индуцировать цитотоксические T-лимфоциты (ЦТЛ), специфичные к MELK. Как обсуждается подробно ниже, мононуклеары периферической крови (PBMC), полученные от здоровых доноров, стимулировали с помощью пептидов-кандидатов, связывающих A*2402, и произошедших из эпитопного пептида MELK, т.e. из пептида дикого типа MELK-A24-9-87_WT (SEQ ID NO: 6). Затем создавали клеточные линии ЦТЛ со специфической цитотоксичностью против положительных по HLA-A24 клеток-мишеней, стимулированные с помощью каждого из пептидов-кандидатов. Все вместе эти результаты демонстрируют, что эти пептиды представляют собой рестриктированные по HLA-A24 эпитопные пептиды, которые могут индуцировать мощный и специфичный иммунный ответ против клеток, экспрессирующих MELK. Результаты дополнительно демонстрируют, что MELK является чрезвычайно иммуногенным, и что его эпитопы представляют собой эффективные мишени для противоопухолевой иммунотерапии.

[0010] Соответственно, целью настоящего изобретения является предложение выделенных пептидов модифицированного эпитопного пепида, полученного из MELK (SEQ ID NO: 47), специфически модифицированного эпитопного пептида для MELK-A24-9-87_WT дикого типа (SEQ ID NO: 6), или их иммунологически активных фрагментов, которые связываются с HLA-антигенами. Пептиды по настоящему изобретению обладают способностью индуцирования ЦТЛ. Такие пептиды могут использоваться для индуцирования CTL ex vivo или могут вводиться субъекту для индуцирования иммунного ответа против эндометриоза и раковых заболеваний, примеры которых включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC. Предпочтительные пептиды представляют собой нонапептиды и, как правило, состоят из аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO: 35-45. Из них пептиды, содержащие аминокислотную последовательность, выбранную из SEQ ID NO: 35, 41 и 44, демонстрировали особенно сильную способность индуцирования ЦТЛ, и, таким образом, они конкретно применяются по настоящему изобретению.

Настоящее изобретение также охватывает модифицированные пептиды, имеющие аминокислотные последовательности SEQ ID NO: 35-45, где одна, две или более аминокислот заменены, делетированы или добавлены при условии, что модифицированные пептиды сохраняют необходимую исходную способность исходного пептида индуцировать ЦТЛ.

[0011] Кроме того, в настоящем изобретении предлагаются выделенные полинуклеотиды, кодирующие любые из пептидов по настоящему изобретению. Эти полинуклеотиды могут использоваться для индуцирования антиген-экспрессирующих клеток (АПК) со способностью индуцирования ЦТЛ подобно пептидам по настоящему изобретению, или могут вводиться субъекту для индуцирования иммунного ответа против раковых заболеваний.

При введении субъекту, пептиды по настоящему изобретению презентируются на поверхности АПК так, чтобы индуцировать ЦТЛ, нацеленные на соответствующие пептиды. Таким образом, целью настоящего изобретения является предложение веществ, которые индуцируют ЦТЛ, причем такие вещества включают один или более пептидов по настоящему изобретению или полинуклеотиды, кодирующие такие пептиды. В настоящем изобретении дополнительно предлагаются фармацевтические агенты, включающие один или более пептидов по настоящему изобретению, или включающие полинуклеотиды, кодирующие такие пептиды, такие агенты применяются для лечения и/или профилактики эндометриоза и раковых заболеваний, примеры которых включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC. Таким образом, еще одной целью настоящего изобретения является предложение фармацевтической композиции, составленной для лечения и/или предотвращения эндометриоза или рака, и/или для предотвращения его послеоперационного рецидива, и включающих любые из пептидов или полинуклеотидов по настоящему изобретению. Вместо них или дополнительно к пептидам или полинуклеотидам по настоящему изобретению вещества или лекарственные средства по настоящему изобретению необязательно могут включать в качестве активного ингредиента АПК или экзосомы, которые презентируют любые из пептидов по настоящему изобретению.

[0012] Пептиды и полинуклеотиды по настоящему изобретению могут использоваться для индуцирования АПК, которые презентируют на своей поверхности комплекс HLA-антигена и пептида по настоящему изобретению, например, путем приведения АПК, полученных из субъекта, в контакт с пептидом по настоящему изобретению, или путем введения полинуклеотида, кодирующего пептид по настоящему изобретению, в АПК. Такие АПК обладают высокой способностью индуцирования ЦТЛ против пептидов-мишеней и, таким образом, применяются для противораковой иммунотерапии. Соответственно, другой целью настоящего изобретения является предложение способов индуцирования АПК со способностью индуцирования ЦТЛ, а также АПК, полученных такими способами.

[0013] Следующей целью настоящего изобретения является предложение способов индуцирования ЦТЛ, которые включает стадию совместного культивирования CD8-положительных клеток с АПК или экзосомами, презентирующими пептид по настоящему изобретению на своей поверхности, или которые включают стадию введения гена, который включает полинуклеотид, кодирующий субъединицу T-клеточного рецептора (TCR), связывающуюся с пептидом по настоящему изобретению. ЦТЛ, получаемые с помощью способов по настоящему изобретению, также находят применение в лечении и/или предотвращении заболеваний, при которых сверхэкспрессируется MELK, таких как, в частности, эндометриоз, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфома, остеосаркома, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC. Таким образом, другой целью настоящего изобретения является предложение ЦТЛ, полученных способами по настоящему изобретению.

[0014] Кроме того, следующей целью настоящего изобретения является предложение способов индуцирования иммунного ответа против рака у нуждающегося в этом субъекта, причем такие способы включают стадию введения субъекту вещества или композиций, содержащих модифицированный MELK или его иммунологически активные фрагменты, полинуклеотиды, кодирующие модифицированный MELK или его фрагменты, и экзосомы или АПК, презентирующие модифицированный MELK или его фрагменты.

Применимость настоящего изобретения охватывает любое из ряда заболеваний, связанных со сверхэкспрессией MELK или произошедших в результате нее, включающих эндометриоз и раковые заболевания, примеры которых включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC.

[0015] Более конкретно, в настоящем изобретении предлагается следующее:

[1] Выделенный пептид, связывающийся с HLA-антигеном или обладающий способностью индуцирования циотоксических T-лимфоцитов (ЦТЛ), где пептид состоит из аминокислотной последовательности SEQ ID NO: 6 или состоит из аминокислотной последовательности, включающей одну или более аминокислотных замен в аминокислотной последовательности SEQ ID NO: 6.

[2] Выделенный пептид [1], где HLA-антиген представляет собой HLA-A24.

[3] Выделенный пептид [1], где полипептид включает одну или более аминокислотных замен в положениях, выбранных из группы, состоящей из (a)-(d), в аминокислотной последовательности SEQ ID NO: 6:

(a) N-концевая аминокислота,

(b) третья аминокислота с N-конца,

(c) третья аминокислота с C-конца и

(d) C-концевая аминокислота.

[4] Выделенный пептид [3], где полипептид включает одну или несколько аминокислотных замен, выбранных из группы, состоящей из (i)-(iv):

(i) аминокислотная замена E на K или R в N-концевом положении аминокислотной последовательности SEQ ID NO: 6,

(ii) аминокислотная замена C на E, I, L, M, N или P в третьем положении с N-конца аминокислотной последовательности SEQ ID NO: 6,

(iii) аминокислотная замена E на N или Q в третьем положении с С-конца аминокислотной последовательности SEQ ID NO: 6, и

(iv) аминокислотная замена F на L в C-концевом положении аминокислотной последовательности SEQ ID NO: 6.

[5] Выделенный пептид [4], где пептид включает единственную аминокислотную замену.

[6] Выделенный пептид [4], где пептид включает две аминокислотные замены.

[7] Выделенный пептид [4], где пептид включает три аминокислотные замены.

[8] Выделенный пептид [4], где пептид включает четыре аминокислотных замены.

[9] Выделенный пептид [4]-[5], который включает аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 35-45.

[10] Выделенный пептид, связывающийся с HLA-антигеном и обладающий способностью индуцирования цитотоксических T-лимфоцитов (ЦТЛ), где указанный пептид состоит из аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO: 35-45, где 1, 2 или более аминокислот вставлены, заменены, делетированы или добавлены.

[11] Пептид [10], обладающий одной или двумя из следующих характеристик:

(a) вторая аминокислота от N-конца выбрана из группы, состоящей из фенилаланина, тирозина, метионина и триптофана; и

(b) C-концевая аминокислота выбрана из группы, состоящей из фенилаланина, лейцина, изолейцина, триптофана и метионина.

[12] Выделенный полинуклеотид, кодирующий пептид по любому из [1]-[11].

[13] Вещество для индуцирования ЦТЛ, где вещество включает один или более пептидов по любому из [1]-[11], или один или более полинуклеотидов [12].

[14] Фармацевтическая композиция для лечения и/или профилактики раковых заболеваний или эндометриоза, и/или для предотвращения их послеоперационных рецидивов, где композиция включает один или более пептидов по любому из [1]-[11], или один или более полинуклеотидов [12].

[15] Фармацевтическая композиция [14], где указанную композицию составляют для введения субъекту, чей HLA-антиген представляет собой HLA-A24.

[16] Фармацевтическая композиция [14] или [15], где указанную композицию составляют для лечения рака или эндометриоза.

[17] Способ индуцирования антиген-презентирующей клетки (АПК) со способностью индуцирования ЦТЛ, где способ включает одну из следующих стадий:

(a) приведения АПК в контакт с пептидом по любому из [1]-[11] in vitro, ex vivo или in vivo; и

(b) введение в АПК полинуклеотида, кодирующего пептид по любому из [1]-[9].

[18] Способ индуцирования ЦТЛ с помощью любого из способов, включающих, по меньшей мере, одну из следующих стадий:

(a) совместное культивирование CD8-положительных T-клеток с АПК, которые презентируют на своей поверхности комплекс HLA-антигена и пептида по любому из [1]-[11];

(b) совместное культивирование CD8-положительных T-клеток с экзосомами, которые презентируют на своей поверхности комплекс HLA-антигена и пептида по любому из [1]-[11]; и

(c) введение в Т-клетку гена, который включает полинуклеотид, кодирующий полипептид субъединицы T-клеточного рецептора (TCR), связывающегося с пептидом по любому из [1]-[9].

[19] Выделенная АПК, которая презентирует на своей поверхности комплекс HLA-антигена и пептида по любому из [1]-[11].

[20] АПК [19], где указанную АПК индуцируют с помощью способа [17].

[21] Выделенный ЦТЛ, мишенью которого является пептид по любому из [1]-[11].

[22] ЦТЛ [21], который индуцируют с помощью способа по [18], и

[23] Способ индуцирования у субъекта иммунного ответа против рака или эндометриоза, включающий введение субъекту композиции, включающей пептид по любому из [1]-[11], его иммунологически активный фрагмент или полинуклеотид, кодирующий пептид или его фрагмент.

[0016] Следует понимать, что и вышеописанная сущность изобретения и последующее подробное описание представляют собой типичные воплощения, и не ограничивают изобретения или других альтернативных воплощений изобретения.

Дополнительно к вышеописанным другие цели и признаки изобретения станут более очевидны после рассмотрения следующего подробного описания совместно с приложенными чертежами и примерами. Однако следует понимать, что и вышеописанная сущность изобретения и последующее подробное описание представляют собой типичные воплощения, и не ограничивают изобретения или других альтернативных воплощений изобретения. Конкретно, в то время как изобретение описывается в данном документе со ссылкой на ряд определенных воплощений, понятно, что описание является иллюстрацией изобретения и не рассматривается как ограничение изобретения. Разнообразные модификации и применения могут осуществляться специалистами в данной области, не выходя за рамки сущности и смысла изобретения, описанного в прилагаемой формуле изобретения. Аналогично, другие цели, признаки, приоритеты и преимущества настоящего изобретения будут очевидны из данной сущности изобретения и из конкретных воплощений, описанных ниже, и будут полностью понятны специалистам в данной области. Такие цели, признаки, приоритеты и преимущества будут очевидны из вышеописанного вместе с приложенными примерами, данными, чертежами и со всеми обоснованными выводами, которые могут быть из них сделаны, при индивидуальном рассмотрении или при рассмотрении совместно со ссылками, включенными в данный документ.

Краткое описание чертежей

[0017] Различные аспекты и применения настоящего изобретения будут очевидны специалисту в данной области при рассмотрении краткого описания чертежей и подробного описания настоящего изобретения и его предпочтительных воплощений, которые приведены далее.

[0018] [Фиг.1] На Фиг.1 изображены фотографии, демонстрирующие результаты анализов иммуноферментных пятен (ELISPOT) для IFN-гамма на ЦТЛ донора А, индуцированных с помощью пептидов, полученных из MELK. ЦТЛ, стимулированные с помощью MELK-A24-9-87 (SEQ ID NO: 6) (a) MELK-A24-10-637 (SEQ ID NO: 23) (b) MELK-A24-9-199 (SEQ ID NO: 1) (d) и MELK-A24-9-78 (SEQ ID NO: 21) (e), демонстрировали потенциальную способность продуцирования IFN-гамма. Напротив, в качестве типичных отрицательных данных, было продемонстрировано отсутствие специфичного продуцирования IFN-гамма из ЦТЛ, стимулированных с помощью MELK-A24-9-96 (SEQ ID NO: 2) (c). На чертежах "+" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью родственного пептида, и "-" обозначает продуцирование IFN-гамма против клеток-мишеней, не стимулированных с помощью каких-либо пептидов.

[0019] [Фиг.2] На Фиг.2 изображены линейные графики, демонстрирующие результат получения клеточных линий ЦТЛ. Мощное продуцирование IFN-гамма детектировали с помощью анализа ELISA для IFN-гамма из линий ЦТЛ, стимулированных с помощью MELK-A24-9-87 (SEQ ID NO: 6) (a), MELK-A24-10-637 (SEQ ID NO: 23) (b) и MELK-A24-9-199 (SEQ ID NO: 1) (c). На чертежах "черный ромб" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью родственных пептидов, и "белый квадрат" обозначает продуцирование IFN-гамма против клеток-мишеней, не стимулированных с помощью каких-либо пептидов.

[0020] [Фиг.3] На Фиг.3 изображен линейный график, демонстрирующий результат получения клона ЦТЛ. Мощное продуцирование IFN-гамма детектировали с помощью анализа ELISA для IFN-гамма из клона ЦТЛ, стимулированного с помощью MELK-A24-9-87 (SEQ ID NO: 6) (a) и MELK-A24-9-199 (SEQ ID NO: 1) (b). На чертежах "черный ромб" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87 (SEQ ID NO: 6), и "белый квадрат" обозначает продуцирование IFN-гамма против клеток-мишеней, не стимулированных с помощью каких-либо пептидов.

[0021] [Фиг.4] На Фиг.4 изображен линейный график, демонстрирующий специфическую активность ЦТЛ против клеток-мишеней, которые экзогенно экспрессируют MELK и HLA-A*2402. Клетки COS7, трансфицированные HLA-A*2402 или полноразмерным геном MELK, получали в качестве контролей. Клон ЦТЛ, созданный с использованием MELK-A24-9-87 (SEQ ID NO: 6), демонстрировал специфическую активность ЦТЛ против клеток COS7, трансфицированных обоими MELK и HLA-A*2402 (черный ромб). С другой стороны, не детектировали никакой значительной специфической активности ЦТЛ против клеток-мишеней, экспрессирующих или HLA-A*2402 (белый треугольник) или MELK (белый круг).

[0022] [Фиг.5А] На Фиг.5А изображены фотографии, демонстрирующие результат анализов иммуноферментных пятен (ELISPOT) для IFN-гамма на ЦТЛ донора В, индуцированных с помощью модифицированных пептидов, полученных из MELK-A24-9-87_WT (SEQ ID NO: 6). ЦТЛ, стимулированные с помощью MELK-A24-9-87_1K (SEQ ID NO: 35) (a), MELK-A24-9-87_3M (SEQ ID NO: 41) (b) и MELK-A24-9-87_7N (SEQ ID NO: 44) (c), демонстрировали потенциальную способность продуцирования IFN-гамма, что обозначено квадратом. С другой стороны, не детектировали пептидо-специфичного продуцирования IFN-гамма из ЦТЛ, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6) (d). На чертежах "+" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью родственного пептида, и "-" обозначает продуцирование IFN-гамма против клеток-мишеней, не стимулированных с помощью каких-либо пептидов.

[0023] [Фиг.5B] На Фиг.5В изображены фотографии, демонстрирующие результат анализов иммуноферментных пятен (ELISPOT) для IFN-гамма на ЦТЛ донора С, индуцированных с помощью модифицированных пептидов, полученных из MELK-A24-9-87_WT (SEQ ID NO: 6). ЦТЛ, стимулированные с помощью MELK-A24-9-87_7N (SEQ ID NO: 44) (a), демонстрировали потенциальную способность продуцирования IFN-гамма. С другой стороны, не детектировали пептидо-специфичного продуцирования IFN-гамма из ЦТЛ, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6) (b). На чертежах "+" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью родственного пептида, и "-" обозначает продуцирование IFN-гамма против клеток-мишеней, не стимулированных с помощью каких-либо пептидов. Клетки в лунке номер #14, стимулированные с помощью MELK-A24-9-87_7N (SEQ ID NO: 44), наращивали для получения линий ЦТЛ. Клетки в лунке номер #4, стимулированные с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), которые также демонстрировали минорное продуцирование IFN-гамма, также наращивали.

[0024] [Фиг.6] На Фиг.6a-c изображены линейные графики, демонстрирующие результат получения линий ЦТЛ, индуцированных из PBMC донора B. Мощное продуцирование IFN-гамма детектировали с помощью анализа ELISA для IFN-гамма из линий ЦТЛ, стимулированных с помощью MELK-A24-9-87_1K (SEQ ID NO: 35) (a), MELK-A24-9-87_3M (SEQ ID NO: 41) (b) и MELK-A24-9-87_7N (SEQ ID NO: 44) (c). На чертежах "черный ромб" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), и "белый квадрат" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью постороннего HIV-пептида. На Фиг.6d-e изображены линейные графики, демонстрирующие результат получения линий ЦТЛ, индуцированных из PBMC донора C. Продуцирование IFN-гамма детектировали с помощью анализа ELISA для IFN-гамма из линий ЦТЛ, стимулированных с помощью MELK-A24-9-87_7N (SEQ ID NO: 44) (d). Линию ЦТЛ не получали из PBMC, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6) (e). На чертежах "черный ромб" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), и "белый квадрат" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью постороннего HIV-пептида.

[0025] [Фиг.7] На Фиг.7a-c изображены линейные графики, демонстрирующие результат получения клонов ЦТЛ, индуцированных из PBMC донора B. Мощное продуцирование IFN-гамма детектировали с помощью анализа ELISA для IFN-гамма из линий ЦТЛ, стимулированных с помощью MELK-A24-9-87_1K (SEQ ID NO: 35) (a), MELK-A24-9-87_3M (SEQ ID NO: 41) (b) и MELK-A24-9-87_7N (SEQ ID NO: 44) (c) На чертеже "черный ромб" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), и "белый квадрат" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью посторонних HIV-пептидов. На Фиг.7d изображен линейный график, демонстрирующий результат получения клона ЦТЛ, индуцированного из PBMC донора C. Продуцирование IFN-гамма детектировали с помощью анализа ELISA для IFN-гамма из клона ЦТЛ, стимулированных с помощью MELK-A24-9-87_7N (SEQ ID NO: 44). На чертеже, "черный ромб" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), и "белый квадрат" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью посторонних HIV-пептидов.

[0026] [Фиг.8] На Фиг.8 изображены линейные графики, демонстрирующие специфическую активность ЦТЛ против клеток-мишеней, которые эндогенно экспрессируют MELK и HLA-A*2402. (a) Линия ЦТЛ, полученная с помощью MELK-A24-9-87_7N (SEQ ID NO: 44), демонстрировала специфическую активность ЦТЛ против опухолевых клеточных линий, экспрессирующих оба, MELK и HLA-A*2402 (черный ромб; KLM-1, черный треугольник; MDA-MB-435S), по сравнению с другими клеточными линиями, которые экспрессировали MELK, но не экспрессировали HLA-A*2402 (белый круг; T47D, белый квадрат; KP-1N). (b) Было продемонстрировано ингибирование ответа ЦТЛ с помощью обработки mAb, связывающим HLA класса I. Клон ЦТЛ, полученный с помощью MELK-A24-9-87_7N (SEQ ID NO: 44), продемонстрировал специфическую активность ЦТЛ против KLM-1 (черный ромб) по сравнению с KP-1N (белый квадрат). Продуцирование IFN-гамма против KLM-1 (черный ромб) ингибировалось с помощью обработки с mAb, связывающим HLA класса I (белый ромб) по сравнению с обработкой нормальным мышиным IgG в качестве контроля (Hyphen).

[0027] [Фиг.9] На Фиг.9 изображены линейные графики, демонстрирующие результат реактивности клона ЦТЛ, специфичного к MELK-A24-9-199 (SEQ ID NO: 1). На Фиг.9(а), "черный ромб" обозначает продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-199 (SEQ ID NO: 1), и "белый квадрат" обозначает продуцирование IFN-гамма против клеток-мишеней, не стимулированных с помощью каких-либо пептидов. На фигуре Фиг.9(b), продуцирование IFN-гамма против опухолевых клеточных линий, которые экспрессируют оба, MELK и HLA-A*2402 (черный ромб; KLM-1) и которые экспрессируют MELK, но не экспрессируют HLA-A*2402 (белый квадрат; KP-1N).

Описание воплощений

[0028] Хотя любые материалы и методы, подобные или эквивалентные тем, что описаны в настоящем документе, также могут использоваться на практике или при тестировании настоящего изобретения, далее будут описаны предпочтительные методы, устройства и материалы. Однако, перед тем как описывать материалы и методы настоящего изобретения, следует понимать, что настоящее изобретение не ограничено конкретными размерами, формами, направлениями, материалами, методологиями, протоколами и т.д., описанными в данном документе, поскольку они могут варьироваться согласно стандартной процедуре эксперимента и его оптимизации. Также следует понимать, что использованная здесь терминология необходима только для целей описания конкретных вариантов или воплощений и не предназначена для ограничения рамок настоящего изобретения, которые будут ограничены только прилагаемой формулой изобретения.

[0029] Описание каждой публикации, патента или патентной заявки, упомянутой в данном описании изобретения, включено в данный документ конкретной ссылкой в полном объеме. Однако ничто в данном документе не должно быть истолковано как признание того, что изобретение не имеет право датировать более ранним числом такие раскрытия посредством предшествующего изобретения.

Если не определено иначе, то все технические и научные термины, использованные в данном документе, имеют тот же смысл, который вкладывается в них обычным специалистом в области, к которой принадлежит настоящее изобретение. В случае противоречий, они будут урегулированы настоящим описанием изобретения, включающим определения. Кроме того, материалы, методы и примеры представлены только для иллюстрации, и не предназначены для ограничения.

[0030] I. Определения

Слова "а", "an" и "the", используемые в данном документе, означают "по меньшей мере, один" если конкретно не указано иначе.

Термины "полипептид", "пептид" и "белок" применяются взаимозаменяемо в данном документе для обозначения полимера из аминокислотных остатков. Термины применяются к аминокислотным полимерам, в которых один или более аминокислотных остатков являются модифицированными остатками или искусственным остатком, таким как искусственный химический миметик соответствующей естественной аминокислоты, а также термины применяются к естественным аминокислотным полимерам.

Термин "олигопептид", иногда используемый в настоящем описании, используется для обозначения пептидов по настоящему изобретению, длина которых составляет 20 остатков или менее, как правило, 15 остатков или менее, и которые как правило содержат от примерно 8 до примерно 11 остатков, часто 9 или 10 остатков.

[0031] При использовании в данном документе, термин "аминокислота" относится к естественным и синтетическим аминокислотам, а также к аналогам аминокислот и аминокислотным миметикам, которые функционируют так же как и естественные аминокислоты. Аминокислоты могут представлять собой либо L-аминокислоты, либо D-аминокислоты. Естественными аминокислотами являются те, которые кодируются генетическим кодом, а также те аминокислоты, которые модифицируются в клетках после трансляции (например, гидроксипролин, гамма-карбоксиглутамат и O-фосфосерин). Термин "аминокислотный аналог" относится к соединениям, которые имеют такую же основную химическую структуру, что и естественная аминокислота, (альфа-углеродный атом, связанный с водородом, карбоксильной группой, аминогруппой и R-группой), но содержат модифицированную R-группу или модифицированные остовы (например, гомосерин, норлейцин, метионин сульфоксид, метионин метил сульфоний). Термин "аминокислотный миметик" относится к химическим соединениям, которые имеют разные структуры, но аналогичные функции с естественными аминокислотами.

[0032] Аминокислоты могут обозначаться в данном документе либо по их широко известному трехбуквенному коду, либо по однобуквенному коду, рекомендованному Комиссией по биохимической номенклатуре IUPAC-IUB.

Термины "ген", "полинуклеотид", "нуклеотид" и "нуклеиновая кислота" применяются в данном документе взаимозаменяемо и до тех пор, пока конкретно не определено иначе, аналогично аминокислотам обозначаются с помощью их широко применяемых однобуквенных кодов.

[0033] Термины "композиция", "вещество" или "агент" используются в данном документе взаимозаменяемо для обозначения продукта, который включает конкретные ингредиенты в конкретном количестве, а также любой продукт, который получают прямо или косвенно из конкретных ингредиентов в конкретном количестве. Подразумевается, что такой термин в отношении "фармацевтической композиции" охватывает продукт, включающий активный ингредиент(ы) и любой инертный ингредиент(ы), который составляет носитель, а также любой продукт, который получают прямо или косвенно в результате комбинации, комплексообразования или агрегации любых двух или более ингредиентов, или в результате диссоциации одного или более ингредиентов, или в результате реакций других типов или в результате взаимодействий одного или более ингредиентов. Соответственно, в контексте настоящего изобретения термин "фармацевтическая композиция" обозначает любую композицию, полученную путем примешивания соединения по настоящему изобретению и фармацевтически или физиологически приемлемого носителя. При использовании в данном документе термин "фармацевтически приемлемый носитель" или "физиологически приемлемый носитель", обозначает фармацевтически или физиологически приемлемый материал, композицию, вещество или носитель, включающие, в частности, жидкий или твердый наполнитель, разбавитель, вспомогательное вещество, растворитель или инкапсулирующий материал, вовлеченный в перенос или в транспорт целевых переносимых полифармакофоров от одного органа или области организма в другой орган или в другую область организма.

[0034] Термин "активный ингредиент" обозначает в данном документе вещество в агенте или в композиции, которое биологически или физиологически активно. Конкретно, в фармацевтическом агенте или в композиции "активный ингредиент" обозначает вещество, которое демонстрирует целевой фармакологический эффект. Например, в случае фармацевтических агентов или композиций для применения в лечении или предотвращении рака, активные ингредиенты в агентах или композициях могут приводить к получению, по меньшей мере, одного биологического или физиологического воздействия прямого или косвенного на раковые клетки и/или ткани. Предпочтительно, такое воздействие может включать уменьшение или ингибирование роста раковых клеток, разрушение или уничтожение раковых клеток и/или тканей и так далее. Как правило, косвенный эффект активных ингредиентов это индуцирование ЦТЛ, распознающих или уничтожающих раковые клетки. Перед включением в состав, "активный ингредиент" также обозначается как "активное вещество", "лекарственное вещество" или "технический продукт".

Фармацевтические агенты или композиции по настоящему изобретению находят конкретное применение в качестве вакцин. В контексте настоящего изобретения термин "вакцина" (также обозначаемый как "иммуногенная композиция") обозначает вещество, которое обладает функцией индуцирования противоопухолевого иммунитета при введении животным.

[0035] До тех пор, пока не определено иначе, термин "рак" обозначает раковые заболевания, при которых сверхэкспрессируется ген MELK, примеры которых включают, в частности, эндометриоз и раковые заболевания, примеры которых включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC.

До тех пор, пока не определено иначе, термин "эндометриоз" обозначает эндометриоз, при котором сверхэкспресссируется ген MELK, причем примеры эндометриоза включают, в частности, стадию I (минимальный), II (спокойный), III (умеренный), или IV (тяжелый) эндометриоза, классифицированного с помощью классификации пересмотренной шкалы Американского общества Фертильности. Альтернативно, примеры эндометриоза включают, в частности, стадию I, II, III, или IV эндометриоза, классифицированного с помощью классификации по Beecham.

[0036] До тех пор пока не определено иначе, термины "цитотоксический T-лимфоцит", "цитотоксическая T-клетка" и "ЦТЛ" используются в данном документе взаимозаменяемо и до тех пор, пока конкретно не указано иначе, обозначают подгруппу T-лимфоцитов, которые способны распознавать чужеродные клетки (например, опухолевые клетки, вирусно-инфицированные клетки) и индуцировать смерть таких клеток.

До тех пор, пока не определено иначе, термин "HLA-A24" обозначает тип HLA-A24, содержащий подтипы, такие как HLA-A*2402.

[0037] При использовании в данном документе, до тех пор пока не определено иначе, термин "набор реагентов" используется для обозначения комбинации реагентов и других материалов. В данном документе предполагается, что набор реагентов может включать микроэррей, чип, маркер и так далее. Подразумевается, что термин "набор реагентов" не является ограничением конкретной комбинации реагентов и/или материалов.

При использовании в данном документе в контексте субъекта или пациента термин "HLA-A24-положительный" обозначает, что субъект или пациент гомозиготно или гетерозиготно обладает геном HLA-A24-антигена, и HLA-A24-антиген экспрессируется в клетках субъекта или пациента в виде HLA-антигена.

[0038] В той степени, в которой способы и композиции по настоящему изобретению находят применение в контексте "лечения" рака или эндометриоза, лечение считается "эффективным", если оно приводит к клиническому эффекту, такому как уменьшение экспрессии гена MELK или к уменьшению размера, распространения или метастатического потенциала рака или эндометриоза у субъекта. Когда лечение применяется профилактически, "эффективность" обозначает, что оно задерживает или предотвращает образование раковых заболеваний или эндометриоза, или предотвращает или ослабляет клинические симптомы рака или других заболеваний. Эффективность определяется при совместном использовании любых известных методов диагностики или лечения заболевания или конкретного типа опухоли.

[0039] В той степени, в которой способы и композиции по настоящему изобретению находят применение в контексте "предотвращения" и "профилактики" заболеваний, таких как рак или эндометриоз, такие термины используются в данном документе взаимозаменяемо для обозначения любой активности, которая снижает нагрузку смертности или заболеваемости этим заболеванием. Предотвращение и профилактика может иметь место "на первичном, вторичном или третичном уровне предотвращения". В то время как первичное предотвращение и профилактика избегают развития заболевания, вторичный и третичный уровни предотвращения и профилактики охватывают активности, цель которых предотвращение и профилактика прогрессии заболевания и проявления симптомов, а также уменьшение негативного вклада уже имеющегося заболевания путем восстановления функции и уменьшения степени осложнений, связанных с заболеванием. Альтернативно, предотвращение и профилактика могут включать широкий спектр профилактических терапий, цель которых облегчение тяжести конкретного расстройства, например, уменьшение пролиферации и метастазирования опухолей.

[0040] В контексте настоящего изобретения лечение и/или профилактика рака или эндометриоза и/или предотвращение его послеоперационного рецидива включают одну или более из следующих стадий, таких как хирургическое удаление раковых клеток, ингибирование роста раковых клеток, инволюция или регрессия опухоли, индуцирование ремиссии и суппрессия проявления рака, регрессия опухоли и уменьшение или ингибирование метастазирования. Эффективное лечение и/или профилактика рака снижает смертность и улучшает прогноз индивидуумов, имеющих раковое заболевание, снижает уровень опухолевых маркеров в крови и облегчает детектируемые симптомы, сопровождающие рак. Например, снижение или ослабление симптомов, составляющих эффективное лечение и/или профилактику, включает снижение или ослабление на 10%, 20%, 30% или более, или представляет собой стабилизацию заболевания.

[0041] В контексте настоящего изобретения термин "антитело" обозначает иммуноглобулины и их фрагменты, которые специфично реактивны по отношению к определенному белку или его пептиду. Антитело может включать человеческие антитела, приматизированные антитела, химерные антитела, биспецифичные антитела, гуманизированные антитела, антитела, сшитые с другими белками или радиоактивными метками, и фрагменты антител. Кроме того, антитело в настоящем документе используется в широком смысле и специфически охватывает интактные моноклональные антитела, поликлональные антитела, мультспецифичные антитела (например, биспецифичные антитела), образованные, по меньшей мере, из двух интактных антител, любые фрагменты антител при условии, что они проявляют целевую биологическую активность. "Антитело" включает все классы (например, IgA, IgD, IgE, IgG и IgM).

[0042] II. Пептиды

Для демонстрации того, что модифицированные пептиды, полученные из MELK, функционируют в качестве антигена, распознаваемого ЦТЛ, модифицированные пептиды, полученные из MELK-A24-9-87_WT (SEQ ID NO: 6), анализировали для определения того, являются ли они антигенными эпитопами, рестриктированными по HLA-A24, которые представляют собой часто встречающиеся HLA-аллели (Date Y et al., Tissue Antigens 47: 93-101, 1996; Kondo A et al., J Immunol 155: 4307-12, 1995; Kubo RT et al., J Immunol 152: 3913-24, 1994).

Кандидаты HLA-A24-связывающих модифицированных пептидов, полученных из MELK, которые обладают потенциальной способностью более эффективно индуцировать специфические ЦТЛ, чем MELK-A24-9-87 дикого типа (MELK-A24-9-87_WT) (SEQ ID NO: 6), идентифицировали на основе их аффинностей связывания с HLA-A24. То есть, согласно настоящему изобретению, предлагаются модифицированные пептиды, содержащие аминокислотную последовательность, содержащую одну или более аминокислотных замен в аминокислотной последовательности SEQ ID NO: 6.

[0043] В настоящем изобретении количество аминокислотных замен в модифицированных пептидах MELK-A24-9-87_WT (SEQ ID NO: 6) составляет, по меньшей мере, одну. В некоторых воплощениях, количество замен составляет одну, две, три или четыре замены в следующих положениях (a)-(d) в аминокислотной последовательности SEQ ID NO: 6.

(a) N-концевая аминокислота,

(b) третья аминокислота с N-конца,

(c) третья аминокислота с C-конца и

(d) C-концевая аминокислота.

[0044] Положения консервативных остатков в последовательностях пептидов, презентирующихся путем связывания с HLA-антигенами, уже известны (J Immunol 1994, 152: 3913; Immunogenetics 1995, 41: 178; J Immunol 1994, 155: 4307). В соответствии с консервативными остатками может вводиться замена во втором положении аминокислотной последовательности с N-конца и замена C-концевой аминокислоты с сохранением или с повышением связывания HLA-A24 с пептидами. Однако положения, представленные как (a)-(d), отличаются от положений консервативных остатков. Другими словами, в настоящем изобретении предлагаются пептиды, обладающие повышенной способностью индуцирования ЦТЛ, и содержащие замены, отличные от ранее известных консервативных остатков.

[0045] В воплощении настоящего изобретения, замены в этих положениях могут быть выбраны из группы, состоящей из (i)-(iv):

(i) аминокислотная замена E на K или R в N-концевом положении аминокислотной последовательности SEQ ID NO: 6,

(ii) аминокислотная замена C на E, I, L, M, N или P в третьем положении с N-конца аминокислотной последовательности SEQ ID NO: 6,

(iii) аминокислотная замена E на N или Q в третьем положении с С-конца аминокислотной последовательности SEQ ID NO: 6 и

(iv) аминокислотная замена F на L в C-концевом положении аминокислотной последовательности SEQ ID NO: 6.

[0046] Модификация одной, двух или более аминокислот в пептиде не повлияет на функцию пептида, как описано подробно ниже. Следующие пептиды идентифицировали как пептиды-кандидаты, обладающие более высокой аффинностью связывания с MELK-A24-9-87_WT (SEQ ID NO: 6):

MELK-A24-9-87_1K (SEQ ID NO: 35),

MELK-A24-9-87_1R (SEQ ID NO: 36),

MELK-A24-9-87_9L (SEQ ID NO: 37),

MELK-A24-9-87_3E (SEQ ID NO: 38),

MELK-A24-9-87_3I (SEQ ID NO: 39),

MELK-A24-9-87_3L (SEQ ID NO: 40),

MELK-A24-9-87_3M (SEQ ID NO: 41),

MELK-A24-9-87_3N (SEQ ID NO: 42),

MELK-A24-9-87_3P (SEQ ID NO: 43),

MELK-A24-9-87_7N (SEQ ID NO: 44), и

MELK-A24-9-87_7Q (SEQ ID NO: 45),.

[0047] После in vitro-стимулирования T-клеток с помощью дендритных клеток (DC), нагруженных с использованием этих пептидов, ЦТЛ были успешно получены с использованием следующих пептидов:

MELK-A24-9-87_1K (SEQ ID NO: 35),

MELK-A24-9-87_3M (SEQ ID NO: 41), и

MELK-A24-9-87_7N (SEQ ID NO: 44).

Эти полученные ЦТЛ демонстрируют мощную специфическую активность ЦТЛ против клеток-мишеней, возбужденных с помощью соответствующих петидов. Результаты, представленные в данном документе, демонстрируют, что пептиды представляют собой модифицированные эпитопные пептиды MELK, рестриктированные по HLA-A24.

[0048] Так как ген MELK сверхэкспрессируется в клетках эндометриоза и в клетках рака и в тканях, включающих, в частности, клетки рака груди, рака мочевого пузыря, рака шейки матки, холангиоцеллюлярного рака, CML, колоректального рака, рака пищевода, рака желудка, рака печени, NSCLC, лимфомы, остеосаркомы, рака яичника, рака поджелудочной железы, рака предстательной железы, светлоклеточного рака и SCLC, но не экспрессируется в большинстве клеток здоровых органов, то он является хорошей мишенью для иммунотерапии. Таким образом, в настоящем изобретении предлагаются нонапептиды (пептиды, состоящие из девяти аминокислотных остатков), соответствующие ЦТЛ-распознаваемым модифицированным эпитопам MELK. Предпочтительные примеры нонапептидов по настоящему изобретению включают пептиды, содержащие аминокислотную последовательность, выбранную из SEQ ID NO: 35-45.

[0049] Как правило, компьютерные программы, доступные в настоящее время из интернета, такие, как описанные в Parker KC et al., J Immunol 1994 Jan 1, 1(152): 163-75, могут использоваться для расчета аффинностей связывания между различными пептидами и HLA-антигенами in silico. Аффинность связывания с HLA-антигенами можно измерить, как описано, например, в публикациях Parker KC et al., J Immunol 1994 Jan 1, 1(152): 163-75; и Kuzushima K et al., Blood 2001, 98(6): 1872-81, Larsen MV et al. BMC Bioinformatics. 2007 Oct 31; 8: 424, Buus S et al. Tissue Antigens., 62:378-84, 2003, Nielsen M et al., Protein Sci 2003; 12: 1007-17, и Nielsen M et al. PLoS ONE 2007; 2: e796, которые суммированы, например, в Lafuente EM et al., Current Pharmaceutical Design, 2009, 15, 3209-3220. Методы определения аффинности связывания описаны, например, в Journal of Immunological Methods, 1995, 185: 181-190 и в Protein Science, 2000, 9: 1838-1846. Таким образом, можно использовать такие компьютерные программы для выбора иммунологически активных фрагментов, полученных из MELK, которые обладают высокой аффинностью связывания с HLA-антигенами. Соответственно, настоящее изобретение охватывает идентифицированные с использованием таких известных программ пептиды, состоящие из любых иммунологически активных фрагментов, полученных из MELK, которые связываются с HLA-антигенами.

[0050] Пептиды по настоящему изобретению могут фланкироваться дополнительными аминокислотными остатками при условии, что полученный в результате пептид сохранит способность индуцирования ЦТЛ. Конкретные аминокислотные остатки, фланкирующие пептиды по настоящему изобретению, могут представлять собой аминокислоты любого типа при условии, что они не повлияют на способность исходного пептида индуцировать ЦТЛ. Таким образом, настоящее изобретение охватывает пептиды, которые включают модифицированные пептиды, полученные из MELK, и которые обладают аффинностью связывания с HLA-антигенами. Такие пептиды, как правило, состоят из менее чем примерно 40 аминокислот, часто менее чем примерно 20 аминокислот, обычно из менее чем примерно 15 аминокислот.

[0051] В основном, модификация одной, двух или более аминокислот в пептиде не повлияет на функцию пептида, и, в некоторых случаях, даже усилит целевую функцию исходного пептида. Фактически, известно, что модифицированные пептиды (т.e., пептиды, состоящие из аминокислотной последовательности, в которой одна, две или более аминокислотных остатков модифицированы (т.e., заменены, делетированы, добавлены или вставлены, по сравнению с исходной эталонной последовательностью), сохраняют биологическую активность исходного пептида (Mark et al., Proc Natl Acad Sci USA 1984, 81: 5662-6; Zoller and Smith, Nucleic Acids Res 1982, 10: 6487-500; Dalbadie-McFarland et al., Proc Natl Acad Sci USA 1982, 79: 6409-13). Таким образом, в одном воплощении, пептиды по настоящему изобретению могут обладать как способностью индуцирования ЦТЛ, так и могут содержать аминокислотную последовательность, выбранную из SEQ ID NO: 35-45, где одна, две или даже более аминокислот добавлены, вставлены и/или заменены.

[0052] Специалистам в данной области понятно, что индивидуальные добавления или замены в аминокислотной последовательности, которые изменяют единственную аминокислоту или небольшой процент аминокислот, как правило, приводит в результате к сохранению свойств исходной аминокислоты. Как таковые, они часто обозначаются как "консервативные замены" или "консервативные модификации", где изменение белка приводит в результате к получению модифицированного белка, обладающего функцией, аналогичной функции исходного белка. Таблицы консервативных замен предоставляющие подобные аминокислоты, хорошо известны в данной области. Примеры характеристик боковых цепей аминокислот, которые считаются консервативными, включают, например, гидрофобные аминокислоты (A, I, L, M, F, P, W, Y, V), гидрофильные аминокислоты (R, D, N, C, E, Q, G, H, K, S, T) и боковые цепи, содержащие, в совокупности, следующие функциональные группы или характеристики: алифатические боковые цепи (G, A, V, L, I, P); боковые цепи, содержащие гидроксильную группу (S, T, Y); боковые цепи, содержащие атом серы (C, M); боковые цепи, содержащие карбоновую кислоту и амид (D, N, E, Q); боковые цепи, содержащие основание (R, K, H); и боковые цепи, содержащие ароматический компонент (H, F, Y, W). Кроме того, следующие восемь групп содержат аминокислоты, которые считаются в данной области консервативными заменами друг друга:

1) Аланин (А), Глицин (G);

2) Аспарагиновая кислота (D), Глутаминовая кислота (Е);

3) Аспарагин (N), Глутамин (Q);

4) Аргинин (R), Лизин (К);

5) Изолейцин (I), Лейцин (L), Метионин (М), Валин (V);

6) Фенилаланин (F), Тирозин (Y), Триптофан (W);

7) Серин (S), Треонин (T), и

8) Цистеин (С), Метионин (М) (см., например, Creighton, Proteins 1984).

Также предполагается, что такие консервативно модифицированные пептиды являются пептидами по настоящему изобретению. Однако пептиды по настоящему изобретению не ограничиваются этим и могут включать неконсервативные модификации при условии, что полученный в результате модифицированный пептид сохранит способность исходного пептида индуцировать ЦТЛ. Кроме того, модифицированные пептиды не должны исключать получения полиморфных вариантов, межвидовых гомологов и аллелей MELK, способных индуцировать ЦТЛ.

[0053] Аминокислотные остатки могут быть вставлены, заменены или добавлены к пептидам по настоящему изобретению, или, альтернативно, аминокислотные остатки могут быть делетированы с достижением более высокой аффинности связывания. Для сохранения необходимой способности индуцирования ЦТЛ предпочтительно модифицируют (вставляют, делетируют, добавляют и/или заменяют) только небольшое количество (например, 1, 2 или более) или небольшой процент аминокислот. В данном документе термин "несколько" обозначает 5 или менее аминокислот, например, 4, 3 или менее. Процент аминокислот, которые следует модифицировать, составляет, предпочтительно, 20% или менее, более предпочтительно, 15% или менее, еще более предпочтительно, 10% или менее или 1-5%.

[0054] Кроме того, аминокислотные остатки могут быть вставлены, заменены или добавлены к пептидам по настоящему изобретению, или, альтернативно, аминокислотные остатки могут быть делетированы с достижением более высокой аффинности связывания. При использовании в контексте иммунотерапии, пептиды по настоящему изобретению должны презентироваться на поверхности клетки или экзосомы, предпочтительно, в виде комплекса с HLA-антигеном. Дополнительно к пептидам, которые презентируются естественным образом, так как закономерность последовательностей пептидов, презентирующихся путем связывания с HLA-антигенами, уже известна (J Immunol 1994, 152: 3913; Immunogenetics 1995, 41: 178; J Immunol 1994, 155: 4307), то на основе такой закономерности в иммуногенные пептиды по изобретению могут вводиться модификации. Например, может быть целесообразной замена второй аминокислоты с N-конца, заменяя ее на фенилаланин, тирозин, метионин или триптофан, и/или замена аминокислоты на С-конце на фенилаланин, лейцин, изолейцин, триптофан или метионин, с целью повышения аффинности связывания с HLA-A24. Таким образом, настоящим изобретением охвачены пептиды, содержащие аминокислотные последовательности, выбранные из SEQ ID NO: 35-45, где вторую аминокислоту с N-конца этих аминокислотных последовательностей заменяют на фенилаланин, тирозин, метионин или триптофан, и/или где C-конец этих аминокислотных последовательностей заменяют на фенилаланин, лейцин, изолейцин, триптофан или метионин.

[0055] Замены могут вводиться не только в концевые аминокислоты, но также в положение пептидов, соответствующее потенциальному распознаванию T-клеточного рецептора (TCR). Некоторые исследования продемонстрировали, что пептид, содержащий аминокислотные замены, может обладать такой же или лучшей функцией, чем у исходного пептида, например, CAP1, p53 (264-272), Her-2/neu (369-377) или gp100 (209-217) (Zaremba et al. Cancer Res. 57, 4570-4577, 1997, T. K. Hoffmann et al. J Immunol. (2002) Feb 1;168(3):1338-47., S. O. Dionne et al. Cancer Immunol immunother. (2003) 52: 199-206 и S. O. Dionne et al. Cancer Immunology, Immunotherapy (2004) 53, 307-314).

Настоящее изобретение также предполагает добавление одной, двух или нескольких аминокислот к N- и/или C-концу описанных пептидов. Такие модифицированные пептиды, обладающие высокой аффинностью связывания с HLA-антигеном и сохраняющие способность индуцирования ЦТЛ, также включены в настоящее изобретение.

Следует заметить, что хотя имеются упоминания о модификации второй аминокислоты с N-конца и N- и/или C-концов пептидов для достижения более высокой аффинности связывания, как указано выше, при этом эффект модификации седьмой аминокислоты с N-конца еще нигде не освещался.

[0056] Однако, когда пептидная последовательность идентична части аминокислотной последовательности эндогенного или экзогенного белка, имеющего другую функцию, могут индуцироваться побочные эффекты, такие как аутоиммунные расстройства и/или аллергические симптомы против конкретных веществ. Таким образом, предпочтительно осуществлять поиск гомологии с использованием доступных баз данных во избежание ситуаций, в которых последовательность пептида перекрывает аминокислотную последовательность другого белка. Когда из поиска гомологии становится очевидно, что не существует пептида, обладающего даже 1 или 2 аминокислотными различиями по сравнению с целевым пептидом, целевой пептид может быть модифицирован с целью повышения его аффинности связывания с HLA-антигенами, и/или для повышения его способности индуцирования ЦТЛ без опасения появления каких-либо побочных эффектов.

[0057] Хотя ожидается, что пептиды, обладающие высокой аффинностью связывания с HLA-антигенами, как описано выше, будут высоко эффективными, пептиды-кандидаты, которые выбраны согласно наличию в качестве показателя высокой аффинности связывания, дополнительно исследуют на предмет наличия способности индуцирования ЦТЛ. В данном документе, термин "способность индуцирования ЦТЛ" обозначает способность пептида индуцировать ЦТЛ при презентации на антиген-презентирующих клетках (АПК). Кроме того, "способность индуцирования ЦТЛ" включает способность пептида индуцировать активацию ЦТЛ, пролиферацию ЦТЛ, стимулировать лизис с помощью ЦТЛ клеток-мишеней и повышать продуцирование IFN-гамма клетками ЦТЛ.

[0058] Подтверждение способности индуцирования ЦТЛ осуществляют путем индуцирования АПК, несущих человеческие MHC-антигены (например, B-лимфоциты, макрофаги и дендритные клетки (DC)), или более конкретно, DC, полученные из мононуклеаров периферической крови человека, и после стимулирования с помощью пептидов, смешивания с CD8-положительными клетками и затем с помощью измерения IFN-гамма, продуцированного и высвобожденного ЦТЛ против клеток-мишеней. В качестве реакционной системы могут использоваться полученные трансгенные животные, экспрессирующие человеческий HLA-антиген (например, описанные в BenMohamed L, Krishnan R, Longmate J, Auge C, Low L, Primus J, Diamond DJ, Hum Immunol 2000 Aug, 61(8): 764-79, Related Articles, Books, Linkout Induction of CTL response by a minimal epitope vaccine in HLA A*0201/DR1 transgenic mice: dependence on HLA class II restricted T(H) response). Например, клетки-мишени могут быть радиоактивно-меченными с помощью 51Cr и так далее, и цитотоксическая активность может быть рассчитана на основании радиоактивности, высвобождаемой из клеток-мишеней. Альтернативно, способность индуцирования ЦТЛ может оцениваться путем измерения IFN-гамма, продуцированного и высвобожденного ЦТЛ в присутствии АПК, которые несут иммобилизованные пептиды, и путем визуализации области ингибирования на среде с использованием моноклональных антител, связывающих IFN-гамма.

В результате исследования способности пептидов индуцировать ЦТЛ, как описано выше, было обнаружено, что нонапептиды, выбранные среди пептидов, содержащих аминокислотные последовательности, обозначенные с помощью SEQ ID NO: 35-45, продемонстрировали особенно высокую способность индуцирования ЦТЛ, а также высокую аффинность связывания с HLA-антигеном. Таким образом, эти пептиды приведены в качестве примера предпочтительных воплощений настоящего изобретения.

[0059] Кроме того, результат анализов гомологии продемонстрировал, что такие пептиды не обладают существенной гомологией с пептидами, полученными из других известных продуктов генов человека. Это уменьшает возможность неизвестного или нецелесообразного иммунного ответа, возникающего при применении иммунотерапии. Таким образом, также на основании этого аспекта, эти пептиды применяются для того, чтобы вызвать иммунитет против MELK у пациентов, имеющих раковое заболевание или эндометриоз. Таким образом, пептиды по настоящему изобретению это, предпочтительно, пептиды, состоящие из аминокислотной последовательности, выбранной из SEQ ID NO: 35-45.

[0060] Дополнительно к вышеописанным модификациям пептиды по настоящему изобретению также могут быть связаны с другими пептидами, при условии, что полученный в результате связанный пептид сохраняет необходимую способность исходного пептида по части индуцирования ЦТЛ. Примеры других подходящих пептидов включают: пептиды по настоящему изобретению или пептиды, обладающие способность индуцирования ЦТЛ, полученные из других TAA. Подходящие межпептидные линкеры хорошо известны в данной области, например, AAY (P. M. Daftarian et al., J Trans Med 2007, 5:26), AAA, NKRK (R. P. M. Sutmuller et al., J Immunol. 2000, 165: 5 7308-7315) или K (S. Ota et al., Can Res. 62, 1471-1476, K. S. Kawamura et al., J Immunol. 2002, 168: 5709-5715).

[0061] Например, также, по существу, одновременно могут использоваться отличные от MELK опухолеспецифичные антигенные пептиды для повышения иммунного ответа посредством HLA класса I и/или класса II. Хорошо известно, что раковые клетки могут экспрессировать более одного опухолеспецифичного гена. Таким образом, специалист в данной области в рамках обычного эксперимента способен определить, экспрессирует ли конкретный субъект дополнительные опухолеспецифичные гены, и затем включить в MELK-композиции или вакцины согласно настоящему изобретению пептиды, полученные из экспрессирующихся продуктов таких генов и связывающиеся с антигенами HLA класса I и/или HLA класса II.

[0062] Примеры пептидов, связывающихся с HLA класса I и HLA класса II, известны специалисту в данной области (см., например, Coulie, Stem Cells 13:393-403, 1995) и могут использоваться в настоящем изобретении подобно пептидам, раскрытым в данном документе. Специалист в данной области может легко получить полипептиды, включающие один или более пептидов MELK и один или более пептидов, отличных от MELK, или нуклеиновые кислоты, кодирующие такие полипептиды, с использованием стандартных процедур молекулярной биологии.

[0063] Вышеописанные связанные пептиды обозначены в данном документе как "политопы", т.e., группы из двух или более потенциально иммуногенных стимулирующих иммунный ответ пептидов, которые могут быть соединены вместе в различных расположениях (например, будучи связанными, перекрывающимися). Политоп (или нуклеиновая кислота, кодирующая политоп) может вводиться с использованием стандартного протокола иммунизации, например, животным для тестирования эффективности политопа в стимулировании, повышении и/или в вызове иммунного ответа.

[0064] Пептиды могут быть соединены вместе непосредственно или посредством использования фланкирующих последовательностей с образованием политопов, и применение политопов в качестве вакцин хорошо известно в данной области (см., например, Thomson et al., Proc. Natl. Acad. Sci USA 92(13):5845-5849, 1995; Gilbert et al., Nature Biotechnol. 15(12):1280-1284, 1997; Thomson et al., J Immunol. 157(2):822-826, 1996; Tarn et al., J Exp. Med. 171(l):299-306, 1990). Политопы, содержащие различные количества и комбинации эпитопов, могут быть получены и протестированы на предмет распознавания с помощью ЦТЛ и на предмет эффективности в повышении иммунного ответа.

[0065] Дополнительно к модификации пептидов по настоящему изобретению, обсуждаемой выше, описанные пептиды могут быть дополнительно соединены с другими веществами, при условии, что они сохранят способность исходных пептидов индуцировать ЦТЛ. Типичные вещества включают: пептиды, липиды, сахар или цепи сахаров, ацетильные группы, природные или синтетические полимеры, и т.д. Пептиды по настоящему изобретению могут содержать модификации, такие как гликозилирование, окисление боковой цепи и/или фосфорилирование; при условии, что эти модификации не нарушат биологической активности исходного пептида. Эти типы модификаций могут придавать дополнительные функции (например, функция нацеливания и функция доставки пептидов) и/или могут стабилизировать пептиды.

[0066] Например, в данной области известно, что для повышения in vivo стабильности полипептида вводят D-аминокислоты, миметики аминокислот или синтетические аминокислоты; эта концепция также может быть адаптирована к полипептидам по настоящему изобретению. Стабильность полипептида можно оценить различными путями. Например, для тестирования стабильности могут использоваться пептидазы и различные биологические среды, такие как человеческая плазма и сыворотка (см., например, Verhoef et al., Eur J Drug Metab Pharmacokin 1986, 11: 291-302).

[0067] Кроме того, как упомянуто выше, среди модифицированных пептидов, в которых заменены, делетированы или добавлены один, два или более аминокислотных остатков, пептиды, обладающие такой же или более высокой активностью по сравнению с исходными пептидами, могут быть подвергнуты скринингу или отбору. Таким образом, в настоящем изобретении также предлагается способ скрининга или отбора модифицированных пептидов, обладающих такой же или более высокой активностью по сравнению с исходными пептидами. Иллюстративный способ может включать стадии:

a: замены, делеции или добавления, по меньшей мере, одного аминокислотного остатка пептида по настоящему изобретению,

b: определения активности пептида, и

c: отбора пептида, обладающего такой же или более высокой активностью по сравнению с исходным пептидом.

В данном документе, оцениваемая активность может включать активность связывания с MHC, способность индуцирования АПК или ЦТЛ и цитотоксическую активность.

В данном документе, пептиды по настоящему изобретению также могут быть описаны как "пептид(ы) MELK" или "полипептид(ы) MELK".

[0068] III. Получение модифицированных пептидов MELK

Пептиды по изобретению могут быть получены с использованием хорошо известных методов. Например, пептиды могут быть получены синтетически, с использованием технологии рекомбинантной ДНК или с помощью химического синтеза. Пептиды по изобретению могут быть синтезированы индивидуально или в виде более длинных полипептидов, состоящих из двух или более пептидов. Затем пептиды могут быть выделены, т.е., очищены или выделены так, что они по существу свободны от других природных белков клетки-хозяина и их фрагментов или от любых других химических веществ.

Пептиды по настоящему изобретению могут содержать модификации, такие как гликозилирование, окисление боковой цепи или фосфорилирование, при условии, что такие модификации не нарушают биологической активности исходного пептида. Другие иллюстративные модификации включают введение D-аминокислот или других миметиков аминокислот, которые могут использоваться, например, для увеличения периода полужизни пептидов в сыворотке.

[0069] Пептиды по настоящему изобретению могут содержать модификации, такие как гликозилирование, окисление боковой цепи или фосфорилирование; при условии, что такие модификации не нарушают биологической активности пептидов, описанных в данном документе. Другие модификации включают введение D-аминокислот или других миметиков аминокислот, которые могут использоваться, например, для увеличения периода полужизни пептидов в сыворотке.

[0070] Пептид по настоящему изобретению может быть получен посредством химического синтеза на основе выбранной аминокислотной последовательности. Примеры стандартных методов пептидного синтеза, которые могут быть адаптированы для синтеза, включают, в частности:

(i) Peptide Synthesis, Interscience, New York, 1966;

(ii) The Proteins, Vol. 2, Academic Press, New York, 1976;

(iii) Peptide Synthesis (in Japanese), Maruzen Co., 1975;

(iv) Basics and Experiment of Peptide Synthesis (in Japanese), Maruzen Co., 1985;

(v) Development of Pharmaceuticals (second volume) (in Japanese), Vol. 14 (peptide synthesis), Hirokawa, 1991;

(vi) WO99/67288; и

(vii) Barany G. & Merrifield R.B., Peptides Vol. 2, "Solid Phase Peptide Synthesis", Academic Press, New York, 1980, 100-118.

[0071] Альтернативно, пептиды по настоящему изобретению могут быть получены с использованием адаптации любых известных методов генетической инженерии для получения пептидов (например, Morrison J, J Bacteriology 1977, 132: 349-51; Clark-Curtiss & Curtiss, Methods in Enzymology (eds. Wu et al.) 1983, 101: 347-62). Например, сначала получают подходящий вектор, несущий полинуклеотид, кодирующий целевой пептид, в экспрессируемой форме (например, в 3'-области по отношению к регуляторной последовательности, соответствующей промоторной последовательности) и трансформируют в подходящую клетку-хозяина. Затем клетку-хозяина культивируют с получением пептида, представляющего интерес. Пептид также может быть получен in vitro с использованием адаптированной системы in vitro-трансляции.

[0072] IV. Полинуклеотиды

В настоящем изобретении также предлагается полинуклеотид, который кодирует любой из вышеупомянутых пептидов по настоящему изобретению. Они включают модифицированные полинуклеотиды, полученные из природного гена MELK (Регистрационный номер GenBank No. NM_014791 (SEQ ID NO: 46)), а также полинуклеотиды, содержащие их консервативно модифицированную нуклеотидную последовательность. В данном документе термин "консервативно модифицированная нуклеотидная последовательность" обозначает последовательности, которые кодируют идентичные или по существу идентичные аминокислотные последовательности. Из-за вырожденности генетического кода, большое число функционально идентичных нуклеиновых кислот кодируют тот или иной белок. Например, кодоны GCA, GCC, GCG и GCU все кодируют аминокислоту аланин. Таким образом, в каждой позиции, в которой аланин определяется кодоном, кодон может быть изменен на любой из соответствующих описанных кодонов без изменения кодируемого полипептида. Такие варианты нуклеиновых кислот представляют собой "молчащие варианты", которые являются одним из видов консервативно модифицированных вариантов. Каждая последовательность нуклеиновой кислоты в данном документе, которая кодирует пептид, также описывает каждый возможный молчащий вариант нуклеиновой кислоты. Специалисту в данной области понятно, что каждый кодон в нуклеиновой кислоте (за исключением AUG, который обычно является единственным кодоном для метионина, и TGG, который обычно является единственным кодоном для триптофана) может быть модифицирован с получением функционально идентичной молекулы. Соответственно, каждый молчащий вариант нуклеиновой кислоты, которая кодирует пептид, подразумевается в каждой описанной последовательности.

Полинуклеотид по настоящему изобретению может состоять из ДНК, РНК и их производных. ДНК обычно состоит из оснований, таких как A, T, C и G, а в РНК T заменен на U. Специалисту в данной области понятно, что искусственные основания также включены в полинуклеотиды.

[0073] Полинуклеотид по настоящему изобретению может кодировать множество пептидов по настоящему изобретению, содержащих или не содержащих вставки аминокислотных последовательностей. Например, вставка аминокислотной последовательности может обеспечивать сайт отщепления (например, последовательность распознавания фермента) полинуклеотида или транслируемых пептидов. Кроме того, полинуклеотид может включать любые последовательности, дополнительные к кодирующей последовательности, кодирующей пептид по настоящему изобретению. Например, полинуклеотид может представлять собой рекомбинантный полинуклеотид, который включает регуляторные последовательности, необходимые для экспрессии пептида, или может представлять собой экспрессирующий вектор (плазмиду) с маркерными генами и так далее. Как правило, такие рекомбинантные полинуклеотиды могут быть получены с помощью манипуляций с полинуклеотидами посредством стандартных методов рекомбинантной ДНК с использованием, например, полимераз и эндонуклеаз.

[0074] Для получения полинуклеотидов по настоящему изобретению могут использоваться как методы рекомбинантного, так и химического синтеза. Например, полинуклеотид может быть получен путем вставки в соответствующий вектор, который может экспрессироваться при трансфекции в компетентные клетки. Альтернативно, полинуклеотид может амплифицироваться с использованием методов ПЦР или путем экспрессии в подходящих организмах-хозяевах (см., например, Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York, 1989). Альтернативно, полинуклеотид может быть синтезирован с использованием методов твердофазного синтеза, как описано в Beaucage SL & Iyer RP, Tetrahedron 1992, 48: 2223-311; Matthes et al., EMBO J 1984, 3: 801-5.

[0075] V. Экзосомы

В настоящем изобретении дополнительно предлагаются внутриклеточные везикулы, называемые экзосомами, которые презентируют на своей поверхности комплексы, образованные между пептидами по настоящему изобретению и HLA-антигенами. Экзосомы могут быть получены, например, с использованием методов, подробно описанных в Публикации Японской Патентной Заявки Kohyo No. Hei 11-510507 и WO99/03499, и могут быть получены с использованием АПК, полученных из образцов пациентов, которые являются субъектами для лечения и/или предотвращения заболевания. Экзосомы по настоящему изобретению могут вводиться в качестве вакцин аналогично пептидам по настоящему изобретению.

[0076] Тип HLA-антигенов, содержащихся в комплексах, должен соответствовать типу HLA-антигенов субъекта, которому требуется лечение и/или предотвращение заболевания. Например, в популяции в Японии преобладают HLA-A24 (особенно, A*2402) и, таким образом, подходят для лечения пациента-японца. Использование A24-типа, который высоко экспрессируется среди японцев и европейцев, будет предпочтительным для получения эффективных результатов. Как правило, в больнице, тип HLA-антигена пациента, которому требуется лечение, определяют заранее, что позволяет осуществить соответствующий отбор пептидов, обладающих высоким уровнем аффинности связывания, с конкретным антигеном, или обладающих способностью индуцирования ЦТЛ с помощью антигенной презентации. Кроме того, с целью получения пептидов, обладающих и высокой аффинностью связывания и способностью индуцирования ЦТЛ, может быть осуществлена замена, вставка и/или добавление 1, 2 или нескольких аминокислот на основе аминокислотной последовательности модифицированных пептидов из MELK-A24-9-87_WT (SEQ ID NO: 6).

При использовании A24-типа HLA-антигена для экзосомы по настоящему изобретению, находят применение пептиды, содержащие последовательность любой из SEQ ID NO: 35-45.

[0077] VI. Антиген-презентирующие клетки (АПК)

В настоящем изобретении также предлагаются выделенные АПК, которые презентируют на своей поверхности комплексы, образованные между HLA-антигенами и пептидами по настоящему изобретению. АПК могут быть получены от пациентов, которые являются субъектами для лечения и/или предотвращения заболевания, и клетки могут вводиться в качестве вакцин сами по себе или в комбинации с другими лекарственными средствами, включающими пептиды по настоящему изобретению, экзосомы или ЦТЛ.

[0078] АПК не ограничиваются конкретным типом клеток и включают дендритные клетки (DC), клетки Лангерганса, макрофаги, B-клетки и активированные T-клетки, которые, как известно, презентируют на своей клеточной поверхности белковоподобные антигены так, чтобы их распознавали лимфоциты. Так как DC являются частными представителями АПК, обладающими самой сильной функцией индуцирования ЦТЛ среди АПК, то DC находят применение в качестве АПК по настоящему изобретению.

Например, АПК по настоящему изобретению могут быть получены путем индуцирования DC из моноцитов периферической крови и затем путем их контакта (стимулирования) с пептидами по настоящему изобретению in vitro, ex vivo или in vivo. Когда пептиды по настоящему изобретению вводят субъекта, АПК, которые презентрируют пептиды по настоящему изобретению, индуцируются в организме субъекта. Термин "индуцирование АПК" включает контакт (стимулирование) клетки с использованием пептидов по настоящему изобретению или нуклеотидов, кодирующих пептиды по настоящему изобретению для презентации на клеточной поверхности комплексов, образованных между HLA-антигенами и пептидами по настоящему изобретению. Таким образом, АПК по настоящему изобретению могут быть получены путем забора АПК у субъекта после введения ему пептидов по настоящему изобретению. Альтернативно, АПК по настоящему изобретению могут быть получены путем приведения АПК, собранных у субъекта, в контакт с пептидом по настоящему изобретению.

[0079] АПК по настоящему изобретению индивидуально или в комбинации с другими лекарственными средствами, включающими пептиды, экзосомы или ЦТЛ по настоящему изобретению, могут вводиться субъекту для индуцирования у него иммунного ответа против рака. Например, ex vivo введение может включать стадии:

a: забор АПК у первого субъекта,

b: приведение АПК стадии a в контакт с пептидом, и

c: введение АПК стадии b второму субъекту.

[0080] Первый субъект и второй субъект могут быть одним и тем же индивидуумом или могут быть разными индивидуумами. Альтернативно, согласно настоящему изобретению предлагается применение пептидов по настоящему изобретению для производства фармацевтической композиции, индуцирующей антиген-презентирующие клетки. Кроме того, в настоящем изобретении предлагается способ или процесс производства фармацевтической композиции, индуцирующей антиген-презентирующие клетки. Кроме того, также в настоящем изобретении предлагаются пептиды по настоящему изобретению для индуцирования антиген-презентирующих клеток. АПК, полученные с помощью стадии b, могут вводиться в качестве вакцины для лечения и/или предотвращения эндометриоза или рака, примеры которого включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC.

[0081] Также в настоящем изобретении предлагается способ или процесс производства фармацевтической композиции для индуцирования АПК, где способ включает стадию примешивания или включения в состав пептида по изобретению вместе с фармацевтически приемлемым носителем.

Согласно аспекту настоящего изобретения, АПК обладают высоким уровнем способности индуцирования ЦТЛ. В термине "высокий уровень способности индуцирования ЦТЛ", имеется в виду высокий уровень относительно уровня, при котором АПК не контактируют с пептидом или пептидами и не могут индуцировать ЦТЛ. Такие АПК, обладающие высоким уровнем способности индуцирования ЦТЛ, могут быть получены с помощью способа, который включает стадию переноса полинуклеотида, кодирующего пептид по настоящему изобретению, в АПК in vitro, а также способом, упомянутым выше. Вводимые гены могут быть представлены в форме ДНК или РНК. Примеры методов введения включают без конкретных ограничений, различные методы, обычно осуществляемые в данной области, такие как липофекция, электропорация и кальций фосфатный метод. Более конкретно, введение может осуществляться, как описано в Cancer Res 1996, 56: 5672-7; J Immunol 1998, 161: 5607-13; J Exp Med 1996, 184: 465-72; Опубликованный Японский Перевод Международной Заявки № 2000-509281. При переносе гена в АПК, ген подвергается в клетке транскрипции, трансляции и так далее, и затем полученный белок процессируется с помощью MHC класса I или II и проходит через путь презентации пептидов.

[0082] VII. Цитотоксические Т-лимфоциты (ЦТЛ)

ЦТЛ, индуцированные против любого из пептидов по настоящему изобретению, усиливают иммунный ответ, направленный на раковые клетки in vivo, и таким образом, они могут использоваться в качестве вакцин по существу аналогично пептидам. Таким образом, в настоящем изобретении также предлагаются выделенные ЦТЛ, которые специфично индуцируются и активируются любым из пептидов по настоящему изобретению.

Такие ЦТЛ могут быть получены с помощью (1) введения пептида(ов) по настоящему изобретению субъекту, с забором ЦТЛ у субъекта; или (2) контакта (стимулирования) выделенных у субъекта АПК и CD8-положительных клеток или мононуклеаров периферической крови in vitro с использованием пептида(ов) по настоящему изобретению и затем с помощью выделения ЦТЛ; или (3) с помощью контакта CD8-положительных клеток или мононуклеаров периферической крови in vitro с АПК или экзосомами, презентирующими комплекс HLA-антигена и пептида по настоящему изобретению на своей поверхности, и затем с помощью выделения ЦТЛ; или (4) с помощью введения в ЦТЛ гена, включающего полинуклеотид, кодирующий субъединицу T-клеточного рецептора (TCR), связывающегося с пептидом по настоящему изобретению. Вышеупомянутые АПК и эккзосомы могут быть получены с помощью методов, описанных выше, а метод (4) подробно описан ниже в разделе "VIII. T-клеточный рецептор (TCR)".

[0083] ЦТЛ по настоящему изобретению могут быть получены от пациентов, которые являются субъектами для лечения и/или предотвращения заболевания, и клетки могут вводиться сами по себе или в комбинации с другими лекарственными средствами, включающими пептиды по настоящему изобретению или экзосомы, с целью получения регулирующих эффектов. Полученные ЦТЛ действуют специфически против клеток-мишеней, презентирующих пептиды по настоящему изобретению, например, такие же пептиды, которые используются для индуцирования. Клетки-мишени могут представлять собой клетки, которые эндогенно экспрессируют MELK, такие как клетки рака или клетки эндометриоза, или клетки, трансфицированные геном MELK; и клетки, которые презентируют пептид по настоящему изобретению на клеточной поверхности благодаря стимулированию с помощью пептида, также могут служить в качестве мишеней атаки активированных ЦТЛ.

[0084] VIII. T-клеточный рецептор (TCR)

В настоящем изобретении также предлагается композиция, содержащая нуклеиновые кислоты, кодирующие полипептиды, которые способны к образованию субъединицы T-клеточного рецептора (TCR), и предлагаются способы ее применения. Субъединицы TCR обладают способностью образовывать TCR, которые придают специфичность T-клеткам против опухолевых клеток, экспрессирующих MELK. При использовании методов, известных в данной области, могут быть идентифицированы нуклеиновые кислоты альфа- и бета-цепей в качестве субъединиц TCR ЦТЛ, индуцированных с помощью одного или более пептидов по настоящему изобретению (WO2007/032255 и Morgan et al., J Immunol, 171, 3288 (2003)). Например, метод ПЦР является предпочтительным для анализа TCR. В частности ПЦР-праймеры для анализа могут представлять собой, например, праймеры 5'-R (5'-gtctaccaggcattcgcttcat-3') в качестве 5'-праймеров (SEQ ID NO: 49) и праймеры 3-TRa-C (5'-tcagctggaccacagccgcagcgt-3'), специфичные к С-участку альфа цепи TCR (SEQ ID NO: 50), праймеры 3-TRb-C1 (5'-tcagaaatcctttctcttgac-3'), специфичные к С1-участку бета-цепи TCR (SEQ ID NO: 51), или праймеры 3-TRbeta-C2 (5'-ctagcctctggaatcctttctctt-3'), специфичные к С2-участку бета-цепи TCR (SEQ ID NO: 52), в качестве 3'-праймеров. Производные TCR могут связываться с клетками-мишенями, представляющими модифицированный пептид MELK, с высокой авидностью, и необязательно опосредуют эффективное уничтожение клеток-мишеней, презентирующих модифицированный пептид MELK, in vivo и in vitro.

[0085] Нуклеиновые кислоты, кодирующие субъединицы TCR, могут быть включены в подходящие векторы, например, в ретровирусные векторы. Эти векторы хорошо известны из уровня техники. Нуклеиновые кислоты или векторы, их содержащие, могут эффективно переносится в T-клетку, например, в T-клетку пациента. Предпочтительно, в изобретении предлагается готовая для использования композиция, дающая возможность быстрой модификации собственных Т-клеток пациента (или клеток другого млекопитающего) для быстрого и легкого получения модифицированных T-клеток, обладающих превосходными свойствами уничтожения раковых клеток.

[0086] Специфичный TCR - это рецептор, способный специфично распознавать комплекс пептида по настоящему изобретению и HLA-молекулы, придавая T-клетке специфическую активность против клетки-мишени, когда TCR находится на поверхности T-клетки. Специфичное распознавание вышеописанного комплекса может подтверждаться любыми известными методами, и предпочтительные методы включают, например, анализ тетрамера с использованием HLA-молекулы и пептида по изобретению, и анализа иммуноферментных пятен. При осуществлении анализа иммуноферментных пятен, может быть подтверждено, что T-клетка, экспрессирующая на клеточной поверхности TCR, распознает клетку с помощью TCR, и что сигнал передается внутриклеточно. Подтверждение того, что вышеупомянутый комплекс может придавать T-клетке цитотоксическую активность, когда комплекс присутствует на поверхности Т-клетки, также может проводиться с помощью известного метода. Предпочтительный метод включает, например, определение цитотоксической активности против HLA-положительной клетки-мишени, такой метод, как анализ высвобождения хрома.

[0087] Кроме того, в настоящем изобретении предлагаются ЦТЛ, которые получают путем трансдукции с использованием нуклеиновых кислот, кодирующих полипептидные субъединицы TCR, которые связываются с модифицированным пептидом MELK, например, последовательности SEQ ID NO:35-45 в контексте HLA-A24. Трансдуцированные ЦТЛ способны к наведению на раковые клетки in vivo и могут наращиваться с помощью хорошо известных методов in vitro-культивирования (например, Kawakami et al., J Immunol., 142, 3452-3461 (1989)). ЦТЛ по изобретению могут использоваться для образования иммуногенной композиции, применяемой в лечении или предотвращении рака у пациента, нуждающегося в терапии или в иммунной защите (WO2006/031221).

[0088] Предотвращение и профилактика включают любую активность, которая снижает нагрузку смертности или заболеваемости этим заболеванием. Предотвращение и профилактика может иметь место "на первичном, вторичном или третичном уровне предотвращения". В то время как первичное предотвращение и профилактика избегают развития заболевания, вторичный и третичный уровни предотвращения и профилактики охватывают активности, цель которых предотвращение и профилактика прогрессии заболевания и проявления симптомов, а также уменьшение негативного вклада уже имеющегося заболевания путем восстановления функции и уменьшения степени осложнений, связанных с заболеванием. Альтернативно, предотвращение и профилактика включают широкий спектр профилактических терапий, цель которых облегчение тяжести конкретного расстройства, например, уменьшение пролиферации и метастазирования опухолей или эндометриоза, уменьшение ангиогенеза.

[0089] Лечение для профилактики рака и/или предотвращение его послеоперационного рецидива может включать одну или более из следующих стадий, таких как хирургическое удаление раковых клеток, ингибирование роста раковых клеток, инволюция или регрессия опухоли, индуцирование ремиссии и суппрессия проявления рака, регрессия опухоли и уменьшение или ингибирование метастазирования. Эффективное лечение и/или профилактика рака снижает смертность и улучшает прогноз индивидуумов, имеющих раковое заболевание, снижает уровень опухолевых маркеров в крови и облегчает детектируемые симптомы, сопровождающие рак. Например, снижение или ослабление симптомов, составляющих эффективное лечение и/или профилактику, включает снижение или ослабление на 10%, 20%, 30% или более, или представляет собой стабилизацию заболевания.

[0090] IX. Фармацевтические вещества или композиции

Так как экспрессия MELK специфически повышается при эндометриозе и при раковых заболеваниях, включающих рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC, по сравнению с здоровыми тканями, то пептиды по настоящему изобретению или полинуклеотиды, кодирующие такие пептиды, могут использоваться для лечения и/или профилактики эндометриоза и рака или опухоли и/или для предотвращения их рецидива. Таким образом, в настоящем изобретении для лечения и/или профилактики рака, опухоли или эндометриоза и/или для предотвращения их послеоперационного рецидива предлагается фармацевтическое вещество или композиция, которая включает в качестве активного ингредиента один или более пептидов по настоящему изобретению или полинуклеотиды, кодирующие эти пептиды. Альтернативно, пептиды по настоящему изобретению могут экспрессироваться на поверхности любых из вышеупомянутых экзосом или клеток, таких как АПК, для применения в качестве фармацевтических веществ или композиций. Кроме того, вышеупомянутые ЦТЛ, которые нацелены на любые из пептидов по изобретению, также могут использоваться в качестве активного ингредиента фармацевтических веществ или композиций по настоящему изобретению.

[0091] Фармацевтические композиции по настоящему изобретению также могут находить применение в качестве вакцин. В контексте настоящего изобретения термин "вакцина" (также обозначаемый как "иммуногенная композиция") обозначает вещество, которое обладает функцией индуцирования противоопухолевого иммунитета при введении животным.

Фармацевтические композиции по настоящему изобретению могут использоваться для лечения и/или предотвращения раковых заболеваний или эндометриоза и/или для предотвращения их послеоперационных рецидивов у субъектов или пациентов, включающих человека и любое другое млекопитающее, включающее, в частности, мышь, крысу, морскую свинку, кролика, кошку, собаку, овцу, козу, свинью, крупный рогатый скот, лошадь, обезьяну, бабуина и шимпанзе, особенно коммерчески важное животное или домашнее животное.

[0092] В другом воплощении, в настоящем изобретении также предлагается применение активного ингредиента в производстве фармацевтической композиции или вещества для лечения рака, опухоли или эндометриоза, причем указанный активный ингредиент выбран среди:

(a) пептида по настоящему изобретению;

(b) нуклеиновой кислоты, кодирующую такой пептид, раскрытый в данном документе, в экспрессирующейся форме;

(c) АПК или экзосомы, презентирующей петид по настоящему изобретению на своей поверхности; и

(d) цитотоксической T-клетки по настоящему изобретению.

[0093] Альтернативно, в настоящем изобретении также предлагается активный ингредиент для применения в лечения рака, опухоли или эндометриоза, причем указанный активный ингредиент выбран среди:

(a) пептида по настоящему изобретению;

(b) нуклеиновой кислоты, кодирующую такой пептид, раскрытый в данном документе, в экспрессирующейся форме;

(c) АПК или экзосомы, презентирующей петид по настоящему изобретению на своей поверхности; и

(d) цитотоксической T-клетки по настоящему изобретению.

[0094] Альтернативно, в настоящем изобретении дополнительно предлагается способ или процесс производства фармацевтической композиции или вещества для лечения рака, опухоли или эндометриоза, где способ или процесс включает стадию включения в состав фармацевтически или физиологически приемлемого носителя вместе с активным ингредиентом, выбранным среди:

(a) пептида по настоящему изобретению;

(b) нуклеиновой кислоты, кодирующую такой пептид, раскрытый в данном документе, в экспрессирующейся форме;

(c) АПК или экзосомы, презентирующей петид по настоящему изобретению на своей поверхности; и

(d) цитотоксической T-клетки по настоящему изобретению.

[0095] В другом воплощении, в настоящем изобретении также предлагается способ или процесс производства фармацевтической композиции или вещества для лечения рака, опухоли или эндометриоза, где способ или процесс включает стадии примешивания активного ингредиента вместе с фармацевтически или физиологически приемлемым носителем, где активный ингредиент выбран среди:

(a) пептида по настоящему изобретению;

(b) нуклеиновой кислоты, кодирующую такой пептид, раскрытый в данном документе, в экспрессирующейся форме;

(c) АПК или экзосомы, презентирующей петид по настоящему изобретению на своей поверхности; и

(d) цитотоксической T-клетки по настоящему изобретению.

[0096] Альтернативно, в настоящем изобретении также предлагается вещество для индуцирования ЦТЛ, где вещество состоит из одного или более пептидов по настоящему изобретению, или из одного или более полинуклеотидов по настоящему изобретению.

Альтернативно, фармацевтическая композиция или вещество по настоящему изобретению могут использоваться как для профилактики рака, опухоли или эндометриоза, так и для предотвращения их послеоперационного рецидива.

[0097] Фармацевтические вещества или композиции по настоящему изобретению находят свое применение в качестве вакцины. Как отмечено выше, в контексте настоящего изобретения термин "вакцина" (также обозначаемый как "иммуногенная композиция") обозначает вещество, которое обладает функцией индуцирования противоопухолевого иммунитета при введении животным.

Фармацевтические вещества или композиции по настоящему изобретению могут использоваться для лечения и/или предотвращения раковых заболеваний, опухолей или эндометриоза и/или для предотвращения их послеоперационных рецидивов у субъектов или пациентов, включающих человека и любое другое млекопитающее, включающее, в частности, мышь, крысу, морскую свинку, кролика, кошку, собаку, овцу, козу, свинью, крупный рогатый скот, лошадь, обезьяну, бабуина и шимпанзе, особенно коммерчески важное животное или домашнее животное.

[0098] Согласно настоящему изобретению, было обнаружено, что пептиды, имеющие аминокислотную последовательность, выбранную среди SEQ ID NO: 35-45, представляют собой рестриктированные по HLA-A24 эпитопные пептиды или их кандидаты, которые могут индуцировать мощный и специфичный иммунный ответ. Таким образом, фармацевтические вещества или композиции по настоящему изобретению, которые включают любые из пептидов, имеющие аминокислотные последовательности SEQ ID NO:35-45, особенно подходят для введения субъектам, чей HLA-антиген представляет собой HLA-A24. То же самое применяется к фармацевтическим веществам и композициям, которые включают полинуклеотиды, кодирующие эти пептиды (т.e., полинуклеотиды по настоящему изобретению).

[0099] Раковые заболевания, опухоли или эндометриоз, которые подвергаются лечению с помощью фармацевтических веществ или композиций по настоящему изобретению, ничем не ограничиваются и включают все типы заболеваний, в которые вовлечен MELK, включающие, в частности, эндометриоз, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC.

[0100] Фармацевтические вещества или композиции по настоящему изобретению могут содержать дополнительно к вышеупомянутым активным ингредиентам другие пептиды, которые обладают способностью индуцировать ЦТЛ против раковых клеток, другие полинуклеотиды, кодирующие другие пептиды, другие клетки, которые презентируют другие пептиды и так далее. В данном документе, другие пептиды, которые обладают способностью индуцировать ЦТЛ против раковых клеток, представлены в качестве примера опухолеспецифическими антигенами (например, идентифицированными TAA), но не ограничены ими.

[0101] Если необходимо, фармацевтические вещества или композиции по настоящему изобретению необязательно могут включать другие терапевтические вещества в качестве активного ингредиента, при условии, что вещество не ингибирует противоопухолевого эффекта активного ингредиента, например, любого из пептидов по настоящему изобретению. Например, составы могут включать противовоспалительные вещества, обезболивающие средства, химиотерапевтические средства и так далее. Дополнительно к включению других терапевтических веществ в лекарственное средство, лекарственные средства по настоящем изобретению также могут вводиться последовательно или одновременно с одним или несколькими другими фармакологическими веществами. Количества лекарственного средства и фармакологического вещества зависят, например, от того, какого типа используется фармакологическое вещество, от заболевания, подвергаемого лечению, и от графика и путей введения.

Следует понимать, что дополнительно к ингредиентам, конкретно упомянутым в данном документе, фармацевтические вещества или композиции по настоящему изобретению могут включать другие стандартные вещества, имеющие отношение к типу рассматриваемого состава.

[0102] В одном воплощении настоящего изобретения, фармацевтические вещества или композиции по настоящему изобретению могут быть включены в готовые изделия и в наборы реагентов, содержащие материалы, применяемые для лечения патологических состояний заболевания, подвергаемого лечению, например, рака или эндометриоза. Готовое изделие может включать контейнер с любым из фармацевтических веществ или композиций по настоящему изобретению, и маркировку. Подходящие контейнеры включают бутылки, флаконы и пробирки. Контейнеры могут быть сделаны из различных материалов, таких как стекло или пластик. Маркировка на контейнере должна включать вещество, используемое для лечения или предотвращения одного или нескольких патологических состояний заболевания. Маркировка также может указывать руководство по введению и так далее.

[0103] Дополнительно к контейнеру, описанному выше, набор реагентов, включающий фармацевтическое вещество или композицию по настоящему изобретению, необязательно может дополнительно включать второй контейнер, содержащий фармацевтически приемлемый разбавитель. Изделие может дополнительно включать другие материалы, целесообразные с коммерческой и пользовательской точки зрения, включая другие буферы, разбавители, фильтры, иглы, шприцы и листки-вкладыши с инструкцией по применению.

Фармацевтические вещества или композиции могут, если это целесообразно, быть представлены в упаковке или в устройстве с дозатором, которое может содержать одну или более дозированных лекарственных форм, содержащих активный ингредиент. Упаковка может, например, включать металлическую фольгу или пластиковую пленку, такую как блистерная упаковка. Упаковка или устройство с дозатором может быть сопровождена инструкциями по введению.

[0104] (1) Фармацевтические вещества или композиции, содержащие пептиды в качестве активного ингредиента

Пептиды по настоящему изобретению могут вводиться непосредственно в виде фармацевтического вещества или композиции или, если необходимо, могут быть включены в состав с помощью стандартных методов составления композиций. В последнем случае, дополнительно к пептидам по настоящему изобретению могут быть включены по необходимости без всяких ограничений носители, вспомогательные вещества и тому подобное, которые обычно используются для лекарственных средств. Примеры таких носителей представляют собой стерильную воду, физиологический солевой раствор, фосфатный буфер, культуральную жидкость и так далее. Кроме того, фармацевтические вещества или композиции могут при необходимости содержать стабилизаторы, суспензии, консерванты, поверхностно-активные вещества и так далее. Фармацевтические вещества или композиции по настоящему изобретению могут использоваться в противораковой терапии.

[0105] Пептиды по настоящему изобретению могут быть получены в виде комбинации, состоящей из двух или более пептидов по настоящему изобретению, для индуцирования ЦТЛ in vivo. Пептидная комбинация может принимать форму коктейля, или они могут быть конъюгированы друг с другом с использованием стандартных методов. Например, пептиды могут быть химически связаны или могут экспрессироваться в виде одной сшитой полипептидной последовательности. Пептиды в комбинации могут быть одинаковыми или различными. При введении пептидов по настоящему изобретению, пептиды презентируются с высокой плотностью с помощью HLA-антигенов на АПК, затем индуцируются ЦТЛ, которые специфично реагируют с комплексом, образованным между представленным пептидом и HLA-антигеном. Альтернативно, у субъектов проводят забор АПК (например, DC) и затем стимулируют их с помощью пептидов по настоящему изобретению для получения АПК, которые презентируют любой из пептидов по изобретению на своей клеточной поверхности. Эти АПК повторно вводят субъектам для индуцирования у них ЦТЛ, и в результате может повышаться агрессивность по отношению к опухолеспецифичному эндотелию.

[0106] Фармацевтические вещества или композиции для лечения и/или предотвращения рака, опухоли или эндометриоза, которые включают пептид по настоящему изобретению в качестве активного ингредиента, также могут включать адъювант, который, как известно, эффективно индуцирует клеточный иммунитет. Альтернативно, фармацевтические вещества или композиции могут вводиться вместе с другими активными ингредиентами или могут вводиться путем их включения в состав гранул. Адъювант относится к соединению, которое усиливает иммунный ответ против белка при введении вместе (или последовательно) с белком, обладающим иммунологической активностью. Адъюванты, предлагаемые в данном документе, включают те, которые описаны в литературе (Clin Microbiol Rev 1994, 7: 277-89). Примеры подходящих адъювантов могут включать, в частности, фосфат алюминия, гидроксид алюминия, алюминиевые квасцы, холерный токсин, токсин сальмонеллы.

Кроме того, могут стандартным образом использоваться липосомные составы, гранулярные составы, в которых пептид связан с гранулами диаметром несколько микрометров, и составы, в которых липид связан с пептидом.

[0107] В другом воплощении настоящего изобретения, пептиды по настоящему изобретению также могут вводиться в форме фармацевтически приемлемой соли. Предпочтительные примеры солей включают соли с щелочным металлом, соли с металлом, соли с органическим основанием, соли с органической кислотой и соли с неорганической кислотой. При использовании в данном документе, "фармацевтически приемлемая соль" относится к тем солям, которые сохраняют биологическую эффективность и свойства соединения, и которые получают путем реакции с неорганическими кислотами или основаниями, такими как соляная кислота, бромоводородная кислота, серная кислота, азотная кислота, фосфорная кислота, метансульфокислота, этансульфокислота, п-толуолсульфокислота, салициловая кислота и так далее.

[0108] В некоторых воплощениях, фармацевтические вещества или композиции по настоящему изобретению могут дополнительно включать компонент, который праймирует ЦТЛ. Липиды были идентифицированы в качестве веществ, способных праймировать ЦТЛ in vivo против вирусных антигенов. Например, остатки пальмитиновой кислоты могут быть присоединены к эпсилон- и альфа-аминогруппам остатка лизина и затем могут быть соединены с пептидом по настоящему изобретению. Липидированный пептид может затем вводиться либо непосредственно в мицеллу или частицу, инкорпорированную в липосому, либо может эмульгироваться в адъюванте. В качестве другого примера липидного праймирования ответа ЦТЛ для праймирования ЦТЛ могут использоваться липопротеины E. coli, такие как трипальмитоил-S-глицерилцистеинил-серин-серин (P3CSS), при ковалентном присоединении к соответствующему пептиду (см., например, Deres et al., Nature 1989, 342: 561-4).

[0109] Метод введения может быть пероральным, внутрикожным, подкожным, внутривенной инъекцией и так далее, также введение может быть системным или местным поблизости от целевых сайтов. Введение может осуществляться посредством однократного введения или может быть накопительным посредством многократных введений. Дозировка пептидов по настоящему изобретению может соответственно регулироваться согласно заболеванию, подвергаемому лечению, возрасту пациента, весу, методу введения и так далее, и, как правило, составляет 0,001 мг - 1000 мг, например, 0,1 мг - 10 мг, и может вводиться один раз в период от нескольких дней до нескольких месяцев. Специалист в данной области может соответствующим образом выбрать подходящую дозу.

[0110] (2) Фармацевтические вещества или композиции, содержащие полинуклеотиды в качестве активного ингредиента

Фармацевтические вещества или композиции по настоящему изобретению также могут содержать нуклеиновые кислоты, кодирующие пептиды, раскрытые в данном документе, в экспрессирующейся форме. В данном документе термин "в экспрессирующейс форме" обозначает, что полинуклеотид при введении в клетку будет экспрессироваться in vivo в виде полипептида, который индуцирует противоопухолевый иммунитет. В типичном воплощении, последовательность нуклеиновой кислоты полинуклеотида, представляющего интерес, включает регуляторные элементы, необходимые для экспрессии полинуклеотида. Полинуклеотид(ы) может быть сконструирован для достижения стабильной вставки в геном клетки-мишени (см., например, Thomas KR & Capecchi MR, Cell 1987, 51: 503-12 на предмет описания векторов с кассетой гомологичной рекомбинации). См., например, Wolff et al., Science 1990, 247: 1465-8; патент США № 5580859; 5589466; 5804566; 5739118; 5736524; 5679647; и WO 98/04720. Примеры технологий доставки на основе ДНК включают "депротеинизированную ДНК", облегченную доставку (с использованием бупивакаина, полимеров, опосредованную пептидами), доставку с использованием катионных липидных комплексов и опосредованную частицами ("генная пушка") или доставку, опосредованную давлением (см., например, патент США № 5922687).

[0111] Пептиды по изобретению также могут экспрессироваться с помощью вирусных или бактериальных векторов. Примеры экспрессирующих векторов включают ослабленных вирусных хозяев, таких как вирус вакцинии или вирус оспы птиц. Данный способ включает применение вируса вакцинии, например, в качестве вектора для экспрессии нуклеотидных последовательностей, которые кодируют пептид. При введении хозяину, рекомбинантный вирус вакцинии экспрессирует иммуногенный пептид и таким образом вызывает иммунный ответ. Векторы на основе вакцин и методы, используемые в протоколах иммунизации, описаны, например, в патенте США № 4722848. Другой вектор - это BCG (бацилла Кальметта-Герена). Векторы BCG описаны в Stover et al., Nature 1991, 351: 456-60. Известен широкий спектр других векторов, применяемых для терапевтического введения или иммунизации, например, аденовирусные векторы или аденоассоциированные вирусные векторы, ретровирусные векторы, векторы на основе Salmonella typhi, векторы на основе детоксифицированного токсина сибирской язвы и так далее. См., например, Shata et al., Mol Med Today 2000, 6: 66-71; Shedlock et al., J Leukoc Biol 2000, 68: 793-806; Hipp et al., In Vivo 2000, 14: 571-85.

Доставка полинуклеотида субъекту может быть прямой, в случае которой субъект непосредственно подвергается воздействию вектора, несущего полинуклеотид, или косвенной, в случае которой сначала клетки трансформируют с помощью полинуклеотида, представляющего интерес, in vitro, затем клетки трансплантируются субъекту. Эти два способа известны, соответственно, как способы генной терапии in vivo и ex vivo.

[0112] Для общих сведений о способах генной терапии см. Goldspiel et al., Clinical Pharmacy 1993, 12: 488-505; Wu and Wu, Biotherapy 1991, 3: 87-95; Tolstoshev, Ann Rev Pharmacol Toxicol 1993, 33: 573-96; Mulligan, Science 1993, 260: 926-32; Morgan & Anderson, Ann Rev Biochem 1993, 62: 191-217; Trends in Biotechnology 1993, 11(5): 155-215). Методы с использованием технологии рекомбинантной ДНК, хорошо известные из уровня техники, которые также могут использоваться в настоящем изобретении, описаны в литературе Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, NY, 1993; and Krieger, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY, 1990.

[0113] Метод введения может быть пероральным, внутрикожным, подкожным, внутривенной инъекцией и так далее, также находит применение системное введение или местное введение поблизости от целевых сайтов. Введение может осуществляться посредством однократного введения или может быть накопительным посредством многократных введений. Дозировка полинуклеотида в подходящем носителе или дозировка клеток, трансформированных полинуклеотидом, кодирующим пептиды по изобретению, может соответственно регулироваться согласно заболеванию, подвергаемому лечению, возрасту пациента, весу, методу введения и так далее, и, как правило, составляет 0,001 мг - 1000 мг, например, 0,1 мг - 10 мг, и может вводиться один раз в период от нескольких дней до нескольких месяцев. Специалист в данной области может соответствующим образом выбрать подходящую дозу.

[0114] X. Способы, использующие пептиды, экзосомы, АПК и ЦТЛ

Пептиды и полинуклеотиды по настоящему изобретению могут использоваться для индуцирования АПК и ЦТЛ. Экзосомы и АПК по настоящему изобретению также могут использоваться для индуцирования ЦТЛ. Пептиды, полинуклеотиды, экзосомы и АПК могут использоваться в комбинации с любыми другими соединениями при условии, что дополнительные соединения не ингибируют способности индуцирования ЦТЛ. Таким образом, вышеупомянутые фармацевтические вещества или композиции по настоящему изобретению могут использоваться для индуцирования ЦТЛ. Дополнительно к ним также для индуцирования APC могут использоваться вещества, включающие пептиды и полинуклеотиды, как обсуждается ниже.

[0115] (1) Способ индуцирования антиген-презентирующих клеток (АПК)

В настоящем изобретении предлагаются способы индуцирования АПК с высокой способностью индуцирования ЦТЛ с использованием пептидов или полинуклеотидов по настоящему изобретению.

Способы по настоящему изобретению включают стадию приведения АПК в контакт с пептидами по настоящему изобретению in vitro, ex vivo или in vivo. Например, способ приведения АПК в контакт с пептидами ex vivo может включать стадии:

a: забор АПК у субъекта, и

b: приведение АПК стадии a в контакт с пептидом.

АПК не ограничиваются конкретным типом клеток и включают дендритные клетки (DC), клетки Лангерганса, макрофаги, B-клетки и активированные T-клетки, которые, как известно, презентируют на своей клеточной поверхности белковоподобные антигены так, чтобы их распознавали лимфоциты. DC могут предпочтительно использоваться благодаря их самой сильной способности индуцирования ЦТЛ среди АПК. Любые пептиды по настоящему изобретению могут использоваться в качестве пептида стадии b сами по себе или в комбинации с другими пептидами по изобретению.

[0116] Альтернативно, пептиды по настоящему изобретению могут вводиться субъекту для контакта пептидов с АПК in vivo. Затем АПК с высокой способностью индуцирования ЦТЛ могут индуцироваться в организме субъекта. Таким образом, в изобретении также предлагается способ введения пептидов по настоящему изобретению субъекту для индуцирования АПК in vivo. Также возможно введение субъекту полинуклеотидов, кодирующих пептиды по настоящему изобретению, в экспрессирующейся форме, так что пептиды по настоящему изобретению экспрессируются и контактируют с APC in vivo, индуцируя впоследствии АПК с высокой способностью индуцирования ЦТЛ в организме субъекта. Таким образом, в изобретении также предлагается способ введения полинуклеотидов по настоящему изобретению субъекту для индуцирования АПК in vivo. Термин "экспрессирующаяся форма" определен выше в разделе "IX. Фармацевтические вещества (2) Фармацевтические вещества, содержащие полинуклеотиды в качестве активного ингредиента".

[0117] Кроме того, настоящее изобретение включает введение полинуклеотида по настоящему изобретению в АПК для индуцирования APC со способностью индуцирования CTL. Например, способ может включать стадии:

a: забор АПК у субъекта, и

b: введение полинуклеотида, кодирующего пептид по настоящему изобретению.

Стадия b может осуществляться, как описано выше в разделе "VI. Антиген-презентирующие клетки".

[0118] Альтернативно, в настоящем изобретении предлагается способ получения антиген-презентирующей клетки (АПК), которая специфично индуцирует активность ЦТЛ против MELK, где способ может включать одну из следующих стадий:

(a) приведение АПК в контакт с пептидом по настоящему изобретению in vitro, ex vivo или in vivo; и

(b) введение полинуклеотида, кодирующего пептид по настоящему изобретению, в АПК.

[0119] (2) Способ индуцирования ЦТЛ

В настоящем изобретении также предлагаются способы индуцирования ЦТЛ с использованием пептидов, полинуклеотидов или экзосом или АПК по настоящему изобретению.

В настоящем изобретении также предлагаются способы индуцирования ЦТЛ с использованием полинуклеотида, кодирующего полипептид, который способен к образованию субъединицы Т-клеточного рецептора (TCR), распознающего комплекс пептидов по настоящему изобретению и HLA-антигенов. Предпочтительно, способы индуцирования ЦТЛ включают, по меньшей мере, одну стадию, выбранную среди:

a: приведения CD8-положительной T-клетки в контакт с антиген-презентирующей клеткой и/или экзосомой, которые презентируют на своей поверхности комплекс HLA-антигена и пептида по настоящему изобретению; и

b: введения в CD8-положительную клетку полинуклеотида, кодирующего полипептид, который способен образовывать субъединицу TCR, распознающую комплекс пептида по настоящему изобретению и HLA-антигена.

Когда пептиды, полинуклеотиды, АПК или экзосомы по настоящему изобретению вводят субъекту, то ЦТЛ индуцируются в организме субъекта, и сила иммунного ответа, направленного на раковые клетки, повышается. Таким образом, в настоящем изобретении также предлагается способ, который включает стадию введения пептидов, полинуклеотидов, АПК или экзосом по настоящему изобретению субъекту для индуцирования ЦТЛ.

[0120] Альтернативно, ЦТЛ также могут индуцироваться с помощью их применения ex vivo. В таком случае, после индуцирования ЦТЛ активированные ЦТЛ должны быть возвращены субъекту. Например, способ по настоящему изобретению для индуцирования ЦТЛ может включать стадии:

a: забор АПК у субъекта;

b: приведение АПК стадии a) в контакт с пептидом; и

c: совместное культивирование АПК стадии b) с CD8-положительными клетками.

АПК, совместно культивируемые вместе с CD8-положительными клетками на вышеописанной стадии c, могут быть получены путем переноса гена, который включает полинуклеотид по настоящему изобретению, в АПК, как описано выше в разделе "VI. Антиген-презентирующие клетки", хотя настоящее изобретение этим не ограничивается и могут использоваться любые АПК для способа по настоящему изобретению, которые эффективно презентируют на своей поверхности комплекс HLA-антигена и пептида по настоящему изобретению.

[0121] Вместо таких АПК также могут использоваться экзосомы, которые презентируют на своей поверхности комплекс HLA-антигена и пептида по настоящему изобретению. А именно, в настоящем изобретении также предлагается способ, где экзосомы, презентирующие на своей поверхности комплекс HLA-антигена и пептида по настоящему изобретению, совместно культивируются с CD8-положительными клетками. Такие экзосомы могут быть получены с помощью способов, описанных выше в разделе "V. Экзосомы".

Кроме того, ЦТЛ могут индуцироваться путем введения CD8-положительные клетки гена, который включает полинуклеотид, кодирующий субъединицу TCR, связывающуюся с пептидом по настоящему изобретению. Такая трансдукция может осуществляться, как описано выше в разделе "VIII. T-клеточный рецептор (TCR)".

Кроме того, в настоящем изобретении предлагается способ или процесс производства фармацевтического вещества или композиции, индуцирующей ЦТЛ, где способ включает стадию примешивания или включения в состав пептида по настоящему изобретению вместе с фармацевтически приемлемым носителем.

[0122] (3) Способ индуцирования иммунного ответа

Кроме того, в настоящем изобретении предлагаются способы индуцирования иммунного ответа против заболеваний, связанных с MELK. Подходящее заболевание включает эндометриоз и раковые заболевания, примеры которых включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC.

Способы включают стадию введения веществ или композиций, содержащих любые из пептидов по настоящему изобретению или содержащих полинуклеотиды, кодирующие их. В настоящем изобретении также предлагается введение экзосом или АПК, презентирующих любые из пептидов по настоящему изобретению. Для подробного описания см. раздел "IX. Фармацевтические вещества или композиции", особенно часть, описывающую применение фармацевтических веществ и композиций по настоящему изобретению в качестве вакцин. Кроме того, экзосомы и АПК, которые могут применяться для настоящих способов индуцирования иммунного ответа, подробно описаны в разделе "V. Экзосомы", "VI. Антиген-презентирующие клетки (АПК)", и (1) и (2) из "X. Способы, использующие пептиды, экзосомы, APC и ЦТЛ", описанные выше.

[0123] Также в настоящем изобретении предлагается способ или процесс производства фармацевтического вещества или композиции, индуцирующих иммунный ответ, где способ включает стадию примешивания или включения в состав пептида по изобретению вместе с фармацевтически приемлемым носителем.

Способ включает введение вакцины по настоящему изобретению, которая содержит:

a: один или более эпитопных пептидов по настоящему изобретению или его иммунологически активный фрагмент;

b: один или более полинуклеотидов, кодирующих эпитопные пептиды или иммунологически активный фрагмент (a);

c: один или более выделенных ЦТЛ по настоящему изобретению; или

d: одну или более выделенных антиген-презентирующих клеток по настоящему изобретению.

[0124] В контексте настоящего изобретения раковое заболевание, при котором сверхэкспрессируется MELK, может быть подвергнуто лечению с использованием данных активных ингредиентов. Заболевания включают, в частности, эндометриоз, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC. Соответственно, перед введением вакцин или фармацевтических композиций, содержащих активные ингредиенты, предпочтительно подтверждение того, повышен ли уровень экспрессии MELK в клетках или тканях рака или эндометриоза, подвергаемых лечению, по сравнению с нормальными клетками того же органа. Таким образом, в одном воплощении настоящего изобретения предлагается способ лечения рака или эндометриоза, при котором (сверх)экспрессируется MELK, причем способ может включать стадии:

i) определения уровня экспрессии MELK в клетках или тканях рака или эндометриоза, полученных у субъекта, имеющего рак, подвергаемый лечению;

ii) сравнения уровня экспрессии MELK с здоровым контролем; и

iii) введения, по меньшей мере, одного компонента, выбранного из группы, состоящей из (a)-(d), описанных выше, субъекту, имеющему рак или эндометриоз, при котором сверхэкспрессируется MELK по сравнению со здоровым контролем. Альтернативно, в настоящем изобретении также предлагается вакцина или фармацевтическая композиция, содержащая, по меньшей мере, один компонент, выбранный из группы, состоящей из (a)-(d), описанных выше, для применения для введения субъекту, имеющему рак или эндометриоз, при котором сверхэкспрессируется MELK. Другими словами, в настоящем изобретении дополнительно предлагается способ идентификации субъекта, которого следует подвергнуть лечению с помощью полипептида MELK по настоящему изобретению, причем такой способ включает стадию определения уровня экспрессии MELK в клетках или тканях рака или эндометриоза, взятых у субъекта, где увеличение уровня по сравнению с нормальным контрольным уровнем гена указывает на то, что у субъекта есть рак или эндометриоз, который может подвергаться лечению с использованием полипептида MELK по настоящему изобретению. Способ лечения рака или эндометриоза по настоящему изобретению описан более подробно ниже.

Субъект, подвергаемый лечению с помощью способа по настоящему изобретению, предпочтительно является млекопитающим. Типичные млекопитающие включают, в частности, например, человека, примата, отличного от человека, мышь, крысу, собаку, кошку, лошадь и корову.

[0125] Согласно настоящему изобретению определяют уровень экспрессии MELK в клетках или тканях рака или эндометриоза, полученных от субъекта. Уровень экспрессии может определяться на уровне продукта транскрипции с использованием методов, известных из уровня техники. Например, мРНК MELK можно количественно оценить с использованием зондов с помощью методов гибридизации (например, Нозерн-гибридизация). Детектирование может быть проведено с использованием чипа или эррея. Использование эррея предпочтительно для детектирования уровня экспрессии MELK. Специалисты в данной области могут получить такие зонды с применением информации о последовательности MELK. Например, в качестве зонда может использоваться кДНК MELK. Если необходимо, зонды могут быть помечены с использованием подходящей метки, такой как красители, флуоресцентные вещества и изотопы, и уровень экспрессии гена может детектироваться как интенсивность гибридизующихся меток.

Кроме того, продукт транскрипции MELK (например, SEQ ID NO: 46) может количественно оцениваться с использованием праймеров с помощью методов детектирования на основе амплификации (например, ОТ-ПЦР). Такие праймеры могут быть получены на основе доступной информации о последовательности гена.

[0126] Конкретно, зонд или праймер, используемый для способа по настоящему изобретению, гибридизуется с мРНК MELK при жестких условиях, умеренно жестких или при условиях низкой жесткости. При использовании в данном документе, термин "жесткие условия (гибридизации)" относится к условиям, в которых зонд или праймер будет гибридизоваться со своей последовательностью-мишенью, но не с другими последовательностями. Жесткие условия являются зависимыми от последовательности и будут отличаться в различных условиях. Специфичная гибридизация более длинных последовательностей наблюдается при более высоких температурах, чем у более коротких последовательностей. Как правило, температуру жестких условий выбирают так, чтобы она была примерно на 5°C ниже, чем температура плавления (T.пл.) для конкретной последовательности при определенной ионной силе и при определенном pH. T.пл. представляет собой температуру (при определенной ионной силе, pH и концентрации нуклеиновой кислоты), при которой 50% зондов, комплементарных их последовательности-мишени, гибридизуется с последовательностью-мишенью в равновесии. Так как последовательности-мишени, как правило, присутствуют в избытке, то при T.пл. 50% зондов в равновесии заняты. Как правило, жесткие условия будут такие, при которых концентрация соли составляет менее чем примерно 1 M ионов натрия, как правило, примерно 0,01-1 M ионов натрия (или других солей) при pH 7-8,3, и температура составляет, по меньшей мере, примерно 30 градусов °C для коротких зондов или праймеров (например, 10-50 нуклеотидов) и, по меньшей мере, примерно 60 градусов °C для более длинных зондов или праймеров. Жесткие условия также могут быть достигнуты добавлением дестабилизирующих веществ, таких как формамид.

Зонды или праймеры могут быть конкретных размеров. Размеры могут колебаться от, по меньшей мере, 10 нуклеотидов, по меньшей мере, 12 нуклеотидов, по меньшей мере, 15 нуклеотидов, по меньшей мере, 20 нуклеотидов, по меньшей мере, 25 нуклеотидов, по меньшей мере, 30 нуклеотидов, и размер зондов и праймеров может колебаться от 5-10 нуклеотидов, 10-15 нуклеотидов, 15-20 нуклеотидов, 20-25 нуклеотидов и 25-30 нуклеотидов.

[0127] Альтернативно, продукт трансляции может детектироваться для диагностики по настоящему изобретению. Например, может определяться количество белка MELK (SEQ ID NO: 47). Методы определения количества белка в виде продукта трансляции включают методы иммуноанализа, которые используют антитело, специфически распознающее белок. Антитела могут быть моноклональными или поликлональными. Кроме того, для детектирования может использоваться любой фрагмент или модификация антитела (например, химерное антитело, scFv, Fab, F(ab')2, Fv, и т.д.) при условии, что фрагмент или модифицированное антитело сохраняют способность связывания с белком MELK. Методы получения этих типов антител для детектирования белков хорошо известны из уровня техники, и в настоящем изобретении может применяться любой метод для получения таких антител и их эквивалентов.

В качестве метода детектирования уровня экспрессии гена MELK на основе его продукта трансляции может измеряться интенсивность окрашивания посредством иммуногистохимического анализа с использованием антитела к белку MELK. А именно, в данном измерении сильное окрашивание указывает на повышенное присутствие белка/уровень и в то же время на высокий уровень экспрессии гена MELK.

Уровень экспрессии гена-мишени, например, гена MELK, в клетках рака или эндометриоза может определяться как увеличенный, если уровень увеличен относительно контрольного уровня (например, уровня в нормальных клетках) гена-мишени, например на 10%, 25% или 50%; или увеличен более чем в 1,1 раз, более чем в 1,5 раза, более чем в 2 раза, более чем в 5 раз, более чем в 10 раз или более.

[0128] Контрольный уровень может определяться одновременно с уровнем для клеток рака или эндометриоза с использованием образцов, ранее взятых и сохраненных у субъекта/субъектов, чье состояние заболевания (есть заболевание или нет заболевания) известно. Кроме того, в качестве нормального контроля могут использоваться нормальные клетки, полученные из здоровых областей органа, который имеет рак или эндометриоз, который следует подвергнуть лечению. Альтернативно, контрольный уровень может определяться с помощью статистического метода на основе результатов, полученных после анализа ранее определенного уровня экспрессии гена MELK в образцах субъекта, чье состояние заболевания известно. Кроме того, контрольный уровень может быть получен из базы данных профилей экспрессии из ранее тестированных клеток. Более того, согласно аспекту настоящего изобретения уровень экспрессии гена MELK в биологическом образце может сравниваться со множеством контрольных уровней, определенных из множества эталонных образцов. Предпочтительно применение контрольного уровня, определенного из эталонного образца, полученного из типа ткани, аналогичного типу ткани, из которого получен биологический образец субъекта. Более того, предпочтительно применение стандартного значения уровня экспрессии гена MELK в популяции с известным состоянием заболевания. Стандартное значение может быть получено с помощью метода известного из уровня техники. Например, интервал среднего значения ± 2 SD (стандартное отклонение) или среднее значение ± 3 SD может использоваться в качестве стандартного значения.

[0129] В контексте настоящего изобретения, контрольный уровень, определенный для биологического образца, который, как известно, является здоровым, обозначается как "нормальный контрольный уровень". С другой стороны, если контрольный уровень определяется для болезненного биологического образца, то он обозначается как "болезненный контрольный уровень".

Когда уровень экспрессии гена MELK увеличивается по сравнению с нормальным контрольным уровнем или когда он аналогичен/эквивалентен болезненному контрольному уровню, то у субъекта можно диагностировать заболевание, которое следует подвергнуть лечению.

[0130] Более конкретно, в настоящем изобретении предлагается способ (i) диагностирования того, имеется ли у субъекта рак или эндометриоз, который следует подвергнуть лечению, и/или (ii) способ отбора субъекта для лечения рака или эндометриоза, причем способ включает стадии:

a: определения уровня экспрессии MELK в клетках или тканях рака или эндометриоза, полученных у субъекта, который предположительно имеет рак или эндометриоз, который следует подвергнуть лечению;

b: сравнения уровня экспрессии MELK с нормальным контрольным уровнем;

c: диагностирование субъекта как имеющего рак или эндометриоз, который следует подвергнуть лечению, если уровень экспрессии MELK увеличен по сравнению с нормальным контрольным уровнем; и

d: отбор субъекта для лечения рака или эндометриоза, если субъект диагностируется в стадии (c) как имеющий рак или эндометриоз, который следует подвергнуть лечению.

[0131] Альтернативно, такой способ включает стадии:

a: определения уровня экспрессии MELK в клетках или тканях рака или эндометриоза, полученных у субъекта, который предположительно имеет рак или эндометриоз, который следует подвергнуть лечению;

b: сравнения уровня экспрессии MELK с болезненным контрольным уровнем;

c: диагностирование субъекта как имеющего рак или эндометриоз, который следует подвергнуть лечению, если уровень экспрессии MELK аналогичен или эквивалентен болезненному контрольному уровню; и

d: отбор субъекта для лечения рака или эндометриоза, если субъект диагностируется в стадии (c) как имеющий рак или эндометриоз, который следует подвергнуть лечению.

[0132] В настоящем изобретении также предлагается набор реагентов для определения субъекта, страдающего эндометриозом или раком, который может быть подвергнут лечению с использованием полипептида MELK по настоящему изобретению, который также может использоваться для оценки и/или отслеживания эффективности противораковой иммунотерапии. Предпочтительно, раковые заболевания включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC. Более конкретно, набор реагентов предпочтительно включает, по меньшей мере, один реагент для детектирования экспрессии гена MELK во взятой у субъекта клетке рака или эндометриоза, причем такой реагент выбирают из группы:

(a) реагента для детектирования мРНК гена MELK;

(b) реагента для детектирования белка MELK; и

(c) реагента для детектирования биологической активности белка MELK.

[0133] Подходящие реагенты для детектирования мРНК гена MELK, включают нуклеиновые кислоты, которые специфично связываются с MELK мРНК или идентифицируют ее, такие как олигонуклеотиды, которые имеют комплементарную последовательность части MELK мРНК. Эти типы олигонуклеотидов являются типичными праймерами и зондами, которые специфичны MELK мРНК. Эти типы олигонуклеотидов могут быть получены на основе методов, хорошо известных из уровня техники. Если необходимо, реагент для детектирования MELK мРНК может быть иммобилизован на твердой подложке. Более того, в набор реагентов может быть включен более чем один реагент для детектирования MELK мРНК.

[0134] С другой стороны, подходящие реагенты для детектирования белка MELK включают антитела к белку MELK. Антитела могут быть моноклональными или поликлональными. Кроме того, в качестве реагента может использоваться любой фрагмент или модификация антитела (например, химерное антитело, scFv, Fab, F(ab')2, Fv, и т.д.) при условии, что фрагмент или модифицированное антитело сохраняют способность связывания с белком MELK. Методы получения этих типов антител для детектирования белков хорошо известны из уровня техники, и в настоящем изобретении может применяться любой метод для получения таких антител и их эквивалентов. Кроме того, антитело может быть помечено с использованием молекул, генерирующих сигнал, посредством прямого связывания или с использованием метода непрямого мечения. Метки и методы мечения антител и детектирования связывания антител с их мишенями хорошо известны из уровня техники, и любые метки и методы могут применяться для настоящего изобретения. Более того, в набор реагентов может быть включен более чем один реагент для детектирования белка MELK.

[0135] Набор реагентов может содержать более чем один из вышеупомянутых реагентов. Например, образцы ткани, взятые у субъектов без ракового заболевания или эндометриоза или у страдающих раком или эндометриозом, могут служить в качестве используемых контрольных реагентов. Набор реагентов по настоящему изобретению может дополнительно включать другие материалы, целесообразные с коммерческой и пользовательской точки зрения, включающие буферы, разбавители, фильтры, иглы, шприцы и листки-вкладыши (например, написанные, напечатанные, CD-ROM, и т.д.) с инструкциями по применению. Эти реагенты и тому подобное могут храниться в контейнере с маркировкой. Подходящие контейнеры включают бутылки, флаконы и пробирки. Контейнеры могут быть сделаны из различных материалов, таких как стекло или пластик.

[0136] В воплощении настоящего изобретения, когда реагент представляет собой зонд для MELK мРНК, реагент может быть иммобилизован на твердой подложке, такой как пористая полоска, с образованием, по меньшей мере, одного сайта детектирования. Область измерения или детектирования пористой полоски может включать множество сайтов, каждый из которых содержит нуклеиновую кислоту (зонд). Тестовая полоска также может содержать сайты для отрицательного и/или положительного контроля. Альтернативно, контрольные сайты могут быть расположены на полоске, отделенной от тестовой полоски. Необязательно, различные сайты детектирования могут содержать различные количества иммобилизованных нуклеиновых кислот, т.е. более высокие количества в первом сайте детектирования и меньшие количества в последующих сайтах. При добавлении тестируемого образца, ряд сайтов, представляющих детектируемый сигнал, обеспечивает количественное показание количества MELK мРНК, присутствующего в образце. Сайты детектирования могут быть сконфигурированы в любой подходящей детектируемой форме и, как правило, в форме полосы или пятна, перекрывающих ширину тестовой полоски.

[0137] Набор реагентов по настоящему изобретению может дополнительно включать образец положительного контроля стандартного образца MELK. Образец положительного контроля по настоящему изобретению может быть получен путем собирания MELK-положительных образцов и затем путем анализа их уровня MELK. Альтернативно, очищенный белок или полинуклеотид MELK может быть добавлен к клеткам, которые не экспрессируют MELK с образованием положительного образца или стандартного образца MELK. В настоящем изобретении очищенный MELK может представлять собой рекомбинантный белок. Уровень MELK образца положительного контроля имеет значение, составляющее, например, более чем пороговое значение.

В одном воплощении, в настоящем изобретении дополнительно предлагается набор реагентов, включающий белок или неполный белок, способные специфично распознавать антитело по настоящему изобретению или его фрагмент.

[0138] Примеры неполного пептида или белка по настоящему изобретению включают полипептиды, состоящие из, по меньшей мере, 8, предпочтительно, 15, и более предпочтительно, 20 последовательных аминокислот в аминокислотной последовательности белка по настоящему изобретению. Рак или эндометриоз может быть диагностирован путем детектирования антитела в образце (например, в крови, ткани) с использованием белка или пептида (полипептида) по настоящему изобретению. Способ получения белка по настоящему изобретению и пептидов описан выше.

Способы диагностирования рака или эндометриоза по настоящему изобретению могут осуществляться путем определения различия между количеством антитела, связывающего MELK, и его количеством в соответствующем контрольном образце, как описано выше. Предполагается, что субъект страдает раком или эндометриозом, если клетки или ткани субъекта содержат антитела к продуктам экспрессии (MELK) гена, и определено, что количество антитела, связывающего MELK, составляет более чем пороговое значение по сравнению с уровнем в нормальном контроле.

[0139] В другом воплощении, диагностический набор реагентов по настоящему изобретению может включать пептид по настоящему изобретению и молекулу HLA, связывающуюся с ним. Способ детектирования антиген-специфичных ЦТЛ с использованием антигенных пептидов и молекул HLA был уже разработан (например, Altman JD et al., Science. 1996, 274(5284): 94-6). Таким образом, комплекс пептида по настоящему изобретению и молекулы HLA может применяться для детектирования ЦТЛ, специфичных к опухолевым антигенам, давая таким образом возможность раннего детектирования рецидива и/или метастазирования рака. Кроме того, он может применяться для отбора субъектов, к которым применимы лекарственные средства, включающие пептид по настоящему изобретению в качестве активного ингредиента, или оценка лечебного эффекта лекарственных средств.

Конкретно, может быть получен согласно настоящему способу (см., например, Altman JD et al., Science. 1996, 274(5284): 94-6), комплекс олигомера, такого как тетрамер радиоактивномеченной молекулы HLA, и пептида по настоящему изобретению. При использовании комплекса диагностика может быть осуществлена, например, путем количественной оценки антиген-пептид-специфичных ЦТЛ в лимфоцитах периферической крови, взятых у субъекта, предположительно страдающего раком.

[0140] В настоящем изобретении дополнительно предполагается способ или диагностические агенты для оценки иммунологического ответа субъекта с использованием пептидных эпитопов, описанных в данном документе. В одном воплощении изобретения, рестриктированные по HLA петиды, описанные в данном документе, могут использоваться в качестве реагентов для оценки или прогноза иммунного ответа субъекта. Оцениваемый иммунный ответ может индуцироваться путем контакта иммуногена с иммунокомпетентными клетками in vitro или in vivo. В предпочтительных воплощениях, иммунокомпетентные клетки для оценки иммунологического ответа могут быть выбраны среди клеток периферической крови, лимфоцитов периферической крови и мононуклеаров периферической крови (PBMC). Методы сбора и выделения таких иммунокомпетентных клеток хорошо известны в данной области. В некоторых воплощениях, любые вещества или композиции, которые могут привести в результате к получению антигенспецифичных ЦТЛ, которые распознают и связываются с пептидным(и) эпитопом(ами), могут применяться в качестве реагента. Пептидные реагенты необязательно могут использоваться в качестве иммуногена. Аналитические системы, которые используются для такого анализа, включают относительно недавние технические разработки, такие как анализы с использованием тетрамеров, окрашивающих внутриклеточные лимфокины и анализ с высвобождением интерферона или метод иммуноферментных пятен (ELISPOT). В предпочтительном воплощении, иммунокомпетентные клетки, контактирующие с пептидным реагентом, могут представлять собой антиген-презентирующие клетки, включающие дендритные клетки.

[0141] Например, пептиды по настоящему изобретению могут использоваться в анализах окрашивания с использованием тетрамеров для оценки мононуклеаров периферической крови на предмет присутствия антигенспецифичных ЦТЛ после экспонирования с антигеном опухолевой клетки или с иммуногеном. Тетрамерный комплекс HLA может использоваться для непосредственной визуализации антигенспецифичных ЦТЛ (см., например, Ogg et al., Science 279: 2103-2106, 1998; и Altman et al, Science 174: 94-96, 1996) и для определения частоты появления популяции антигенспецифичных ЦТЛ в образце мононуклеаров периферической крови. Тетрамерный реагент с использованием пептида по изобретению может генерироваться, как описано ниже.

[0142] Пептид, который связывается с молекулой HLA, собирается в присутствии соответствующей тяжелой цепи HLA и бета 2-микроглобулина с генерированием тримолекулярного комплекса. В комплексе карбокси-конец тяжелой цепи биотинилирован на сайте, который ранее был встроен в белок. Затем к комплексу добавляют стрептавидин с образованием тетрамера, состоящего из тримолекулярного комплекса и стрептавидина. Посредством флуресцентно меченного стрептавидина тетрамер может использоваться для окрашивания антигенспецифичных клеток. Клетки затем могут быть идентифицированы, например, с помощью проточной цитометрии. Такой анализ может использоваться для диагностических и прогностических целей. Клетки, идентифицированные с помощью такой процедуры, также могут использоваться для терапевтических целей.

[0143] В настоящем изобретении также предлагаются реагенты для оценки вторичного иммунного ответа (см., например, Bertoni et al, J. Clin. Invest. 100: 503-513, 1997 и Penna et al., J Exp. Med. 174: 1565-1570, 1991), включающие пептиды по настоящему изобретению. Например, образцы PBMC от индивидуумов, имеющих рак, подвергаемый лечению, могут быть проанализированы на предмет присутствия антигенспецифичных ЦТЛ с использованием специфических пептидов. Образец крови, содержащий мононуклеарные клетки, может оцениваться путем культивирования PBMC и стимулирования клеток с помощью пептида по изобретению. После соответствующего периода культивирования наращенная популяция клеток может анализироваться, например, на предмет активности ЦТЛ.

[0144] Пептиды также могут использоваться в качестве реагентов для оценки эффективности вакцины. PBMC, полученные от пациента, вакцинированного с использованием иммуногена, могут анализироваться с использованием, например, любого из методов, описанных выше. Пациента типируют по HLA, и для анализа отбирают реагенты пептидных эпитопов, которые распознают аллель-специфичные молекулы, присутствующие у пациента. Иммуногенность вакцины может быть выявлена по присутствию эпитоп-специфичных ЦТЛ в образце PBMC. Пептиды по изобретению также могут использоваться для получения антител с использованием методов, хорошо известных в данной области (см., например, CURRENT PROTOCOLS IN IMMUNOLOGY, Wiley/Greene, NY; и Antibodies A Laboratory Manual, Harlow and Lane, Cold Spring Harbor Laboratory Press, 1989), которые могут найти применение в качестве реагентов для диагностики, детектирования или отслеживания рака или эндометриоза. Такие антитела могут включать те, которые распознают пептид в контексте молекулы HLA, т.е., антитела, которые связываются с комплексом пептид-MHC.

[0145] Пептиды и композиции по настоящему изобретению имеют ряд дополнительных применений, некоторые из которых описаны в данном документе. Например, в настоящем изобретении предлагается способ диагностики или детектирования расстройства, характеризующегося экспрессией иммуногенного полипептида MELK. Эти методы включают определение экспрессии HLA-связывающего пептида MELK или комплекса HLA-связывающего пептида MELK и молекулы HLA класса I в биологическом образце. Экспрессию пептида или комплекса пептида и молекулы HLA класса I можно определить или детектировать с использованием анализа партнера связывания для пептида или комплекса. В предпочтительном воплощении, партнер по связыванию для пептида или комплекса может представлять собой антитело, специфически распознающее и связывающееся с пептидом. Экспрессия MELK в биологическом образце, таком как биопсия опухоли или эндометриоза, также может тестироваться с помощью стандартных протоколов ПЦР-амплификации с использованием MELK-праймеров. Пример опухолевой экспрессии представлен в данном документе и дополнительное раскрытие типичных условий и праймеров для амплификации MELK можно найти в WO2003/27322.

[0146] Предпочтительно, способы диагностики включают приведение биологического образца, взятого у субъекта, в контакт с агентом, специфичным для HLA-связывающего пептида MELK, для детектирования присутствия HLA-связывающего пептида MELK в биологическом образце. При использовании в данном документе, термин "приведение в контакт" обозначает помещение биологического образца в достаточной близости от агента и при подходящих условиях, например, концентрации, температуры, времени, ионной силы, чтобы была возможность специфичного взаимодействия между агентом и HLA-связывающим пептидом MELK, которые присутствуют в биологическом образце. Как правило, условия контакта агента с биологическим образцом представляют собой условия, известные специалисту в данной области, для облегчения специфичного взаимодействия между молекулой и компонентом, имеющим к ней сродство (например, белок и его рецептор, антитело и его белковый антиген, нуклеиновая кислота и комплементарная ей последовательность), в биологическом образце. Типичные условия для облегчения специфичного взаимодействия между молекулой и компонентом, имеющим к ней сродство, описаны, например, в патенте США № 5108921, выданном Low et al.

[0147] Способ диагностики по настоящему изобретению может быть осуществлен как in vivo, так и in vitro. Соответственно, биологический образец может быть локализован in vivo или in vitro в настоящем изобретении. Например, биологический образец может представлять собой ткань in vivo и агент, специфичный для иммуногенного полипептида MELK, может использоваться для детектирования присутствия таких молекул в ткани. Альтернативно, биологический образец может быть собран и выделен in vitro (например, образец крови, биопсия опухоли, тканевый экстракт). В конкретном предпочтительном воплощении, биологический образец может представлять собой образец, содержащий клетки, более предпочтительно, образец, содержащий клетки опухоли или эндометриоза, взятые у субъекта, которому необходимо поставить диагноз и подвергнуть лечению.

[0148] Альтернативно, диагноз может быть поставлен с помощью метода, который позволяет прямую количественную оценку антиген-специфичных T-клеток с помощью окрашивания с использованием флуоресцеин-меченных многомерных комплексов HLA (например, Altman, J. D. et al., 1996, Science 274: 94; Altman, J. D. et al., 1993, Proc. Natl. Acad. Sci. USA 90: 10330). Также предлагается окрашивание на предмет присутствия внутри клеточных лимфокинов и анализ с высвобождением интерферона-гамма или метод иммуноферментных пятен. Мультимерное окрашивание, окрашивание внутриклеточных лимфокинов и метод иммуноферментных пятен, по-видимому, по меньшей мере, в 10 раз более чувствительны, чем стандартные анализы (Murali-Krishna, K. et al., 1998, Immunity 8: 177; Lalvani, A. et al., 1997, J. Exp. Med. 186: 859; Dunbar, P. R. et al., 1998, Curr. Biol. 8: 413). Также могут использоваться пентамеры (например, US 2004-209295A), декстрамеры (например, WO 02/072631), и стрептамеры (например, Nature medicine 6. 631-637 (2002)).

Например, в некоторых воплощениях, в настоящем изобретении предлагается способ диагностики или оценки иммунологического ответа субъекта, которому вводили, по меньшей мере, один из пептидов MELK по настоящему изобретению, причем способ включает стадии:

a: приведение иммуногена в контакт с иммунокомпетентными клетками при условиях, подходящих для индуцирования ЦТЛ, специфичных для иммуногена;

b: детектирование или определение уровня индуцирования ЦТЛ, индуцированных в стадии (a); и

c: корреляция иммунологического ответа субъекта с уровнем индуцирования ЦТЛ.

[0149] В настоящем изобретении иммуноген представляет собой, по меньшей мере, один из (a) пептидов MELK, выбранных среди аминокислотных последовательностей SEQ ID NO: 6, 35-45, пептидов, содержащих такие аминокислотные последовательности, и пептидов, содержащих такие аминокислотные последовательности, которые были модифицированы с помощью 1, 2 или более аминокислотных замен. Между тем условия, подходящие для индуцирования иммуногенспецифичных ЦТЛ, хорошо известны в данной области. Например, иммунокомпетентные клетки могут культивироваться in vitro в присутствии иммуногенов для индуцирования иммуногенспецифичных ЦТЛ. С целью индуцирования иммуногенспецифичных ЦТЛ к клеточной культуре могут добавляться любые стимулирующие факторы. Например, IL-2 является предпочтительным стимулирующим фактором для индуцирования ЦТЛ.

[0150] В некоторых воплощениях, стадия отслеживания или оценки иммунологического ответа субъекта, подвергаемого лечению с использованием пептидной противораковой терапии, может проводиться перед, во время и/или после лечения. Как правило, в процессе осуществления протокола противораковой терапии иммуногенные пептиды многократно вводят субъекту, подвергаемому лечению. Например, иммуногенные пептиды могут вводиться каждую неделю в течение 3-10 недель. Соответственно, иммунологический ответ субъекта может оцениваться или отслеживаться в процессе протокола противораковой терапии. Альтернативно, оценка или отслеживание имунологического ответа на противораковую терапию может проводиться по завершении протокола противораковой терапии.

Согласно настоящему изобретению повышенное индуцирование иммуногенспецифичных ЦТЛ по сравнению с контролем указывает на то, что субъект, для которого проводят оценку или диагностику, иммунологически отвечает на иммуноген(ы), которые ему вводили. Подходящие контроли для оценки иммунологического ответа могут включать, например, уровень индуцирования ЦТЛ в момент, когда иммунокомпетентные клетки не контактируют с пептидом, или контактируют с контрольными пептидами, имеющими аминокислотную последовательность, отличную от последовательности любого из пептидов MELK. (например, случайные аминокислотные последовательности).

[0151] В предпочтительном воплощении, имунологический ответ субъекта оценивают последовательно путем сравнения иммунологических ответов между всеми иммуногенами, вводимыми субъекту. Конкретно, даже когда субъекту вводят смесь некоторых типов пептидов MELK, иммунологический ответ может варьироваться в зависимости от пептидов. В этом случае, путем сравнения иммунологических ответов между всеми пептидами, могут быть идентифицированы пептиды, на которые субъект демонстрирует более сильный ответ.

[0152] XI. Антитела

В настоящем изобретении дополнительно предлагаются антитела, которые связываются с пептидом по настоящему изобретению. Предпочтительные антитела специфично связываются с пептидом по настоящему изобретению и не будут связываться (или будет очень слабое связывание) с другим пептидом. Альтернативно, антитела связываются с пептидом по настоящему изобретению, а также с его гомологами. Антитела к пептиду по изобретению могут находить применение в диагностических и прогностических анализах рака или эндометриоза и в методологиях визуализации. Аналогично, такие антитела могут найти применение в лечении, диагностике и/или в прогнозировании других раковых заболеваний или эндометриоза, при условии, что у пациентов, имеющих рак или эндометриоз, также экспрессируется или сверхэкспессируется MELK. Более того, внутриклеточно экспрессирующиеся антитела (например, одноцепочечные антитела) могут находить терапевтическое применение в лечении эндометриоза или раковых заболеваний, в которые вовлечена экспрессия MELK, примеры которых включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC.

[0153] В настоящем изобретении также предлагается иммунологический анализ для детектирования и/или количественной оценки белка MELK (SEQ ID NO: 47) или его полипептидных фрагментов, имеющих аминокислотную последовательность, выбранную среди SEQ ID NO: 35, 41, 44. Такие анализы могут включать одно или более антител, связывающих MELK, способных при необходимости распознавать и связывать белок MELK или его фрагменты. В контексте настоящего изобретения антитела к MELK, связывающиеся с полипептидом MELK, предпочтительно распознают полипептид, имеющий аминокислотную последовательность, выбранную среди SEQ ID NO: 35, 41, 44. Специфичность связывания может подтверждаться с помощью теста ингибирования. То есть, когда связывание между анализируемым антителом и полноразмерным полипептидом MELK ингибируется в присутствии любых полипептидных фрагментов, имеющих аминокислотную последовательность, выбранную среди SEQ ID NO: 35, 41, 44, то демонстрируется, что это антитело специфично связывается с фрагментом. В контексте настоящего изобретения, такие иммунологические анализы осуществляют в рамках различных форматов иммунологических анализов, хорошо известных в данной области, включающих, в частности, различные типы радиоиммуноанализов, иммунохроматографический метод, твердофазный иммуноферментный анализ (ELISA), флуоресцентный иммуноферментный анализ (ELIFA) и так далее.

[0154] Родственные иммунологические, но не связанные с антителами анализы по изобретению также могут включать анализы Т-клеточной иммуногенности (ингибирующий или стимулирующий), также анализы связывания с MHC. Кроме того, иммунологические методы визуализации, способные детектировать раковые заболевания и эндометриоз, при которых экспрессируется MELK, также предлагаются настоящим изобретением, включая, в частности, радиосцинтиграфический метод визуализации с использованием меченых антител по настоящему изобретению. Такие анализы могут находить клиническое применение в детектировании, отслеживании или в прогнозе эндометриоза или раковых заболеваний, при которых экспрессируется MELK, примеры которых включают, в частности, эндометриоз и раковые заболевания, примеры которых включают, в частности, рак груди, рак мочевого пузыря, рак шейки матки, холангиоцеллюлярный рак, CML, колоректальный рак, рак пищевода, рак желудка, рак печени, NSCLC, лимфому, остеосаркому, рак яичника, рак поджелудочной железы, рак предстательной железы, светлоклеточный рак и SCLC.

[0155] В настоящем изобретении также предлагается антитело, которое связывается с пептидом по изобретению. Антитело по изобретению может использоваться в любой форме, такой как моноклональные или поликлональные антитела, и включает антисыворотку, полученную путем иммунизации животного, такого как кролик, с помощью пептида по изобретению, все классы поликлональных и моноклональных антител, человеческие антитела и гуманизированные антитела, полученные с использованием генетической рекомбинации.

Пептид по изобретению, используемый в качестве антигена для получения антитела, может быть выделен из любого вида животного, но предпочтительно из млекопитающего, такого как человек, мышь или крыса, более предпочтительно, из человека. Пептид, имеющий человеческое происхождение, может быть получен на основе нуклеотидных или аминокислотных последовательностей, раскрытых в данном документе.

Согласно настоящему изобретению, пептид, используемый в качестве антигена иммунизации, может представлять собой полный белок или неполный пептид или белок. Неполный пептид может включать, например, (N)-концевой или карбокси (C)-концевой фрагмент пептида по настоящему изобретению.

[0156] В данном документе антитело определяется как белок, который реагирует как с полноразмерным пептидом, так и с фрагментом пептида MELK. В предпочтительном воплощении, антитело по настоящему изобретению может распознавать пептидные фрагменты MELK, имеющие аминокислотную последовательность, выбранную среди SEQ ID NO: 35, 41, 44. Методы синтеза олигопептидов хорошо известны в данной области. После синтеза пептиды необязательно могут быть очищены перед использованием в качестве иммуногена. В настоящем изобретении, олигопептид (например, 9- или 10-мер) может быть конъюгирован или связан с носителями для усиления иммуногенности. Гемоцианин лимфы улитки (KLH) хорошо известен в качестве носителя. Методы конъюгации KLH и пептида также хорошо известны в данной области.

Альтернативно, ген, кодирующий пептид по изобретению или его фрагмент, может быть вставлен в известный экспрессирующий вектор, который затем используется для трансформации клетки-хозяина, как описано в данном документе. Целевой пептид или его фрагмент может быть извлечен из внеклеточной или из внутриклеточной среды с помощью любого стандартного метода и может затем использоваться в качестве антигена. Альтернативно, цельные клетки, экспрессирующие пептид, или их лизаты или химически синтезированный пептид могут использоваться в качестве антигена.

[0157] Любое млекопитающее может быть иммунизировано с помощью антигена, но предпочтительно принимать в внимание совместимость с родительскими клеткам, используемыми для слияния клеток. Как правило, могут использоваться животные семейства грызунов, зайцеобразных или приматов. Животные семейства грызунов включают, например, мышь, крысу и хомяка. Животные семейства зайцеобразных включают, например, кролика. Животные семейства приматов включают, например, обезьяну Catarrhini (обезьяну старого света), такую как Macaca fascicularis, макака-резус, гамадрил и шимпанзе.

[0158] Методы иммунизации животных с использованием антигенов хорошо известны в данной области. Внутрибрюшинная инъекция или подкожная инъекция антигенов представляют собой стандартный метод иммунизации млекопитающих. Более конкретно, антигены могут быть разведены или суспендированы в подходящем количестве фосфатно-солевого буферного раствора (PBS), в физиологическом солевом растворе и так далее. Если целесообразно, то антигенная суспензия может смешиваться с подходящим количеством стандартного адъюванта, такого как полный адъювант Фрейнда, превращается в эмульсию и затем вводится млекопитающим. Предпочтительно, за этим следует несколько введений антигена, смешанного с подходящим количеством неполного адъюванта Фрейнда каждые 4-21 день. Для иммунизации также может использоваться подходящий носитель. После иммунизации, описанной выше, сыворотку можно исследовать с помощью стандартных методов на предмет увеличения количества целевых антител.

[0159] Поликлональные антитела к пептидам по настоящему изобретению могут быть получены путем забора крови у иммунизированного млекопитающего, исследованного на повышенное присутствие целевых антител в сыворотке, и путем выделения сыворотки из крови с помощью любого стандартного метода. Поликлональные антитела могут включать сыворотку, содержащую поликлональные антитела, а также фракция, содержащая поликлональные антитела, может быть выделена из сыворотки. Иммуноглобулин G или M может быть получен из фракции, которая распознает только пептид по настоящему изобретению, с использованием, например, аффинной колонки, связывающей пептид по настоящему изобретению, и с помощью дальнейшей очистки этой фракции с использованием колонки с белком A или с белком G.

Для получения моноклональных антител, иммунные клетки собирают у млекопитающего, иммунизированного с помощью антигена, и проверяют повышение уровня целевых антител в сыворотке, как описано выше, и подвергают клетки слиянию. Иммунные клетки для слияния клеток могут предпочтительно быть получены из селезенки. Другие предпочтительные родительские клетки, которые используют для слияния с вышеописанным иммуноцитом, включают, например, клетки миеломы млекопитающих, и более предпочтительно, клетки миеломы, обладающие приобретенным свойством селекции слитых клеток с помощью лекарственных средств.

[0160] Вышеописанный иммуноцит и клетки миеломы могут быть слиты согласно известным методам, например, согласно методу Milstein et al. (Galfre and Milstein, Methods Enzymol 73: 3-46 (1981)).

Полученные в результате гибридомы, полученные посредством слияния клеток, могут быть селектированы путем культивирования их в стандартной селективной среде, такой как среда HAT (среда, содержащая гипоксантин, аминоптерин и тимидин). Клеточную культуру, как правило, поддерживают в среде HAT в течение от нескольких дней до нескольких недель, времени, достаточного для того, чтобы за исключением целевой гибридомы все остальные клетки (не слившиеся) умерли. Затем, может быть осуществлено стандартное лимитирующее разведение для скрининга клонов гибридомных клеток, продуцирующих целевое антитело.

[0161] Дополнительно к вышеописанному методу, в котором животное, отличное от человека, иммунизируют с использованием антигена для получения гибридомы, человеческие лимфоциты, такие как инфицированные вирусом EB, могут быть иммунизированы с помощью пептида, клеток, экспрессирующих пептид, или их лизатов in vitro. Затем, иммунизированные лимфоциты сливают с имеющими человеческое происхождение клетками миеломы, которые способны к неограниченному делению, такими как U266, с получением гибридомы, продуцирующей целевое человеческое антитело, которое способно связываться с пептидом (не подвергнутая экспертизе опубликованная японская патентная заявка № Sho 63-17688).

[0162] Полученные гибридомы затем трансплантируют в абдоминальную полость мыши и выделяют асциты. Полученные моноклональные антитела могут быть очищены, например, с помощью осаждения сульфатом аммония, на колонке с белком A или с белком G, ионно-обменной хроматографией DEAE, или на аффинной колонке, с которой связывается пептид по настоящему изобретению. Антитело по настоящему изобретению может использоваться не только для очистки или детектирования пептида по настоящему изобретению, но также в качестве кандидата для агонистов и антагонистов пептида по настоящему изобретению.

[0163] Альтернативно, иммунная клетка, такая как иммунизированный лимфоцит, продуцирующий антитела, может быть иммортализована с помощью онкогена и может использоваться для получения моноклональных антител.

Полученные таким образом моноклональные антитела также могут быть рекомбинантно получены с использованием генно-инженерных методов (см., например, Borrebaeck and Larrick, Therapeutic Monoclonal Antibodies, published in the United Kingdom by MacMillan Publishers LTD (1990)). Например, ДНК, кодирующая антитело, может быть клонирована из иммунной клетки, такой как гибридома или иммунизированный лимфоцит, продуцирующий антитело, вставлена в подходящий вектор и введена в клетку-хозяин с получением рекомбинантного антитела. В настоящем изобретении также предлагаются рекомбинантные антитела, полученные, как описано выше.

[0164] Кроме того, антитело по настоящему изобретению может представлять собой фрагмент антитела или модифицированное антитело, при условии, что оно связывается с одним или более пептидами по изобретению. Например, фрагмент антитела может представлять собой Fab, F(ab')2, Fv или одноцепочечное Fv (scFv), в котором Fv-фрагменты из H и L цепей лигированы с помощью подходящего линкера (Huston et al., Proc Natl Acad Sci USA 85: 5879-83 (1988)). Более конкретно, фрагмент антитела может быть генерирован путем обработки антитела с помощью фермента, такого как папаин или пепсин. Альтернативно, ген, кодирующий антительный фрагмент, может быть сконструирован, вставлен в экспрессирующий вектор и может экспрессироваться в подходящей клетке-хозяине (см., например, Co et al., J Immunol 152: 2968-76 (1994); Better and Horwitz, Methods Enzymol 178: 476-96 (1989); Pluckthun and Skerra, Methods Enzymol 178: 497-515 (1989); Lamoyi, Methods Enzymol 121: 652-63 (1986); Rousseaux et al., Methods Enzymol 121: 663-9 (1986); Bird and Walker, Trends Biotechnol 9: 132-7 (1991)).

Антитело может быть конъюгировано со различными молекулами, такими как полиэтиленгликоль (ПЭГ). Настоящее изобретение представляет такие модифицированные антитела. Модифицированное антитело может быть получено с помощью химической модификации антитела. Такие способы модификации являются стандартными в данной области.

[0165] Альтернативно, антитело по настоящему изобретению может быть получено в виде химерного антитела между вариабельным участком, взятым от нечеловеческого антитела, и константным участком, взятым от человеческого антитела, или в виде гуманизированного антитела, включающего гипервариабельный участок (CDR), взятый из нечеловеческого антитела, каркасный участок (FR) и константный участок, взятый из человеческого антитела. Такие антитела могут быть получены согласно известной технологии. Гуманизация может быть осуществлена путем замены последовательностей грызунов CDR на соответствующие последовательности человеческого антитела (см., например, Verhoeyen et al., Science 239:1534-1536 (1988)). Соответственно, такие гуманизированные антитела являются химерными антителами, где по существу менее чем один интактный человеческий вариабельный домен заменен на соответствующую последовательность из вида, отличного от человека.

[0166] Также могут использоваться полностью человеческие антитела, включающие человеческие вариабельные участки, дополнительно к человеческим каркасному и константному участкам. Такие антитела могут быть получены с использованием различных методов, известных в данной области. Например, in vitro-методы включают применение рекомбинантных библиотек фрагментов человеческого антитела, представленных на бактериофаге (например, Hoogenboom & Winter, J. Mol. Biol. 227:381 (1991)). Аналогично, человеческие антитела могут быть сделаны путем введения человеческого иммуноглобулинового локуса трансгенным животным, например, мышам, у которых эндогенные гены иммуноглобулинов частично или полностью инактивированы. Этот подход описан, например, в патентах США №№ 6150584, 5545807; 5545806; 5569825; 5625126; 5633425; 5661016.

[0167] Антитела, полученные выше, могут быть очищены до гомогенного состояния. Например, разделение и очистка антитела может быть осуществлена согласно методам разделения и очистки, используемым для белков повсеместно. Например, антитело может быть отделено и выделено с помощью подходящим образом выбранного и объединенного применения колоночной хроматографии, такой как аффинная хроматография, фильтра, ультрафильтрации, обессоливания, диализа, электрофореза на SDS-полиакриламидном геле и изоэлектрического фокусирования (Antibodies: A Laboratory Manual. Ed Harlow and David Lane, Cold Spring Harbor Laboratory (1988)), но не ограничиваясь этим. Колонка с белком A и колонка с белком G могут использоваться в качестве аффинных колонок. Используемые типичные колонки с белком A включают, например, Hyper D, POROS и Sepharose F.F. (Pharmacia).

[0168] Типичная хроматография за исключением аффинной включает, например, ионно-обменную хроматографию, гидрофобную хроматографию, гель-фильтрацию, хроматографию с обращенной фазой, адсорбционную хроматографию и так далее (Strategies for Protein Purification and Characterization: A Laboratory Course Manual. Ed Daniel R. Marshak et al., Cold Spring Harbor Laboratory Press (1996)). Хроматографические процедуры могут проводиться с помощью жидкостной хроматографии, такой как ВЭЖХ и жидкостная хроматография быстрого разрешения ЖХБР (FPLC).

Например, измерение или поглощение, твердофазный иммуноферментный анализ (ELISA), ферментный иммуноанализ (EIA), радиоиммуноанализ (RIA) и/или иммунофлуоресценция могут использоваться для измерения антиген-связывающей активности антитела по изобретению. В ELISA антитело по настоящему изобретению иммобилизовано на планшете, белок по изобретению наносят на планшет, и затем применяют образец, содержащий целевое антитело, такой как надосадочная жидкость культуры клеток, продуцирующих антитело, или очищенные антитела. Затем, применяют вторичное антитело, которое распознает первичное антитело, и помечено ферментом, таким как щелочная фосфатаза, и планшет инкубируют. Затем, после промывки, ферментный субстрат, такой как п-нитрофенилфосфат, добавляют к планшету и измеряют поглощение для оценки антиген-связывающей активности образца. Фрагмент пептида, такой как C-концевой или N-концевой фрагмент, может использоваться в качестве антигена для оценки связывающей активности антитела. Для оценки антитела согласно изобретению может использоваться BIAcore (Pharmacia).

[0169] Вышеописанные способы дают возможность детектирования или измерения пептида по изобретению путем экспонирования антитела по изобретению с образцом, который предположительно содержит пептид по изобретению, и детектирования или измерения иммунного комплекса, образованного антителом и пептидом.

Так как метод детектирования или измерения пептида согласно изобретению может специфично детектировать или измерять пептид, то метод находит применение в различных экспериментах, в которых используется пептид.

[0170] XII. Векторы и клетки-хозяева

В настоящем изобретении также предлагается вектор и клетка-хозяин, в которую вводится нуклеотид, кодирующий пептид по настоящему изобретению. Вектор по настоящему изобретению может найти применение в поддержании нуклеотида, особенно ДНК по настоящему изобретению, в клетке-хозяине для экспрессии пептида по настоящему изобретению или для введения нуклеотида по настоящему изобретению при использовании для генной терапии.

[0171] Когда клеткой хозяином является E. coli, и вектор амплифицируется и производится в большом количестве в E. coli (например, JM109, DH5 альфа, HB101 или XL1Blue), то вектор должен иметь "точку начала репликации (ori)" для амплификации в E. coli и маркерный ген для селекции трансформированных E. coli (например, ген устойчивости к лекарственному средству, выбранный для таких лекарственных средств, как ампициллин, тетрациклин, канамицин, хлорамфеникол и тому подобные). Например, могут использоваться векторы типа M13, векторы типа pUC, pBR322, pBluescript, pCR-Script, и т.д. Кроме того, pGEM-T, pDIRECT и pT7 также могут использоваться для субклонирования и выделения кДНК, а также векторов, описанных выше. Когда вектор используется для продуцирования белка по настоящему изобретению, то он находит свое применение в виде экспрессирующего вектора.

[0172] Например, экспрессирующий вектор, экспрессируемый в E. coli, должен обладать вышеописанными характеристиками для амплификации в in E. coli. Когда в качестве клетки-хозяина используются E. coli, такие как JM109, DH5 альфа, HB101 или XL1 Blue, то вектор должен иметь промотор, например, lacZ-промотор (Ward et al., Nature 341: 544-6 (1989); FASEB J 6: 2422-7 (1992)), araB-промотор (Better et al., Science 240: 1041-3 (1988)), T7-промотор и так далее, которые могут эффективно экспрессировать целевой ген в E. coli. В этом отношении, вместо вышеописанных векторов может использоваться, например pGEX-5X-1 (Pharmacia), "QIAexpress system" (Qiagen), pEGFP и pET (в данном случае хозяином предпочтительно являются клетки L21, которые экспрессируют T7 РНК-полимеразу). Кроме того, вектор также может содержать сигнальную последовательность для секреции пептида. Типичная сигнальная последовательность, которая направляет пептид по пути секреции в периплазматическое пространство E. coli, это сигнальная последовательность pelB (Lei et al., J Bacteriol 169: 4379 (1987)). Способы введения векторов в целевые клетки-хозяева включают, например, метод с использованием хлорида кальция и электропорацию.

[0173] Для продуцирования полипептида по настоящему изобретению дополнительно к E. coli могут использоваться, например, экспрессирующие векторы, полученные из млекопитающих (например, pcDNA3 (Invitrogen) и pEGF-BOS (Nucleic Acids Res 18(17): 5322 (1990)), pEF, pCDM8), экспрессирующие векторы, полученные из клеток насекомых (например, "Bac-to-BAC бакуловирусная экспрессирующая система" (GIBCO BRL), pBacPAK8), экспрессирующие векторы, полученные из растений (например, pMH1, pMH2), экспрессирующие векторы, полученные из вирусов животных (например, pHSV, pMV, pAdexLcw), экспрессирующие векторы, полученные из ретровирусов (например, pZIpneo), экспрессирующие векторы, полученные из дрожжей (например, "Pichia Expression Kit" (Invitrogen), pNV11, SP-Q01) и экспрессирующие векторы, полученные из Bacillus subtilis (например, pPL608, pKTH50).

[0174] С целью экспрессии вектора в животных клетках, таких как клетки CHO, COS или NIH3T3, вектор должен иметь промотор, необходимый для экспрессии в таких клетках, например, промотор SV40 (Mulligan et al., Nature 277: 108 (1979)), промотор MMLV-LTR, промотор EF1-альфа (Mizushima et al., Nucleic Acids Res 18: 5322 (1990)), CMV-промотор и так далее, и предпочтительно маркерный ген для селекции трансформантов (например, ген устойчивости к лекарственному средству, выбранный по лекарственному средству (например, неомицин, G418)). Примеры известных векторов с такими характеристиками включают, например, pMAM, pDR2, pBK-RSV, pBK-CMV, pOPRSV и pOP13.

Следующие примеры представлены для иллюстрации настоящего изобретения и для помощи специалисту в его осуществлении и применении. Примеры никоим образом не предназначены для ограничения рамок изобретения.

Примеры

[0175] Материалы и методы

Клеточные линии

TISI, HLA-A*2402 (человеческий лейкоцитарный антиген)-положительная B-лимфобластная клеточная линия была получена из Банка Клеток и Генов IHWG (Сиэтл, Вашингтон). COS7, MDA-MB-435S И T47D были получены из ATCC. KLM-1 и KP-1N были получены из банка клеток RIKEN и банка клеток JCRB, соответственно.

[0176] Селекция кандидатов из пептидов, полученных на основе MELK

9-Мерные и 10-мерные пептиды, полученные из MELK, и которые связываются с молекулой HLA-A*2402, были предсказаны с использованием программы прогноза связывания "BIMAS" (www-bimas.cit.nih.gov/molbio/hla_bind), чей алгоритм описан у Parker et al.(J Immunol 1994, 152(1): 163-75), и у Kuzushima et al.(Blood 2001, 98(6): 1872-81). HIV-пептид, рестриктированный по HLA-A*2402 (RYLRQQLLGI (SEQ ID NO: 48)), использовали в качестве контроля. Эти пептиды синтезировали с помощью Biosynthesis Inc. (Луисвилл, Техас) согласно стандартному твердофазному методу синтеза и очищали с помощью высокоэффективной жидкостной хроматографии (ВЭЖХ). Чистоту (>90%) и идентичность пептидов определяли с помощью аналитической ВЭЖХ и с помощью анализа масс-спектрометрии, соответственно. Пептиды растворяли в диметилсульфоксиде (ДМСО) в концентрации 20 мг/мл и хранили при -80 градусах °C.

[0177] Индуцирование ЦТЛ in vitro

Дендритные клетки с происхождением из моноцитов (DC) использовали в качестве антиген-презентирующих клеток (АПК) для индуцирования ответа цитотоксических Т-лимфоцитов (ЦТЛ) против пептидов, презентированных на HLA. DC генерировали in vitro, как описано в другой публикации (Nakahara S et al., Cancer Res 2003 Jul 15, 63(14): 4112-8). Конкретно, мононуклеары периферической крови (PBMC), выделенные из крови трех здоровых доноров А, В и С (HLA-A*2402-положительных) с помощью раствора Ficoll-Plaque (Pharmacia), разделяли путем адгезии на пластиковой культуральной чашке (Becton Dickinson) для обогащения моноцитарной фракции. Популяцию, обогащенную моноцитами, культивировали в присутствии 1000 Ед/мл гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF) (R&D System) и 1000 Ед/мл интерлейкина (IL)-4 (R&D System) в среде AIM-V (Invitrogen), содержащей 2% инактивированную нагреванием аутологичную сыворотку (AS). Через 7 дней культивирования, индуцированные цитокинами DC стимулировали с помощью 20 микрограмм/мл каждого из синтезированных пептидов в присутствии 3 микрограмм/мл бета 2-микроглобулина в течение 3 часов при 37 градусах °C в среде AIM-V. Генерированные клетки, по-видимому, экспрессируют DC-ассоциированные молекулы, такие как CD80, CD83, CD86 и HLA класса II, на своих клеточных поверхностях (данные не показаны). Эти стимулированные пептидом DC затем инактивировали с помощью облучения рентгеновским излучением (20 Гр) и смешивали в соотношении 1:20 с аутологичными CD8+ T-клетками, полученными с помощью положительной селекции с использованием набора реагентов CD8 Positive Isolation Kit (Dynal). Эти культуры поднимали в 48-луночных планшетах (Corning); каждая лунка содержала 1,5×104 стимулированных пептидом DC, 3×105 CD8+ T-клеток и 10 нг/мл IL-7 (R&D System) в 0,5 мл среды AIM-V/2% AS. Через 3 дня к культурам добавляли IL-2 (CHIRON) до конечной концентрации 20 МЕ/мл. В дни 7 и 14, T-клетки дополнительно стимулировали с помощью аутологичных стимулированных пептидом DC. DC получали каждый раз одним способом, описанным выше. ЦТЛ тестировали по отношению к клеткам A24LCL, стимулированным пептидом, после 3-го раунда пептидного стимулирования на 21 день (Tanaka H et al., Br J Cancer 2001 Jan 5, 84(1): 94-9; Umano Y et al., Br J Cancer 2001 Apr 20, 84(8): 1052-7; Uchida N et al., Clin Cancer Res 2004 Dec 15, 10(24): 8577-86; Suda T et al., Cancer Sci 2006 May, 97(5): 411-9; Watanabe T et al., Cancer Sci 2005 Aug, 96(8): 498-506).

[0178] Процедура наращивания ЦТЛ

ЦТЛ наращивали в культуре с использованием метода, аналогичного описанному у Riddell et al. (Walter EA et al., N Engl J Med 1995 Oct 19, 333(16): 1038-44; Riddell SR et al., Nat Med 1996 Feb, 2(2): 216-23). Всего 5×104 ЦТЛ суспендировали в 25 мл среды AIM-V/5% AS с использованием 2 типов человеческих B-лимфобластных клеточных линий, инактивированных с помощью Митомицина C (MMC), в присутствии 40 нг/мл моноклонального антитела к CD3 (Pharmingen). Через день после инициирования культур к ним добавляли 120 МЕ/мл IL-2. Культуры подпитывали с использованием свежей среды AIM-V/5% AS, содержащей 30 МЕ/мл IL-2 в дни 5, 8 и 11 (Tanaka H et al., Br J Cancer 2001 Jan 5, 84(1): 94-9; Umano Y et al., Br J Cancer 2001 Apr 20, 84(8): 1052-7; Uchida N et al., Clin Cancer Res 2004 Dec 15, 10(24): 8577-86; Suda T et al., Cancer Sci 2006 May, 97(5): 411-9; Watanabe T et al., Cancer Sci 2005 Aug, 96(8): 498-506).

[0179] Создание клонов ЦТЛ

Делали разведения с получением 0,3, 1 и 3 ЦТЛ/на лунку в 96-луночном круглодонном микротитровальном планшете (Nalge Nunc International). ЦТЛ культивировали с использованием 1×104 клеток/на лунку 2 типов человеческих B-лимфобластных клеточных линий, 30 нг/мл антитела к CD3 и 125 Ед/мл IL-2 в общем объеме 150 микролитров/на лунку среды AIM-V, содержащей 5% AS. 50 микролитров/на лунку IL-2 добавляли к среде через 10 дней для достижения конечной концентрации 125 Ед/мл IL-2. Активность ЦТЛ тестировали на 14 день, и клоны ЦТЛ наращивали с использованием тех же методов, что описаны выше (Uchida N et al., Clin Cancer Res 2004 Dec 15, 10(24): 8577-86; Suda T et al., Cancer Sci 2006 May, 97(5): 411-9; Watanabe T et al., Cancer Sci 2005 Aug, 96(8): 498-506).

[0180] Специфическая активность ЦТЛ

Для исследования специфичной активности ЦТЛ, осуществляли метод иммуноферментных пятен (ELISPOT) для интерферона (IFN)-гамма, а также твердофазный иммуноферментный анализ (ELISA) для IFN-гамма. Конкретно, в качестве клеток-стимуляторов получали стимулированные пептидом клетки A24LCL (1×104/на лунку) и опухолевые клеточные линии (5×104/на лунку). Культивированные клетки в 48 лунках, линии ЦТЛ и клоны использовали в качестве клеток-респондеров. Метод ELISPOT для интерферона IFN-гамма, а также анализ ELISA для IFN-гамма осуществляли согласно инструкции производителя.

[0181] Трансфекция плазмид

С помощью ПЦР амплифицировали кДНК, кодирующую открытую рамку считывания гена-мишени или HLA-A*2402. Амплифицированные ПЦР-продукты клонировали в вектор pCAGGS. Плазмиды трансфицировали в клетки COS7, которые отрицательны по генам-мишеням и по HLA-A24, с использованием липофектамина 2000 (Invitrogen) согласно инструкциям производителя. Через 2 дня после трансфекции клетки собирали с помощью версена (Invitrogen) и использовали в качестве клеток-стимуляторов (5×104 клеток/на лунку) для анализа активности ЦТЛ.

[0182] Анализ ингибирования

Для подтверждения активности ЦТЛ, рестриктированной по HLA-класса I, клетки-стимуляторы инкубировали с 10 мкг/мл моноклонального антитела W6/32 (BioLegend) к молекуле HLA класса I или с нормальным мышиным IgG (Santa Cruz Biotechnology) в течение 30 мин при 4 градусах °C. Обработанные клетки использовали в качестве клеток-стимуляторов для определения активности ЦТЛ.

[0183] Результаты

Прогноз HLA-A24-связывающих пептидов, полученных из MELK

Таблицы 1А и 1В демонстрируют HLA-A24-связывающие 9-мерные и 10-мерные пептиды, полученные из MELK, в порядке возрастания аффинности связывания. Всего было отобрано 34 пептида с потенциальной способностью связывания с HLA-A24, они были исследованы для определения эпитопных пептидов.

[0184]

Таблица 1А
Полученные из MELK 9-мерные пептиды, связывающиеся с HLA-A24

[0185]

Таблица 1В
Полученные из MELK 10-мерные пептиды, связывающиеся с HLA-A24

Начальное положение обозначает номер аминокислотного остатка от N-конца MELK.

Бальная оценка связывания получена из "BIMAS".

[0186] Индуцирование ЦТЛ с использованием предсказанных пептидов из MELK, рестриктированных по HLA-A*2402

ЦТЛ из PBMC донора А для тех пептидов, полученных из MELK, генерировали согласно протоколам, описанным в разделе "Материалы и Методы". Пептидо-специфичную активность ЦТЛ определяли с помощью метода ELISPOT для IFN-гамма (Фиг.1). В лунках со следующими номерами было продемонстрировано мощное продуцирование IFN-гамма по сравнению с контрольными лунками: в лунке #2 клетки стимулировали с помощью MELK-A24-9-87 (SEQ ID NO: 6) (a), #1 и #3 стимулировали с помощью MELK-A24-10-637 (SEQ ID NO: 23) (b), #8 стимулировали с помощью MELK-A24-9-199 (SEQ ID NO: 1) (d), и #4 стимулировали с помощью MELK-A24-9-78 (SEQ ID NO: 21) (e). С другой стороны, мощное продуцирование IFN-гамма можно было детектировать с помощью стимулирования с использованием других пептидов, представленных в Таблице 1, независимо от того, обладали ли эти пептиды возможной активностью связывания с HLA-A*2402. Например, типичные негативные данные ответа ЦТЛ, стимулированных с помощью MELK-A24-9-96 (SEQ ID NO: 2), представлены на Фиг.1(c). В результате выявлено, что четыре пептида, полученных из MELK, скринировали в качестве пептидов, которые могли бы индуцировать эффективные ЦТЛ.

[0187] Создание клеточных линий и клонов ЦТЛ против MELK-специфичных пептидов

Клетки, которые демонстрировали пептидо-специфичную активность ЦТЛ, детектированную с помощью анализа ELISPOT для IFN-гамма в лунке #2, где клетки стимулировали с помощью MELK-A24-9-87 (SEQ ID NO: 6), и в #3, где клетки стимулировали с помощью MELK-A24-10-637 (SEQ ID NO: 23), наращивали и использовали для создания линий ЦТЛ. Активность ЦТЛ этих клеточных линий определяли с помощью ELISA для IFN-гамма (Фиг.2). Все линии ЦТЛ демонстрировали мощное продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87 (SEQ ID NO: 6) (a) MELK-A24-10-637 (SEQ ID NO: 23) (b) и MELK-A24-9-199 (SEQ ID NO: 1) (c), по сравнению с клетками-мишенями без пептидного стимула. Более того, клетки линий ЦТЛ разводили и культивировали для создания клонов ЦТЛ, как описано в разделе "Материалы и Методы". Продуцирование IFN-гамма из клонов ЦТЛ против клеток-мишеней, стимулированных с помощью родственных пептидов, определяли с помощью анализа ELISA для IFN-гамма. На Фиг.3 мощное продуцирование IFN-гамма определяли из клона ЦТЛ, стимулированного с помощью MELK-A24-9-87 (SEQ ID NO: 6) и MELK-A24-9-199 (SEQ ID NO: 1).

[0188] Специфичная активность ЦТЛ против клеток-мишеней, экспрессирующих MELK и HLA-A*2402

Созданный клон ЦТЛ, индуцированный против MELK-A24-9-87 (SEQ ID NO: 6), исследовали на предмет его способности распознавать клетки-мишени, которые экспрессируют MELK и HLA-A*2402. Специфическую активность ЦТЛ против клеток COS7, которые трансфицировали обоими, полноразмерной MELK и HLA-A*2402 (специфическая модель для клеток-мишеней, которые экспрессируют MELK и HLA-A*2402), тестировали с использованием клона ЦТЛ, стимулированного с помощью MELK-A24-9-87 (SEQ ID NO: 6). Клетки COS7, трансфицированные или с помощью полноразмерного гена MELK или HLA-A*2402, получали в качестве контролей. На Фиг.4, клон ЦТЛ, стимулированный с помощью MELK-A24-9-87 (SEQ ID NO: 6), демонстрировал мощную активность ЦТЛ против клеток COS7, экспрессирующих оба, MELK и HLA-A*2402. С другой стороны, не детектировали какой-либо значительной специфичной активности ЦТЛ в отношении контролей. Таким образом, эти данные очевидно демонстрируют, что пептид MELK-A24-9-87 (SEQ ID NO: 6) эндогенно процессировался и презентировался на клетках-мишенях вместе с молекулой HLA-A*2402 и распознавался с помощью ЦТЛ.

[0189] Прогноз модифицированных пептидов MELK-A24-9-87, связывающих HLA-A24

Затем, авторы настоящего изобретения исследовали модифицированные пептиды с заменой одного аминокислотного остатка из MELK-A24-9-87 (SEQ ID NO: 6), которые обладали потенциальной способностью индуцировать MELK-A24-9-87-специфичные ЦТЛ более эффективно, чем MELK-A24-9-87 дикого типа (MELK-A24-9-87_WT) (SEQ ID NO: 6). Таблица 2 демонстрирует пептиды-кандидаты, которые содержат модифицированную последовательность MELK-A24-9-87_WT (SEQ ID NO: 6), в порядке повышения аффинности связывания. Всего было отобрано 11 пептидов, для которых прогнозировали, что они обладают более высокой способностью связывания по сравнению с MELK-A24-9-87_WT (SEQ ID NO: 6), и они были исследованы на иммуногенность.

[0190]

Таблица 2
Модифицированные пептиды из MELK-A24-9-87

Бальная оценка связывания получена из "BIMAS".

[0191] Индуцирование ЦТЛ с помощью модифицированных пептидов из MELK-A24-9-87

ЦТЛ, реактивные по отношению к модифицированным пептидам Таблицы 2, генерировали согласно протоколам, описанным в разделе "Материалы и Методы". Пептидо-специфичную активность ЦТЛ определяли с помощью метода ELISPOT для IFN-гамма. Фиг.5A демонстрирует результаты метода ELISPOT для IFN-гамма на ЦТЛ, индуцированных из PBMC донора B. Клетки лунок со следующими номерами продемонстрировали мощное продуцирование IFN-гамма по сравнению с контрольными лунками: клетки в лунках #1, #3 и #12, стимулированные с помощью MELK-A24-9-87_1K (SEQ ID NO: 35) (a), #2 с помощью MELK-A24-9-87_3M (SEQ ID NO: 41) (b) и #10 и #12 с помощью MELK-A24-9-87_7N (SEQ ID NO: 44) (c). С другой стороны, не детектировали специфичного продуцирования IFN-гамма из PBMC, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6) (d).

[0192] PBMC другого донора C также стимулировали с помощью модифицированных пептидов Таблицы 2. На Фиг.5B представлено, что клетки в лунке номер #14, стимулированные с помощью MELK-A24-9-87_7N (SEQ ID NO: 44), продемонстрировали мощное продуцирование IFN-гамма по сравнению с контролями (a). С другой стороны, не детектировали специфичного продуцирования IFN-гамма из ЦТЛ, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6) (b), а также из PBMC донора В.

Эти результаты выявили, что MELK-A24-9-87_1K (SEQ ID NO: 35), MELK-A24-9-87_3M (SEQ ID NO: 41) и MELK-A24-9-87_7N (SEQ ID NO: 44) обладают более высокой иммуногенностью по сравнению с MELK-A24-9-87_WT (SEQ ID NO: 6).

[0193] Создание линий и клонов ЦТЛ с помощью стимулирования с использованием модифицированных пептидов MELK

Клетки, которые демонстрировали пептидо-специфичную активность ЦТЛ, детектированную с помощью анализа ELISPOT для IFN-гамма в лунке #1, где клетки стимулировали с помощью MELK-A24-9-87_1K (SEQ ID NO: 35), #2 с помощью MELK-A24-9-87_3M (SEQ ID NO: 41) и в #12 с помощью MELK-A24-9-87_7N (SEQ ID NO: 44) из донора B и в #14 стимулировали с помощью MELK-A24-9-87_7N (SEQ ID NO: 44) из донора С, наращивали для создания линий ЦТЛ. Клетки в лунке номер #4, стимулированные с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), которые также демонстрировали минорное продуцирование IFN-гамма, также наращивали.

[0194] Активность ЦТЛ этих линий ЦТЛ определяли с помощью ELISA для IFN-гамма. На Фиг.6, линии ЦТЛ от донора B, стимулированные с помощью MELK-A24-9-87_1K (SEQ ID NO: 35) (a), MELK-A24-9-87_3M (SEQ ID NO: 41) (b) и MELK-A24-9-87_7N (SEQ ID NO: 44) (c), демонстрировали мощное продуцирование IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), по сравнению с клетками-мишенями, стимулированными с помощью постороннего HIV-пептида. Линия ЦТЛ от донора C, стимулированная с помощью MELK-A24-9-87_7N (SEQ ID NO: 44), также демонстрировала специфичное для пептида MELK-A24-9-87_WT (SEQ ID NO: 6) продуцирование IFN-гамма (d), тогда как наращенные клетки, стимулированные с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), демонстрировали отсутствие продуцирования IFN-гамма против клеток-мишеней, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6) (e).

[0195] Затем, клоны ЦТЛ создавали с помощью метода лимитирующего разведения, как описано в разделе "Материалы и Методы", и активность ЦТЛ этих клонов ЦТЛ определяли с помощью метода ELISA для IFN-гамма. Мощное продуцирование IFN-гамма детектировали из клонов ЦТЛ, стимулированных с помощью MELK-A24-9-87_1K (SEQ ID NO: 35), MELK-A24-9-87_3M (SEQ ID NO: 41) и MELK-A24-9-87_7N (SEQ ID NO: 44) от донора B (Фиг.7a-c) и MELK-A24-9-87_7N (SEQ ID NO: 44) от донора C (Фиг.7d) против клеток-мишеней, стимулированных с помощью MELK-A24-9-87_WT (SEQ ID NO: 6), по сравнению с клетками-мишенями, стимулированными с помощью постороннего HIV-пептида.

Взятые вместе результаты индуцирования ЦТЛ этих двух доноров демонстрируют, что MELK-A24-9-87_1K (SEQ ID NO: 35), MELK-A24-9-87_3M (SEQ ID NO: 41) и MELK-A24-9-87_7N (SEQ ID NO: 44) обладают более высокой иммуногенностью для индуцирования мощных MELK-A24-9-87-реактивных ЦТЛ по сравнению с MELK-A24-9-87_WT (SEQ ID NO: 6).

[0196] Специфичная активность ЦТЛ против клеток-мишеней, экспрессирующих MELK и HLA-A*2402

Созданные линии и клоны ЦТЛ исследовали на предмет их способности распознавать клетки-мишени, которые экспрессируют MELK и HLA-A*2402. На Фиг.8a, линия ЦТЛ, стимулированная с помощью MELK-A24-9-87_7N (SEQ ID NO: 44), демонстрировала мощную активность ЦТЛ против опухолевых клеточных линий MDA-MB-435S (MELK+, A24+) и KLM-1 (MELK+, A24+), не демонстрируя при этом активности ЦТЛ против T47D (MELK+, A24-) и KP-1N (MELK+, A24-). Для подтверждения того, что эта активность ЦТЛ была вызвана в манере рестриктирования по HLA класса I, осуществляли анализ ингибирования с использованием моноклонального антитела к HLA класса I, для блокирования антиген-специфичного ответа ЦТЛ. На Фиг.8b, продуцирование IFN-гамма клетками ЦТЛ против KLM-1 (MELK+, A24+) полностью ингибировалось с помощью моноклонального антитела, связывающего HLA класса I, по сравнению с нормальным мышиным IgG. Эти результаты очевидно демонстрируют, что ЦТЛ, индуцированные с помощью MELK-A24-9-87_7N (SEQ ID NO: 44), могут распознавать естественно экспрессированный эпитопный пептид MELK на клетках-мишенях вместе с молекулой HLA-A*2402 в манере рестриктирования по HLA класса I. В качестве типичных негативных данных, на Фиг.9 представлено продуцирование IFN-гамма клоном ЦТЛ, специфичным к MELK-A24-9-199 (SEQ ID NO: 1), против клеток-мишеней, стимулированных с помощью MELK-A24-9-199 (SEQ ID NO: 1) (a), против опухолевых клеточных линий KLM-1 (MELK+, A24+) и KP-1N (MELK+, A24-) (b). Хотя клон ЦТЛ, специфичный по отношению к MELK-A24-9-199 (SEQ ID NO: 1), обладает способностью распознавать стимулированные пептидом клетки-мишени, демонстрируется отсутствие продуцирования IFN-гамма против опухолевых клеточных линий KLM-1 (MELK+, A24+). Эти результаты предполагают, что MELK-A24-9-199 (SEQ ID NO: 1) не презентируется естественным образом на опухолевых клетках, экспрессирующих MELK.

[0197] Анализ гомологии антигенных пептидов

ЦТЛ, стимулированные с помощью MELK-A24-9-87 (SEQ ID NO: 6), MELK-A24-10-637 (SEQ ID NO: 23), MELK-A24-9-87_1K (SEQ ID NO: 35), MELK-A24-9-87_3M (SEQ ID NO: 41) и MELK-A24-9-87_7N (SEQ ID NO: 44), демонстрировали существенную и специфичную активность ЦТЛ. Этот результат может быть связан с тем фактом, что последовательности MELK-A24-9-87 (SEQ ID NO: 6), MELK-A24-10-637 (SEQ ID NO: 23), MELK-A24-9-87_1K (SEQ ID NO: 35), MELK-A24-9-87_3M (SEQ ID NO: 41) и MELK-A24-9-87_7N (SEQ ID NO: 44) гомологичны пептидам, полученным из других молекул, которые, как известно, сенсибилизируют иммунную систему человека. Для исключения этой возможности, осуществляли анализ гомологии для этих пептидных последовательностей, используя в качестве запроса алгоритм BLAST (www.ncbi.nlm.nih.gov/blast/blast.cgi), который обнаружил отсутствие последовательностей с значительной гомологией. Результаты анализов гомологии выявляют, что последовательности MELK-A24-9-87 (SEQ ID NO: 6), MELK-A24-10-637 (SEQ ID NO: 23), MELK-A24-9-87_1K (SEQ ID NO: 35), MELK-A24-9-87_3M (SEQ ID NO: 41) и MELK-A24-9-87_7N (SEQ ID NO: 44) уникальны, и, таким образом, насколько известно, существует небольшая вероятность того, что эти молекулы вызывают непредусмотренный иммунологический ответ на какие-то посторонние молекулы.

В заключение, идентифицировали новые эпитопные пептиды, полученные из MELK, и содержащие модифицированную последовательность MELK-A24-9-87 (SEQ ID NO: 6). Результаты, представленные в данном документе, демонстрируют, что MELK-A24-9-87_7N (SEQ ID NO: 44), модифицированные пептиды из MELK-A24-9-87 (SEQ ID NO: 6) эффективно индуцируют ЦТЛ, которые распознают клетки-мишени, экспрессирующие MELK, и демонстрируют мощную активность ЦТЛ по отношению к MELK-A24-9-87 (SEQ ID NO: 6).

[0198] Промышленная применимость:

В настоящем изобретении предлагаются новые TAA, конкретно, полученные из модифицированного пептида MELK, которые индуцируют мощный и специфичный противоопухолевый иммунный ответ и обладают применимостью для широкого спектра заболеваний, включая злокачественные новообразования. Такие TAA применяются в качестве пептидных вакцин против заболеваний, ассоциированных с сверхэкспрессией MELK, например, против эндометриоза или рака, более конкретно, против рака груди, рака мочевого пузыря, рака шейки матки, холангиоцеллюлярного рака, CML, колоректального рака, рака пищевода, рака желудка, рака печени, NSCLC, лимфомы, остеосаркомы, рака яичника, рака поджелудочной железы, рака предстательной железы, светлоклеточного рака и SCLC.

[0199] В то время как изобретение, описанное в данном документе подробно и со ссылками на конкретные воплощения, следует понимать, что приведенное выше описание представлено в качестве примера и является по своему характеру пояснительным, и оно предназначено для иллюстрации изобретения и его предпочтительных воплощений. С помощью обычного эксперимента специалист в данной области легко обнаружит различные изменения и модификации, которые могут быть здесь осуществлены, не выходя при этом за рамки смысла и сущности изобретения, границы которых определяются с помощью прилагаемой формулы изобретения.

1. Выделенный пептид, обладающий способностью индуцировать цитотоксический Т-лимфоцит (ЦТЛ) в присутствии антиген-презентирующей клетки (АПК), несущей HLA-A*2402, где пептид состоит из аминокислотной последовательности, включающей одну аминокислотную замену, выбранную из группы, состоящей из (i)-(iii):
(i) аминокислотная замена E на N в третьем положении с С-конца аминокислотной последовательности SEQ ID NO: 6;
(ii) аминокислотная замена E на K в N-концевом положении в аминокислотной последовательности SEQ ID NO: 6, и
(iii) аминокислотная замена C на M в третьем положении с N-конца аминокислотной последовательности SEQ ID NO: 6.

2. Выделенный пептид, обладающий способностью индуцировать ЦТЛ в присутствии АПК, несущей HLA-A*2402, где указанный пептид состоит из аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO: 44, 35 и 41, в которых вторая аминокислота от N-конца аминокислотной последовательности SEQ ID NO: 44, 35 или 41 заменена аминокислотой, выбранной из группы, состоящей из фенилаланина, метионина и триптофана; и/или С-концевая аминокислота аминокислотной последовательности SEQ ID NO: 44, 35 или 41 заменена аминокислотой, выбранной из группы, состоящей из лейцина, изолейцина, триптофана и метионина.

3. Выделенный полинуклеотид, кодирующий пептид по п. 1 или 2.

4. Композиция для индуцирования ЦТЛ в присутствии АПК, несущей HLA-A*2402, содержащая от 0,001 мг до 1000 мг одного или более пептидов по п. 1 или 2.

5. Фармацевтическая композиция для лечения раковых заболеваний, экспрессирующих MELK, где фармацевтическая композиция содержит от 0,001 мг до 1000 мг одного или более пептидов по п. 1 или 2, где указанная фармацевтическая композиция составлена для введения субъекту, чей HLA-антиген представляет собой HLA-A*2402.

6. Способ in vitro индуцирования АПК, несущей HLA-A*2402 со способностью индуцирования ЦТЛ, где способ включает стадию
приведения АПК, несущей HLA-A*2402, в контакт с пептидом по п. 1 или 2.

7. Способ in vitro индуцирования ЦТЛ приведением АПК, несущей HLA-A*2402 в комплексе с пептидом по п. 1 или 2, в контакт с CD8-положительной Т-клеткой.

8. Выделенная АПК для индуцирования специфического ЦТЛ, которая презентирует на своей поверхности комплекс, образованный между HLA-A*2402 и пептидом по п. 1 или 2, где указанная АПК индуцируется способом по п. 6.

9. Выделенный ЦТЛ для индуцирования иммунного ответа против рака, экспрессирующего MELK, у пациента, чей HLA-антиген представляет собой HLA-A*2402, который индуцируют с помощью способа по п. 7.

10. Способ индуцирования иммунного ответа против рака, экспрессирующего MELK, у субъекта, чей HLA-антиген представляет собой HLA-A*2402, включающий введение субъекту композиции, включающей пептид по п. 1 или 2.

11. Способ индуцирования иммунного ответа против эндометриоза, экспрессирующего MELK, у субъекта, чей HLA-антиген представляет собой HLA-A*2402, включающий введение субъекту композиции, включающей пептид по п. 1 или 2.

12. Применение по меньшей мере одного компонента, выбранного из группы, состоящей из (а)-(с), для изготовления фармацевтического средства или композиции, вводимых в субъекта для лечения рака, экспрессирующего MELK, у пациента, чей HLA-антиген представляет собой HLA-A*2402, где указанный компонент выбран из:
(a) пептида по п. 1 или 2;
(b) АПК, несущей HLA-A*2402 и презентирующей пептид по п. 1 или 2, которая получена стадиями:
(1) получения АПК, несущей HLA-A*2402, у субъекта;
(2) приведения в контакт АПК со стадии (1) с пептидом по п. 1 или 2; и
(c) цитотоксической Т-клетки, которая получена стадиями:
(1) получения АПК, несущей HLA-A*2402, и CD8-положительной Т-клетки у субъекта;
(2) приведения в контакт АПК со стадии (1) с пептидом по п. 1 или 2; и
(3) смешивания АПК со стадии (2) с CD8-положительной Т-клеткой со стадии (1) и совместного культивирования для индуцирования ЦТЛ.



 

Похожие патенты:

Изобретение относится к области биотехнологии и вирусологии. Описан новый штамм вируса ветряной оспы (VZV).

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению модифицированного vWF, и может быть использовано в медицине для лечения гемофилии.

Изобретение относится к области биотехнологии и иммунологии. Предложены новые противораковые антитела, которые связываются с рецептором “frizzled” человека.

Изобретение относится к композиции для поддержания функции тромбоцитов, где композиция в качестве активного ингредиента содержит соединение, представленное общей формулой (I), или его фармацевтически приемлемую соль: где соединение, представленное общей формулой (I), представляет собой любое из N-[2-(4-бут-2-инилоксибензолсульфонил)-1-(4-диэтиламинометилфенил)этил]-N-гидроксиформамида и N-{4-[2-(4-бут-2-инилоксибензолсульфонил)-1-(формилгидроксиамино)этил]бензил}метансульфонамида.

Данное изобретение относится к области иммунологии. Предложено выделенное антитело или его фрагмент, которые связываются с Axl человека и охарактеризованные последовательностями гипервариабельных участков (CDR).

Изобретения касаются системы стабильной экспрессии лентивирусных структурных и регуляторных белков, полустабильной линии пакующих клеток и способа получения лентивирусных векторов (LV) с использованием такой линии пакующих клеток.

Изобретения касаются способов получения стабильной линии пакующих лентивирусы клеток (варианты), стабильной линии пакующих лентивирусы клеток, способа получения лентивирусных векторов, линии клеток-продуцентов и способа производства лентивирусных векторов.

Настоящее изобретение относится к области иммунологии. Предложено моноклональное антитело и его антигенсвязывающий фрагмент, обладающие способностью специфически связываться с IL-17А человека и охарактеризованные последовательностями CDR.

Настоящее изобретение относится к области биотехнологии и может быть использовано для рекомбинантной экспрессии иммуномодуляторных белков. Конструируют вектор, содержащий полинуклеотид, кодирующий генный переключатель, при этом указанный полинуклеотид содержит (1) по меньшей мере одну последовательность фактора транскрипции, которая функционально связана с промотором, при этом указанная по меньшей мере одна последовательность фактора транскрипции кодирует лиганд-зависимый фактор транскрипции, и (2) полинуклеотид, кодирующий полипептид IL-12 и один или более иммуномодуляторных полипептидов, выбранных из IL-2, IL-7, IL-15, IL-18, IL-21, GM-CSF, CCL3 (MIP-1a), CCL5 (RANTES), CCL7 (MCP3), XCL1 (лимфотактин), CCL19 (MIP-3b), CXCL9 (MIG), CXCL10 (IP-10), CXCL12 (SDF-1), CCL21 (6Ckine) или TNF-альфа.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Изобретение относится к биотехнологии, конкретно к клеточным технологиям, и может быть использовано в регенеративной медицине. Выделяют взвесь неадгезирующих мононуклеаров клеток из ткани поджелудочной железы при сахарном диабете, в полученной взвеси оценивают количество мультипотентных прогениторных клеток, олигопотентных прогениторных клеток и инсулин-продуцирующих β-клеток.

Изобретение относится к гистологии. Раскрыт способ получения органоида печени.

Изобретение относится к композиции для поддержания функции тромбоцитов, где композиция в качестве активного ингредиента содержит соединение, представленное общей формулой (I), или его фармацевтически приемлемую соль: где соединение, представленное общей формулой (I), представляет собой любое из N-[2-(4-бут-2-инилоксибензолсульфонил)-1-(4-диэтиламинометилфенил)этил]-N-гидроксиформамида и N-{4-[2-(4-бут-2-инилоксибензолсульфонил)-1-(формилгидроксиамино)этил]бензил}метансульфонамида.

Изобретение относится к медицине. После удаления из глазного яблока взрослого донора-трупа роговично-склерального диска глазное яблоко при отсутствии сквозных повреждений радужной оболочки, цилиарного тела и видимой части собственно сосудистой оболочки (ССО) и выхода стекловидного тела за пределы витреальной полости полностью погружают в стерильную емкость со стерильным фосфатно-солевым буфером с рН 7,4.
Изобретение относится к медицине, а именно к травматологии и ортопедии. Выполняют забор мезенхимальных стволовых клеток пациента, выращивание из них аутологичных хондроцитов.

Изобретение относится к области биотехнологии и может быть использовано для индукции противоопухолевого иммунного ответа in vitro. Способ включает получение прилипающей и неприлипающей фракций мононуклеарных клеток (МНК), выделенных из периферической крови больного, совместное культивирование выделенных из периферической крови больного аутологичных МНК неприлипающей фракции со зрелыми дендритными клетками (ДК), полученными из прилипающей фракции МНК, трансфицированными РНК опухолевых клеток.

Изобретение относится к области криобиологии. Предложен способ консервации биоматериала.

Изобретение относится к области биотехнологии, конкретно к иммунологии, и может быть использовано для генерации цитотоксических клеток с активностью против клеток немелкоклеточного рака легкого.

Изобретение относится к области биотехнологии и генной инженерии. Описана мышь, имеющая неполный N-концевой домен в гене IL-33.

Изобретение относится к области биохимии. Предложен способ имплантации биологического материала в организм с использованием композиции, содержащей коллаген.

Изобретение относится к биотехнологии, в частности к получению противоопухолевых лекарственных средств для генной терапии, и может быть использовано в медицине. Получают лекарственное противоопухолевое средство, содержащее генную конструкцию в форме плазмидной ДНК, включающей гены тимидинкиназы вируса простого герпеса (HSVtk) и гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF), заключенную в полимерный носитель - сополимер полиэтиленгликоль-полиэтиленимин-тat пептид (ПЭГ-ПЭИ-ТАТ).
Наверх