Химерные гены ospa, белки и способы их применения



Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения
Химерные гены ospa, белки и способы их применения

 


Владельцы патента RU 2583289:

БАКСТЕР ИНТЕРНЭШНЛ ИНК. (US)
БАКСТЕР ХЭЛТКЭР С.А. (CH)
ДЗЕ РИСЕРЧ ФАУНДЕЙШН ФОР ДЗЕ СТЕЙТ ЮНИВЕРСИТИ ОФ НЬЮ ЙОРК (US)
БРУКХЕЙВН САЙЕНС АССОШИЭЙТС, ЭлЭлСи (US)

Изобретение относится к области биохимии, в частности к полипептиду, способному вызывать специфичный иммунный ответ против бактерий рода Borrelia, а также полинуклеотиду, его кодирующему. Также раскрыты экспрессионный вектор, содержащий вышеуказанный полинуклеотид, клетка-хозяин, его содержащая, а также способ получения пептида путем культивирования вышеуказанной клетки-хозяина. Изобретение также относится к композициям, содержащим вышеуказанные полинуклеотиды или полипептиды, для вызова специфичного иммунного ответа против бактерий рода Borrelia. Изобретение позволяет эффективно лечить или проводить профилактику инфекции Borrelia или лаймской болезни. 12 н. и 12 з.п. ф-лы, 24 ил., 9 табл., 22 пр.

 

Область техники

Изобретение в общем относится к химерным полипептидам OspA, нуклеиновым кислотам, кодирующим полипептиды, композициям, содержащим такие молекулы, и способам их применения.

Известный уровень техники

Лаймская болезнь представляет собой переносимую клещами болезнь, вызываемую Borrelia burgdorferi sensu lato (s.l.). Болезнь типично характеризуется появлением распространяющейся красной сыпи на месте укуса клеща, за которой могут последовать системные осложнения, включая менингит, кардит или артрит. Почти все случаи лаймской болезни вызываются одним из трех геновидов - Borrelia afzelii, Borrelia garinii и Borrelia burgdorferi sensu stricto (s.s.). В Европе были обнаружены все три вида, инфицирующие людей. Однако в Северной Америке найден только один вид - Borrelia burgdorferi sensu stricto. Borrelia burgdorferi представляет собой вид грамотрицательных бактерий класса спирохет рода Borrelia. Лечение лаймской болезни антибиотиками обычно является эффективным, но у некоторых пациентов развивается хроническая инвалидизирующая форма болезни, затрагивающая суставы или нервную систему, существенно не улучшающаяся даже после терапии парентеральными антибиотиками, что указывает на потребность в вакцине для популяций с высокой степенью риска.

Внешний поверхностный белок A (OspA) представляет собой 31-кДа антиген, экспрессируемый видом Borrelia burgdorferi s.l., присутствующим в средней кишке иксодовых клещей. Была продемонстрирована эффективность OspA для профилактики лаймской болезни в Северной Америке (Steere et al., N. Engl. J. Med. 339: 209-15,1998; Sigal et al., N. Engl. J. Med. 339:216-22, 1998; erratum in: N. Engl. J. Med. 339:571, 1998). Амино-конец полностью процессированного OspA представляет собой цистеиновый остаток, который посттрансляционно модифицируется тремя жирными ацильными цепями, закрепляющими белок на внешней поверхности бактериальной мембраны (Bouchon et al., Anal. Biochem. 246: 52-61, 1997). Сообщается, что липидирование OspA стабилизирует молекулу (Luft, личное сообщение) и является существенным для защиты в отсутствие сильного адъюванта (Erdile et al., Infect. Immun. 61: 81-90, 1993). Растворимая рекомбинантная форма белка, не имеющая амино-концевого липидного мембраносвязывающего фрагмента, была со-кристаллизована с фрагментом Fab агглютинирующего мышиного моноклонального антитела для определения структуры OspA, который, как было продемонстрировано, содержит 21 антипараллельную β-нить с последующей одной α-спиралью (Li et al., Proc. Natl. Acad. Sci. U.S.A. 94:3584-9, 1997).

Моновалентная вакцина на основе OspA (LYMErix®) для профилактики лаймской болезни выпущена в продажу в США. Однако в Европе гетерогенность последовательностей OspA у трех геновидов препятствует широкой защите вакциной на основе OspA от одного штамма (Gern et al., Vaccine 15:1551-7, 1997). В европейских изолятах были определены семь основных серотипов OspA (обозначенных как серотипы 1-7, Wilske et al., J. Clin. Microbiol. 31:340-50, 1993). Серотипы OspA коррелируют с видами; серотип 1 соответствует B. burgdorferi s.s., серотип 2 соответствует B. afzelii и серотипы 3-7 соответствуют B. garinii.

Защитный иммунитет, приобретенный в результате иммунизации с помощью OspA, является исключительным, поскольку взаимодействие между иммунным ответом хозяина и патогеном происходит не в хозяине, а в средней кишке клеща-переносчика. В случае лаймской болезни, клещ выступает в роли переносчика или носителя при передаче лаймской болезни от животных людям. OspA-специфическое антитело, приобретенное во время кормления инфицированного клеща, препятствует переносу B. burgdorferi s.l. иммунизированному млекопитающему-хозяину (de Silva et al., J. Exp. Med. 183: 271-5, 1996). Защита является антитело-медиируемой и преимущественно обеспечивается бактерицидным антителом, хотя антитело, блокирующее прикрепление спирохеты к рецептору выстилки кишечного эпителия клеща, также может быть эффективным (Pal et al., J. Immunol. 166: 7398-403, 2001).

Рациональная разработка эффективных вакцин OspA требует идентификации защитных эпитопов, таких как определяемых защитным моноклональным антителом LA-2 (Golde et al., Infect. Immun. 65: 882-9, 1997). Анализ способами рентгеновской кристаллографии и ЯМР был использован для идентификации иммунологически важных гипервариабельных доменов OspA и локализации эпитопа LA-2 путем картирования на аминокислотах 203-257 (Ding et al., J. Mol. Biol. 302: 1153-64, 2000; Luft et al. J Infect Dis. 185 (Suppl. 1): S46-51, 2002).

В данной области техники существует потребность в разработке вакцины OspA, обеспечивающей широкую защиту против различных видов Borrelia, встречающихся в США, Европе и других регионах. Приведенное далее описание содержит характеристики такой вакцины.

Сущность изобретения

Изобретение направлено на удовлетворение одной или более потребностей в данной области техники, касающихся профилактики и лечения лаймской болезни или лайм-боррелиоза.

Изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 1, 3 и 5. В некоторых аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, состоящую из нуклеотидной последовательности, выбранной из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 1, 3 и 5. В других аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из: (а) нуклеотидной последовательности с по меньшей мере 90, 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности с молекулой нуклеиновой кислоты, содержащей нуклеотидную последовательность, приведенную в SEQ ID NO: 1, SEQ ID NO: 3 или SEQ ID NO: 5; и (б) нуклеотидной последовательности, комплементарной к (а). В дополнительных аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из: (а) нуклеотидной последовательности, кодирующей полипептид с по меньшей мере 90, 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности с полипептидом, содержащим аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6; и (б) нуклеотидной последовательности, комплементарной к (а). В других аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из: (а) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит замещение от одной до 25 консервативных аминокислот; (б) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит инсерцию от одной до 25 консервативных аминокислот; (в) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит внутреннюю делецию от одной до 25 консервативных аминокислот; (г) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит C- и/или N-терминальное усечение от одной до 25 аминокислот; (д) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит модификацию от одной до 25 аминокислот, выбранную из аминокислотных замещений, аминокислотных инсерций, аминокислотных делеций, C-терминального усечения или N-терминального усечения; и (е) нуклеотидной последовательности, комплементарной к любой из (а)-(д).

Изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 7, 9 и 11. В некоторых аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, состоящую из нуклеотидной последовательности, выбранной из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 7, 9 и 11. В дополнительных аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из: (а) нуклеотидной последовательности с по меньшей мере 90, 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности с молекулой нуклеиновой кислоты, содержащей нуклеотидную последовательность, приведенную в SEQ ID NO: 7, SEQ ID NO: 9 или SEQ ID NO: 11; и (б) нуклеотидной последовательности, комплементарной к (а). В дополнительных аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из: (а) нуклеотидной последовательности, кодирующей полипептид с по меньшей мере 90, 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности с полипептидом, содержащим аминокислотную последовательность, приведенную в SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12; и (б) нуклеотидной последовательности, комплементарной к (а). В других аспектах, изобретение включает изолированную молекулу нуклеиновой кислоты, содержащую нуклеотидную последовательность, выбранную из группы, состоящей из: (а) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12, причем полипептид содержит замещение от одной до 25 консервативных аминокислот; (б) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12, причем полипептид содержит инсерцию от одной до 25 консервативных аминокислот; (в) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12, причем полипептид содержит внутреннюю делецию от одной до 25 консервативных аминокислот; (г) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12, причем полипептид содержит C- и/или N-терминальное усечение от одной до 25 аминокислот; (д) нуклеотидной последовательности, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12, причем полипептид содержит модификацию от одной до 25 аминокислот, выбранную из аминокислотных замещений, аминокислотных инсерций, аминокислотных делеций, C-терминального усечения или N-терминального усечения; и (е) нуклеотидной последовательности, комплементарной к любой из (а)-(д).

Изобретение включает векторы, клетки-хозяева и способы получения полипептидов путем культивации клеток-хозяев, описанных тут. В некоторых аспектах, изобретение включает вектор, содержащий любые молекулы нуклеиновой кислоты, описанные тут. В других аспектах, изобретение включает клетку-хозяина, которая содержит такие векторы. В некоторых аспектах, клетка-хозяин представляет собой эукариотическую клетку. В других аспектах, клетка-хозяин представляет собой прокариотическую клетку. В различных аспектах, способ получения полипептида включает культивацию клеток-хозяев, описанных тут, в условиях, пригодных для экспрессии полипептида и, необязательно, выделение полипептида из культуры. В различных аспектах, изобретение включает композиции, содержащие любые из таких химерных молекул нуклеиновой кислоты или любые векторы, содержащие такие молекулы нуклеиновой кислоты и фармацевтически приемлемый носитель или носители.

Изобретение включает композиции, содержащие любые молекулы нуклеиновой кислоты, описанные тут, или любые векторы, описанные тут, и фармацевтически приемлемый носитель. В некоторых аспектах, изобретение включает композиции, содержащие по меньшей мере две молекулы нуклеиновой кислоты, описанные тут, и фармацевтически приемлемый носитель, причем молекулы нуклеиновой кислоты имеют разные нуклеотидные последовательности. В конкретных аспектах, изобретение включает композиции, содержащие комбинацию нуклеотидных последовательностей, приведенных в SEQ ID NOS: 1, 3 и 5.

Изобретение включает изолированный полипептид, содержащий аминокислотную последовательность, выбранную из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 2, 4 и 6. В некоторых аспектах, изобретение включает изолированный полипептид, состоящий из аминокислотной последовательности, выбранной из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 2, 4 и 6. В дополнительных аспектах, изобретение включает изолированный полипептид, содержащий аминокислотную последовательность, состоящую из по меньшей мере 200 аминокислотных остатков, с по меньшей мере 90, 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности с полипептидом, содержащим аминокислотную последовательность, приведенную в SEQ ID NO:2, SEQ ID NO:4 или SEQ ID NO: 6. В дополнительных аспектах, изобретение включает изолированный полипептид, содержащий аминокислотную последовательность, выбранную из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 8, 10 и 12. В других аспектах, изобретение включает изолированный полипептид, состоящий из аминокислотной последовательности, выбранной из группы, состоящей из последовательностей, приведенных в SEQ ID NOS: 8, 10 и 12. В некоторых аспектах, изобретение включает изолированный полипептид, содержащий аминокислотную последовательность, состоящую из по меньшей мере 200 аминокислотных остатков, с по меньшей мере 90, 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности с полипептидом, содержащим аминокислотную последовательность, приведенную в SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12.

Изобретение включает композиции, содержащие любые из полипептидов, описанных тут, и фармацевтически приемлемый носитель. В некоторых аспектах, изобретение включает композиции, содержащие по меньшей мере два полипептида, описанных тут и фармацевтически приемлемый носитель, причем полипептиды имеют разные аминокислотные последовательности. В конкретных аспектах, изобретение включает композиции, содержащие комбинацию полипептидов, содержащих аминокислотные последовательности, приведенные в SEQ ID NOS: 2, 4 и 6.

Изобретение включает иммуногенные композиции. В некоторых аспектах, иммуногенная композиция по изобретению содержит любую из описанных тут композиций и фармацевтически приемлемый носитель. В различных аспектах, иммуногенная композиция обладает способностью индуцировать продуцирование антитела, которое специфически связывается с внешним поверхностным белком A (OspA). В определенных аспектах, иммуногенная композиция обладает способностью индуцировать продуцирование антитела, которое специфически связывается с Borrelia. В конкретных аспектах, иммуногенная композиция обладает способностью индуцировать продуцирование антитела, нейтрализующего Borrelia. В определенных аспектах, Borrelia представляет собой Borrelia burgdorferi sensu lato. В конкретных аспектах, Borrelia представляет собой Borrelia afzelii, Borrelia garinii или Borrelia burgdorferi sensu stricto. В дополнительных аспектах, Borrelia представляет собой Borrelia japonica, Borrelia andersonii, Borrelia bissettii, Borrelia sinica, Borrelia turdi, Borrelia tanukii, Borrelia valaisiana, Borrelia lusitaniae, Borrelia spielmanii, Borrelia miyamotoi или Borrelia lonestar. В некоторых аспектах, антитело продуцируется животным. В дополнительных аспектах, животное представляет собой млекопитающее. В других аспектах, млекопитающее является человеком.

Изобретение включает композиции вакцины. В некоторых аспектах, композиция вакцины по изобретению содержит любую иммуногенную композицию, описанную тут, и фармацевтически приемлемый носитель. В различных аспектах, изобретение включает комбинированную вакцину. В определенных аспектах, комбинированная вакцина по изобретению содержит любую композицию вакцины, описанную тут, в сочетании с по меньшей мере второй композицией вакцины. В некоторых аспектах, вторая композиция вакцины защищает от переносимой клещами болезни. В различных аспектах, переносимая клещами болезнь представляет собой пятнистую лихорадку Скалистых гор, бабезиоз, возвратную лихорадку, колорадскую клещевую лихорадку, моноцитарный эрлихиоз человека (HME), гранулоцитарный эрлихиоз человека (HGE), клещевую сыпную лихорадку STARI (Southern Tick-Associated Rash Illness), туляремию, клещевой паралич, энцефалит Повассан, ку-лихорадку, конго-крымскую геморрагическую лихорадку, цитауксзооноз (cytauxzoonosis), марсельскую лихорадку или клещевой энцефалит. В других аспектах, вторая композиция вакцины представляет собой вакцину, выбранную из группы, состоящей из: вакцины клещевого энцефалита, вакцины японского энцефалита и вакцины пятнистой лихорадки Скалистых гор. В различных аспектах, вторая композиция вакцины имеет сезонный график иммунизации, совместимый с иммунизацией против инфекции Borrelia или лаймской болезни.

Изобретение включает способы индуцирования иммунологического ответа у субъекта. В различных аспектах, такие способы включают стадию введения субъекту любой из иммуногенных композиций или композиций вакцины, описанных тут, в количестве, эффективно индуцирующем иммунологический ответ. В определенных аспектах, иммунологический ответ включает продуцирование анти-OspA антитела. Изобретение включает антитела или их фрагменты, специфически связывающиеся с любыми из описанных тут полипептидов.

Изобретение включает способы профилактики или лечения инфекции Borrelia или лаймской болезни у субъекта. В различных аспектах, такие способы включают стадию введения субъекту любой из композиций вакцины, описанных тут, или любой из комбинированных вакцин, описанных тут, в количестве, обеспечивающем эффективную профилактику или лечение инфекции Borrelia или лаймской болезни. В других аспектах, такие способы включают стадию введения субъекту любых описанных тут антител в количестве, обеспечивающем эффективную профилактику или лечение инфекции Borrelia или лаймской болезни. В определенных аспектах, такие способы включают стадию введения субъекту антитела или его фрагмента, полученного путем иммунизации млекопитающего композицией вакцины по любому из пп. 28-34, в количестве, обеспечивающем эффективную профилактику или лечение инфекции Borrelia или лаймской болезни. В некоторых аспектах, антитело или его фрагмент представляет собой гипериммунную сыворотку, гипериммунную плазму или их очищенную иммуноглобулиновую фракцию.

Изобретение включает способы пассивной профилактики инфекции Borrelia или лаймской болезни у субъекта, включающие стадию введения субъекту анти-OspA антитела или его фрагмента, полученного путем иммунизации млекопитающего любой из композиций вакцины, описанных тут, в количестве, обеспечивающем эффективную профилактику инфекции Borrelia или лаймской болезни, где антитело или его фрагмент представляют собой очищенный препарат иммуноглобулина или препарат иммуноглобулинового фрагмента.

Изобретение включает способы профилактики инфекции Borrelia или лаймской болезни у субъекта, включающие стадию введения субъекту анти-OspA моноклонального антитела или его фрагмента, вырабатываемого после иммунизации субъекта любой из композиций вакцины, описанных тут, в количестве, обеспечивающем эффективную профилактику инфекции Borrelia или лаймской болезни. В некоторых аспектах, моноклональное антитело или его фрагмент являются гуманизированными. В конкретном аспекте, моноклональное антитело представляет собой F237/BK2.

Изобретение включает использование композиций по изобретению для изготовления лекарственных препаратов. Настоящее изобретение также предусматривает другие родственные аспекты.

Изложенная выше сущность изобретения не предназначена для описания всех аспектов изобретения, и дополнительные аспекты описаны в других разделах, таких как приведенное далее детальное описание. Весь документ должен рассматриваться как единое раскрытие изобретения и следует понимать, что предусматриваются все комбинации признаков, описанных тут, даже если комбинация признаков не встречается вместе в одном и том же предложении, или абзаце, или разделе данного документа. Другие признаки и преимущества изобретения будут понятны из приведенного далее детального описания. Следует понимать, однако, что детальное описание и конкретные примеры, указывающие конкретные варианты воплощения изобретения, приводятся только с целью иллюстрации, потому что различные изменения и модификации сущности и объема изобретения будут понятны квалифицированным специалистам в данной области техники из данного детального описания.

Краткое описание чертежей

Фигура 1 представляет собой общую схему получения липидированных химерных конструктов OspA.

Фигура 2 представляет собой аминокислотную последовательность lipB sOspA 1/2251 (SEQ ID NO: 2).

Фигура 3 изображает нуклеотидную (SEQ ID NO: 1) и расшифрованные аминокислотные последовательности (SEQ ID NO: 2) lipB sOspA 1/2251.

Фигура 4 представляет собой аминокислотную последовательность lipB sOspA 6/4 (SEQ ID NO: 4).

Фигура 5 изображает нуклеотидную (SEQ ID NO: 3) и расшифрованные аминокислотные последовательности (SEQ ID NO: 4) lipB sOspA 6/4.

Фигура 6 представляет собой аминокислотную последовательность lipB sOspA 5/3 (SEQ ID NO: 6).

Фигура 7 изображает нуклеотидную (SEQ ID NO: 5) и расшифрованные аминокислотные последовательности (SEQ ID NO: 6) lipB sOspA 5/3.

Фигура 8 изображает оптимизацию использования кодонов для высокого уровня экспрессии.

Фигура 9 изображает различия между последовательностями липидированных и нелипидированных конструктов.

Фигура 10 представляет собой описание системы экспрессии T7.

Фигура 11 представляет собой результаты анализа способом ДСН-ПААГ, показывающие экспрессию новых рекомбинантных белков OspA индуцированными и неиндуцированными культурами.

Фигура 12 представляет собой карту плазмиды pUC18.

Фигура 13 представляет собой карту плазмиды pET30a.

Фигура 14 изображает стратегию создания фрагмента Kpn I - Bam HI lipB sOspA 5/3.

Фигура 15 изображает выравнивание с указанием аминокислотной замены (SEQ ID NO: 39) в lipB sOspA 1/2251 и праймерные последовательности PCR (SEQ ID NOS: 21 и 41), используемые для введения замены (lipB OspA 1/2 mod (SEQ ID NO: 38); консенсусная последовательность (SEQ ID NO: 40)).

Фигура 16 изображает выравнивание OspA-последовательности Blip OspA BPBP/A1 с модифицированной молекулой lipB sOspA 1/2251. Верхняя нить представляет собой исходную последовательность (SEQ ID NO: 42), и нижняя нить представляет собой оптимизированную последовательность (SEQ ID NO: 43). Примечание: три основания (CAT) в начале последовательности не показаны; они образуют часть сайта Nde I CATATG.

Фигура 17 изображает выравнивание OspA-последовательности Blip OspA KT с модифицированной молекулой lipB sOspA 6/4. Верхняя нить представляет собой исходную последовательность (SEQ ID NO: 44) и нижняя нить представляет собой оптимизированную последовательность (SEQ ID NO: 45). Примечание: Одно основание (C) в начале последовательности не показано; оно входит в состав сайта Nde I CATATG.

Фигура 18 изображает выравнивание OspA-последовательности Blip OspA 5/3 с модифицированной молекулой lipB sOspA 5/3. Верхняя нить представляет собой исходную последовательность (SEQ ID NO: 46) и нижняя нить представляет собой оптимизированную последовательность (SEQ ID NO: 47).

Фигура 19 изображает распределение функциональных анти-OspA ответов по результатам проведения анализов на поверхностное связывание антител и ингибирование роста у защищенных и инфицированных животных, иммунизированных 3 нг OspA 1/2 перед контрольным заражением штаммом B. burgdorferi s.s. B31. p-Значения Манна-Уитни продемонстрировали высокозначимые различия по содержанию функциональных антител между защищенными и инфицированными животными.

Фигура 20 изображает распределение функциональных анти-OspA ответов по результатам проведения анализов на поверхностное связывание антител и ингибирование роста у защищенных и инфицированных животных, иммунизированных 3 нг OspA 1/2 перед контрольным заражением природными клещами. p-Значения Манна-Уитни продемонстрировали высокозначимые различия по содержанию функциональных антител между защищенными и инфицированными животными.

Фигура 21 изображает поверхностное связывание (средние интенсивности флуоресценции (MFI)) и ингибирование роста (титры GI-50) в пуле мышиной сыворотки после иммунизации тремя дозами 3-компонентной вакцины химерного OspA. Эффективное поверхностное связывание и ингибирование роста наблюдались для всех шести штаммах Borrelia, экспрессирующих типы OspA, гомологичные типам OspA в вакцине (типы 1-6).

Фигура 22 изображает титры средней интенсивности флуоресценции (MFI), которые были получены с использованием сывороток дня 42 индивидуальных мышей, иммунизированных комбинациями вакцин rOspA путем проведения анализа на поверхностное связывание (SBA). Результаты показали, что все три компонента rOspA (1/2, 6/4 и 5/3) являются необходимыми в мультивалентной вакцине для индуцирования высоких титров поверхностного связывания IgG-антител против всех 6 штаммов у C3H-мышей. Двухкомпонентные вакцины не покрывают полностью 2 отсутствующие штамма.

Фигура 23 изображает ингибирование роста Borreliae с использованием сыворотки дня 42 индивидуальных мышей (в группах по 10), иммунизированных комбинациями вакцин rOspA. Только мультивалентная вакцина (вакцина, содержащая все три штамма) давала >50% ингибирования роста у >90% животных (n=10). Черные столбики (со сплошной заливкой) указывают штаммы, гомологичные использованной вакцине.

Фигура 24 изображает покрытие (coverage) Borreliae, экспрессирующих внутритиповые варианты OspA. Поверхностное связывание было классифицировано на сильное (усиление флуоресценции >10-кратного) или более слабое (2-10-кратное усиление флуоресценции).

ДЕТАЛЬНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Изобретение предусматривает химерные молекулы OspA, пригодные для использования в качестве антигенов, которые могут быть введены как иммуногенная композиция или композиция вакцины при лаймской болезни или инфекции Borrelia. Перед детальным пояснением каких-либо вариантов воплощения изобретения укажем, что изобретение не должно рассматриваться как ограниченное в его применении деталями конструкции и конфигурацией компонентов, указанных в приведенном ниже описании или проиллюстрированных на фигурах и в примерах. Используемые тут заголовки разделов приводятся только в организационных целях и не должны пониматься как ограничивающие описываемый предмет. Все упоминаемые в данной заявке первоисточники явным образом включены сюда в качестве ссылок.

Изобретение охватывает другие варианты воплощения и практикуется или осуществляется различными способами. Также, следует понимать, что фразеология и терминология, используемые тут, предназначены для описания и не должны рассматриваться как ограничивающие. Термины "включающий", "содержащий" или "имеющий" и их варианты следует понимать как охватывающие перечисленные далее позиции и их эквиваленты, а также дополнительные позиции.

Варианты воплощения изобретения проиллюстрированы на примерах конструирования и синтеза трех химерных кодирующих последовательностей OspA, которые кодируют три различные липидированные молекулы OspA, обладающие некоторыми общими признаками. Каждая химерная кодирующая последовательность представляет два серотипа OspA, и химерные кодирующие последовательности были сконструированы таким образом, чтобы они кодировали стабильные химерные молекулы OspA, являющиеся безопасными и сильно иммуногенными, и обеспечивающие защиту субъекта против инфекции B. burgdorferi sensu lato (s.l.).

В одном аспекте, химерные молекулы OspA содержат проксимальный участок от одного серотипа OspA, вместе с дистальным участком от другого серотипа OspA, сохраняя при этом защитные свойства обоих родительских полипептидов. Химерные молекулы нуклеиновой кислоты OspA экспрессировали в Escherichia coli (E. coli) для получения антигенов, которые могли быть введены в комбинированную вакцину для обеспечения защиты против всех шести распространенных серотипов (серотипы 1-6), ассоциированных с лаймской болезнью или инфекцией Borrelia в Европе и против единственного серотипа OspA, ассоциированного с лаймской болезнью или инфекцией Borrelia в Северной Америке. Поскольку вакцина, содержащая серотипы 1-6, обеспечивает защиту против B. afzelii, B. garinii и B. burgdorferi, вакцина предназначена для глобального применения.

Изобретение также включает приготовление второго набора химерных кодирующих последовательностей OspA которые, в одном аспекте, являются производными от первого набора из трех генов, путем удаления последовательностей нуклеиновых кислот, кодирующих лидерную последовательность, необходимую для продуцирования липидированной молекулы OspA. Два набора конструктов (дающих липидированные и нелипидированные полипептиды) были необходимы для оценки простоты их продуцирования в ферментере (биомасса, стабильность, выход продуктов и т.д.), для определения того, насколько легко может осуществляться очистка разных типов антигена и для сравнения их биологических характеристик (профиль безопасности и эффективность защиты).

Изобретение включает иммуногенные композиции, содержащие химерные молекулы OspA по изобретению. Изобретение аналогично включает вакцины и наборы вакцин, содержащих такие молекулы OspA, способы получения иммуногенных композиций и вакцин и использование иммуногенных композиций и вакцин в медицинской терапии и профилактике человека и животных. Изобретение дополнительно включает способы иммунизации против лаймской болезни или инфекции Borrelia с использованием композиций OspA, описанных тут, и использование композиций OspA в производстве лекарственных средств для профилактики лаймской болезни или инфекция Borrelia.

Определения

Если не указано иное, то все технические и научные термины, используемые тут, имеют значения, общеизвестные рядовым специалистам в области техники, к которой принадлежит данное изобретение. Следующие источники содержат общие определения многих терминов, используемых в данном изобретении: Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY (2d ed. 1994); THE CAMBRIDGE DICTIONARY OF SCIENCE AND TECHNOLOGY (Walker ed., 1988); THE GLOSSARY OF GENETICS, 5TH ED., R. Rieger, et al. (eds.), Springer Verlag (1991); и Hale и Marham, THE HARPER COLLINS DICTIONARY OF BIOLOGY (1991).

В тексте используются следующие аббревиатуры:

AA аминокислота
Amp ампициллин
п.о. (bp) пар оснований
B. afzelii Borrelia afzelii
B. burdorferi Borrelia burgdorferi
B. garinii Borrelia garinii
ДНК (DNA) дезоксирибонуклеиновая кислота
dNTPs дезоксинуклеотидтрифосфат
E. coli Escherichia coli
содержание GC процент последовательности, содержащей основания гуанин и цитозин
hLFA-1 ассоциированный с функцией лейкоцитов человеческий антиген-1
ВЭЖХ (HPLC) высокоэффективная жидкостная хроматография
IP интеллектуальная собственность
IPTG изопропил-бета-D-тиогалактопиранозид
Kan канамицин
кДа (kDa) килодальтон
LB среда Луриа
Lip B лидерная последовательность внешнего поверхностного белка B
Mab моноклональное антитело
OD оптическая плотность
OspA внешний поверхностный белок A
OspB внешний поверхностный белок B
ПЦР (PCR) полимеразная цепная реакция
РНК (RNA) рибонуклеиновая кислота
s.l. sensu lato
s.s. sensu stricto
ДСН (SDS) додецилсульфат натрия
SMK питательная среда для E. coli (среда с кетоглутаратом-сорбитом)
тРНК (tRNA) транспортная рибонуклеиновая кислота
WCB рабочий банк клеток

Отметим, что, в используемом в данном описании и приложенной формуле изобретения значении, формы единственного числа (в английском тексте - с артиклями “a”, “an” и “the”) включают ссылки на множественное число, если из контекста явным образом не следует иное.

В используемом тут значении, следующие термины имеют указанные для них значения, если не будет указано иное.

Термин “ген” относится к ДНК-последовательности, кодирующей последовательность аминокислот, которая содержит все или часть одного или более полипептидов, белков или ферментов, и может включать или не включать интроны и регуляторные ДНК-последовательности, такие как промоторные или энхансерные последовательности, 5'-нетранслируемую область или 3'-нетранслируемую область, которые влияют, например, на условия, в которых ген экспрессируется. В данном описании, ген OspA является бактериальным и потому не содержит интронов. Термин “кодирующая последовательность” относится к ДНК-последовательности, которая кодирует последовательность аминокислот, но не содержит интронов или регуляторных последовательностей. Аналогично, в данном описании кодирующая последовательность OspA не содержит регуляторных последовательностей.

“Нуклеиновая кислота”, или “последовательность нуклеиновой кислоты”, или “молекула нуклеиновой кислоты” относится к дезоксирибонуклеотидам или рибонуклеотидам и их полимерам в одно- или двухцепочечной форме. Термин охватывает нуклеиновые кислоты, которые содержат известные нуклеотидные аналоги или модифицированные остатки в основной цепи или связи, являются синтетическими, природными и неприродными, обладают способностью к связыванию, близкой к эталонной нуклеиновой кислоте, и подвергаются метаболизму аналогично эталонным нуклеотидам. Примеры таких аналогов включают, без ограничений, фосфоротиоаты, фосфорамидаты, метилфосфонаты, хиральные метилфосфонаты, 2-O-метилрибонуклеотиды, пептидо-нуклеиновые кислоты (PNAs). Термины охватывают молекулы, состоящие из любых известных аналогов оснований ДНК и РНК, таких как, без ограничений, 4-ацетилцитозин, 8-гидрокси-N6-метиладенин, азиридинилцитозин, псевдоизоцитозин, 5-(карбоксигидроксилметил)урацил, 5-фторурацил, 5-бромурацил, 5-карбоксиметиламинометил-2-тиоурацил, 5-карбоксиметиламинометилурацил, дигидроурацил, инозин, N6-изопентениладенин, 1-метиладенин, 1-метилпсевдоурацил, 1-метилгуанин, 1-метилинозин, 2,2-диметилгуанин, 2-метиладенин, 2-метилгуанин, 3-метилцитозин, 5-метилцитозин, N6-метиладенин, 7-метилгуанин, 5-метиламинометилурацил, 5-метоксиаминометил-2-тиоурацил, бета-D-маннозилквеозин, 5'-метоксикарбонилметилурацил, 5-метоксиурацил, 2-метилтио-N6-изопентениладенин, урацил-5-оксиуксусной кислоты сложный метиловый эфир, урацил-5-оксиуксусная кислота, оксибутоксозин, псевдоурацил, квеозин, 2-тиоцитозин, 5-метил-2-тиоурацил, 2-тиоурацил, 4-тиоурацил, 5-метилурацил, N-урацил-5-оксиуксусной кислоты сложный метиловый эфир, урацил-5-оксиуксусная кислота, псевдоурацил, квеозин, 2-тиоцитозин и 2,6-диаминопурин.

Если не указано иное, конкретная последовательность нуклеиновой кислоты также охватывает по умолчанию ее консервативно модифицированные варианты (напр., замещения вырожденного кодона) и комплементарные последовательности, а также явным образом указанную последовательность. Конкретнее, замещения вырожденного кодона, в некоторых аспектах, получают путем генерирования последовательностей, в которых третье положение одного или более выбранных (или всех) кодонов замещено остатками смешанных оснований и/или дезоксиинозина (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)). Термин нуклеиновая кислота используется взаимозаменяемо с геном, кДНК, мРНК, олигонуклеотидом и полинуклеотидом.

Термины “полипептид”, “пептид” и “белок” используются в данном описании взаимозаменяемо по отношению к полимеру, состоящему из аминокислотных остатков, соединенных пептидными связями. Термины относятся к аминокислотным полимерам, в которых один или несколько аминокислотных остатков представляют собой искусственный химический миметик соответствующей природной аминокислоты, а также к природным аминокислотным полимерам и неприродным аминокислотным полимерам. Термин “белок” типично относится к крупным полипептидам. Термин “пептид” типично относится к коротким полипептидам. Синтетические полипептиды могут быть синтезированы, например, с помощью автоматического полипептидного синтезатора.

Термин “молекула OspA” или “химерная молекула OspA” относится, в одном аспекте, к “нуклеиновой кислоте OspA”, содержащей нуклеотидную последовательность SEQ ID NO: 1 (lipB sOspA 1/2251), SEQ ID NO: 3 (lipB sOspA 6/4), SEQ ID NO: 5 (lipB sOspA 5/3), SEQ ID NO: 7 (sOspA 1/2251), SEQ ID NO: 9 (sOspA 6/4), SEQ ID NO: 11 (sOspA 5/3), SEQ ID NO: 168 (orig sOspA 1/2), SEQ ID NO: 170 (orig sOspA 6/4) или SEQ ID NO: 172 (orig sOspA 5/3), или, в другом аспекте, к “полипептиду OspA”, содержащему аминокислотную последовательность SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3).

Термин “молекула lipB sOspA” относится, в одном аспекте, к “нуклеиновой кислоте OspA”, содержащей нуклеотидную последовательность SEQ ID NO: 1 (lipB sOspA 1/2251), SEQ ID NO: 3 (lipB sOspA 6/4) или SEQ ID NO: 5 (lipB sOspA 5/3), или, в другом аспекте, к “полипептиду OspA”, содержащему аминокислотную последовательность SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4) или SEQ ID NO: 6 (lipB sOspA 5/3). Последовательности нуклеиновой кислоты SEQ ID NOS: 7, 9 и 11 не содержат последовательности нуклеиновой кислоты, кодирующей лидерную последовательность lipB (MRLLIGFALALALIG (SEQ ID NO: 13). Кроме того, последовательности нуклеиновой кислоты SEQ ID NOS: 7, 9 и 11 кодируют остаток метионина на амино-конце SEQ ID NOS: 8, 10 и 12 вместо цистеинового остатка, присутствующего на карбокси-конце лидерной последовательности lipB в SEQ ID NOS: 2, 4 и 6.

Термин “молекула orig sOspA” или “исходная молекула sOspA” относится, в одном аспекте, к “нуклеиновой кислоте OspA”, содержащей нуклеотидную последовательность SEQ ID NO: 168 (orig sOspA 1/2), SEQ ID NO: 170 (orig sOspA 6/4) или SEQ ID NO: 172 (orig sOspA 5/3), или, в другом аспекте, к “полипептиду OspA”, содержащему аминокислотную последовательность SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3). Такие “исходные” молекулы представляют собой химерные конструкты без мутаций и без оптимизации кодонов.

Изобретение включает химерные молекулы “липидированного OspA” и “нелипидированного OspA”. В различных аспектах, липидирование придает OspA свойства адъюванта. В некоторых аспектах изобретения, липидированные молекулы OspA содержат лидерную последовательность OspB. В некоторых аспектах изобретения, лидерная последовательность OspB содержит аминокислоты MRLLIGFALALALIG (SEQ ID NO: 13). В других аспектах, лидерная последовательность OspB содержит другие аминокислоты.

Термины “идентичный” или процент “идентичности”, как известно специалистам в данной области техники, относятся к соотношению между последовательностями двух или более полипептидных молекул или двух или более молекул нуклеиновой кислоты, определенному путем сравнения последовательностей. В данной области техники, “идентичность” также обозначает степень родства последовательности между молекулами нуклеиновой кислоты или полипептидами, в зависимости от обстоятельств, определяемую путем попарного сравнения цепей двух или больше нуклеотидов или двух или более аминокислотных последовательностей. “Идентичность” определяет процент идентичных совпадений между меньшей из двух или более последовательностей с выравниваниями пропусков (если они есть), обрабатываемыми с помощью определенной математической модели или компьютерной программы (т.е. "алгоритмов"). "Существенная идентичность" относится к последовательности с по меньшей мере примерно 70%, примерно 71%, примерно 72%, примерно 73%, примерно 74%, примерно 75%, примерно 76%, примерно 77%, примерно 78%, примерно 79%, примерно 80%, примерно 81%, примерно 82%, примерно 83%, примерно 84%, примерно 85%, примерно 86%, примерно 87%, примерно 88%, примерно 89%, примерно 90%, примерно 91%, примерно 92%, примерно 93%, примерно 94%, примерно 95%, примерно 96%, примерно 97%, примерно 98% или примерно 99% идентичности последовательностей по длине указанной последовательности. В некоторых аспектах, наблюдается идентичность на участке, состоящем из по меньшей мере примерно 50-100 аминокислот или нуклеотидов в длину. В других аспектах, наблюдается идентичность на участке, состоящем из по меньшей мере примерно 100-200 аминокислот или нуклеотидов в длину. В других аспектах, наблюдается идентичность на участке состоящем из по меньшей мере примерно 200-500 аминокислот или нуклеотидов в длину. В определенных аспектах, процент идентичности последовательностей определяется с использованием компьютерной программы, выбранной из группы, состоящей из GAP, BLASTP, BLASTN, FASTA, BLASTA, BLASTX, BestFit и алгоритма Смита-Уотермана.

Следует также определенно понимать, что любое численное значение, указанное тут, включает все значения от наименьшего значения до наибольшего значения, т.е. все возможные комбинации численных значений между наименьшим и наибольшим указанными значениями должны рассматриваться как явным образом указанные в данной заявке. Например, если диапазон концентраций указан как составляющий от примерно 1% до 50%, то следует понимать, что такие значения, как от 2% до 40%, от 10% до 30% или от 1% до 3% и т.д., считаются явным образом приведенными в данном описании изобретения. Перечисленные выше значения являются только примерами конкретного намерения.

Интервалы значений, в различных аспектах, выражены тут как от “примерно” или “приблизительно” одного конкретного значения и/или до “примерно” или “приблизительно” другого конкретного значения. В тех случаях, когда значения выражены приблизительно, с использованием местоимения “примерно”, следует понимать, что такой интервал включает некоторую величину изменчивости.

Термин "подобие" является родственным понятием, но, в отличие от "идентичности", относится к мере подобия, которая включает как идентичные совпадения, так и совпадающие консервативные замещения. Если две полипептидные последовательности содержат, например, 10/20 идентичных аминокислот, и все остальные являются неконсервативными замещениями, то проценты идентичности и подобия оба будут составлять 50%. Если, в этом же примере, еще в пяти положениях находятся консервативные замещения, то процент идентичности остается равным 50%, но процент подобия будет равен 75% (15/20). Таким образом, в тех случаях, где присутствуют консервативные замещения, степень процента подобия между двумя полипептидами будет выше, чем процент идентичности между этими двумя полипептидами.

Термин "изолированная молекула нуклеиновой кислоты" относится к молекуле нуклеиновой кислоты по изобретению, которая (1) была отделена в любой степени от белков, липидов, углеводов или других материалов, с которыми она в естественных условиях объединена при выделении цельной ДНК из клеток-источников, (2) не связана со всем или частью полинуклеотида, с которым "изолированная молекула нуклеиновой кислоты" связана в природе, (3) является функционально связанной с полинуклеотидом, с которым она не связана в природе, или (4) не встречается в природе как часть большей по размеру полинуклеотидной последовательности. По существу не содержащий, в используемом тут значении, указывает, что молекула нуклеиновой кислоты не содержит каких-либо других загрязняющих молекул нуклеиновой кислоты (кислот) или других загрязнений, присутствующих в его природном окружении, которые мешали бы его использованию при продуцировании полипептида или его терапевтическому, диагностическому, профилактическому или исследовательскому использованию.

Термин "изолированный полипептид" относится к полипептиду по настоящему изобретению, который (1) был отделен в любой степени от полинуклеотидов, липидов, углеводов или других материалов, с которыми он в естественных условиях объединен при выделении из клетки-источника, (2) не связан (ковалентными или нековалентными взаимодействиями) со всем или частью полипептида, с которым "изолированный полипептид" связан в природе, (3) является функционально связанным (ковалентными или нековалентными взаимодействиями) с полипептидом, с которым он не связан в природе, или (4) не встречается в природе. В одном аспекте, изолированный полипептид по существу не содержит каких-либо других загрязняющих полипептидов или других загрязнений, присутствующих в его природном окружении, которые мешали бы его терапевтическому, диагностическому, профилактическому или исследовательскому использованию.

В используемом тут значении “фрагмент” полипептида относится к любой части полипептида, меньшей полноразмерного полипептидного или белкового продукта экспрессии. Фрагменты типично являются имеющими делеции аналогами полноразмерного полипептида, в которых удалены один или более аминокислотных остатков с амино-конца и/или карбокси-конца полноразмерного полипептида. Соответственно, “фрагменты” представляют собой подмножество делеционных аналогов, описанных ниже.

В используемом тут значении, “аналог” относится к полипептиду по существу сходной структуры и обладающему такой же биологической активностью, хотя, в определенных случаях и в разной степени, к встречающейся в природных условиях молекуле. Аналоги отличаются по составу их аминокислотных последовательностей от встречающегося в природных условиях полипептида, из которого был получен аналог с помощью одной или более мутаций, включая (i) делецию одного или более аминокислотных остатков на одном или более концов полипептида (включающего описанные выше фрагменты) и/или одного или более внутренних участков встречающейся в природных условиях полипептидной последовательности, (ii) инсерцию или прибавление одной или более аминокислот на одном или более концов (типично, аналог “прибавления”) полипептида и/или в одном или более внутренних участках (типично аналог “инсерции”) встречающейся в природных условиях полипептидной последовательности, или (iii) замещение одной или более аминокислот на другие аминокислоты во встречающейся в природных условиях полипептидной последовательности. Замещения считаются консервативными или неконсервативными на основании физико-химического или функционального родства заменяемой аминокислоты и замещающей ее аминокислоты.

“Консервативно модифицированные аналоги” относится как к аминокислотным, так и к нуклеиново-кислотным последовательностям. Что касается конкретных последовательностей нуклеиновой кислоты, консервативно модифицированные нуклеиновые кислоты относятся к нуклеиновым кислотам, которые кодируют идентичные или по существу идентичные аминокислотные последовательности, или, в случае нуклеиновых кислот, не кодирующих аминокислотную последовательность, к по существу идентичным последовательностям. Вследствие вырожденности генетического кода, большое число функционально идентичных нуклеиновых кислот кодирует любой определенный белок. Например, кодоны GCA, GCC, GCG и GCU все кодируют аминокислоту аланин. Таким образом, в каждом положении, для которого кодон соответствует аланину, этот кодон может быть заменен на любой из соответствующих описанных кодонов без изменения кодируемого полипептида. Такие варианты нуклеиновой кислоты представляют собой “молчащие варианты”, являющиеся одной из разновидностей консервативно модифицированных аналогов. Каждая последовательность нуклеиновой кислоты по настоящему изобретению, кодирующая полипептид, также описывает все возможные молчащие варианты нуклеиновой кислоты. Специалисту будет понятно, что каждый кодон нуклеиновой кислоты (кроме AUG, который обычно является единственным кодоном, соответствующим метионину, и TGG, который обычно является единственным кодоном триптофана) может быть модифицирован с образованием функционально идентичной молекулы. Соответственно, каждый молчащий вариант нуклеиновой кислоты, кодирующей полипептид, неявным образом включен в каждую описанную последовательность.

Что касается аминокислотных последовательностей, специалисту будет понятно, что индивидуальные замещения, инсерции, делеции, аддиции или усечения нуклеиново-кислотной, пептидной, полипептидной или белковой последовательности, которые изменяют, прибавляют или удаляют отдельную аминокислоту или небольшой процент аминокислот кодированной последовательности, представляют собой “консервативно модифицированный аналог”, в котором изменение приводит к замещению аминокислоты на химически подобную аминокислоту. Таблицы консервативных замещений, обеспечивающих введение функционально подобных аминокислот, хорошо известны специалистам. Такие консервативно модифицированные варианты рассматриваются в дополнение к и не исключают полиморфные варианты, межвидовые гомологи и аллели по изобретению.

Каждая из следующих восьми групп содержит аминокислоты, являющиеся консервативными замещениями друг друга:

1) Аланин (A), Глицин (G);

2) Аспарагиновая кислота (D), Глутаминовая кислота (E);

3) Аспарагин (N), Глутамин (Q);

4) Аргинин (R), Лизин (K);

5) Изолейцин (I), Лейцин (L), Метионин (M), Валин (V);

6) Фенилаланин (F), Тирозин (Y), Триптофан (W);

7) Серин (S), Треонин (T); и

8) Цистеин (C), Метионин (M) (см., напр., Creighton, Proteins (1984)).

В используемом тут значении “вариант” относится к полипептиду, белку или его аналогу, который содержит по меньшей мере одно аминокислотное замещение, делецию, инсерцию или модификацию, при условии, что вариант сохраняет биологическую активность нативного полипептида.

В используемом тут значении, “аллельный вариант” относится к любым двум или более полиморфным формам гена, занимающим один и тот же генетический локус. Аллельные варианты возникают естественным путем вследствие мутаций и, в некоторых аспектах, приводят к фенотипическому полиморфизму в популяциях. В определенных аспектах, генные мутации являются молчащими (без изменений в кодируемом полипептиде) или, в других аспектах, кодируют полипептиды, имеющие измененные аминокислотные последовательности. “Аллельные варианты” также относится к кДНК, полученной из транскриптов мРНК генетических аллельных вариантов, а также кодируемым ими белкам.

Термин “производный” относится к полипептидам, ковалентно модифицированным путем конъюгации с терапевтическими или диагностическими агентами, мечения (напр., радионуклидами или различными ферментами), ковалентного присоединения полимера, такого как пегилирование (дериватизация полиэтиленгликолем) и инсерции или замещения способами химического синтеза неприродных аминокислот. В некоторых аспектах, производные модифицируют таким образом, чтобы они содержали дополнительные химические фрагменты, нормально не входящие в состав молекулы. Такие фрагменты, в различных аспектах, модулируют растворимость молекулы, абсорбцию и/или биологический период полувыведения. Фрагменты, в различных других аспектах, альтернативно снижают токсичность молекулы и устраняют или ослабляют любые нежелательные побочные эффекты молекулы и т.д. Фрагменты, способные медиировать такие эффекты, раскрыты в Remington's Pharmaceutical Sciences (1980). Процедуры присоединения таких фрагментов к молекуле хорошо известны специалистам. Например, в некоторых аспектах, производное OspA представляет собой молекулу OspA, имеющую химическую модификацию, придающую белку более длительный период полувыведения in vivo. В одном варианте воплощения, полипептиды модифицируют путем прибавления водорастворимого полимера, известного специалистам. В родственном варианте воплощения, полипептиды модифицируют путем гликозилирования, пегилирования и/или полисиалилирования.

Термин “рекомбинантный”, при использовании по отношению к, напр., клетке или нуклеиновой кислоте, белку или вектору, указывает, что клетка, нуклеиновая кислота, белок или вектор, были модифицированы путем введения гетерологичной нуклеиновой кислоты или белка или изменения нативной нуклеиновой кислоты или белка, или что клетка является потомком модифицированной таким образом клетки. Таким образом, например, рекомбинантные клетки экспрессируют гены, не присутствующие в нативной (не-рекомбинантной) форме клетки, или экспрессируют нативные гены, которые иначе аномально экспрессируются, экспрессируются на низком уровне или совершенно не экспрессируются.

В используемом тут значении “селектируемый маркер” относится к гену, кодирующему фермент или другой белок, который придает клетке или организму, в которых он экспрессируется, идентифицируемое фенотипическое изменение, такое как резистентность к лекарственному средству, антибиотику или другому агенту, так чтобы экспрессия или активность маркера селектировались по наличию признака (например, но без ограничений, позитивный маркер, такой как ген neo) или его отсутствию (например и без ограничений, негативный маркер, такой как ген дифтерии). “Гетерологичный селектируемый маркер” относится к гену селектируемого маркера, который был введен в геном животного, у которого он в естественных условиях отсутствует.

Примеры селектируемых маркеров включают, без ограничений, ген резистентности к антибиотику, такому как неомицин (neo), пуромицин (Puro), дифтерийный токсин, фосфотрансферазу, гигромицин фосфотрансферазу, ксантингуанин-фосфорибозилтрансферазу, тимидинкиназу вируса простого герпеса типа 1, аденин-фосфорибозилтрансферазу и гипоксантин-фосфорибозилтрансферазу. Рядовому специалисту в данной области техники будет понятно, что любой селектируемый маркер, известный специалистам, является пригодным для использования в способах, описанных тут.

Термин “гетерологичный”, при использовании по отношению к частям нуклеиновой кислоты, указывает, что нуклеиновая кислота содержит две или более субпоследовательностей, которые не встречаются в природе в такой же взаимосвязи друг с другом. Например, типично рекомбинантно продуцируют нуклеиновую кислоту, содержащую две или более последовательностей из неродственных генов, расположенных таким образом, чтобы получить новую функциональную нуклеиновую кислоту, напр., промотор из одного источника и кодирующую область из другого источника. Аналогично, гетерологичный белок указывает, что белок содержит две или более субпоследовательностей, которые не встречаются в природе в такой же взаимосвязи друг с другом (напр., слитый белок).

В используемом тут значении, термин “гомологичный” относится к взаимосвязи между белками, имеющими “общее эволюционное происхождение”, включая белки из надсемейств (напр., надсемейство иммуноглобулинов) и гомологичные белки от разных биологических видов (напр., легкая цепь миозина и т.д.) (Reeck et al., Cell 50:667, 1987). Такие белки (и кодирующие их гены) обладают гомологией последовательностей, проявляющейся в подобии их последовательностей, по показателю процента подобия или в присутствии определенных остатков или мотивов в консервативных положениях.

Оптимальное выравнивание последовательностей для сравнения проводится, например и без ограничений, по алгоритму местной гомологии Smith et al., Adv. Appl. Math. 2:482, 1981; по алгоритму выравнивания областей гомологии Needleman et al., J. Mol. Biol. 48:443, 1970; по способу поиска подобия Pearson et al., Proc. Natl. Acad. Sci. USA 85:2444, 1988; способами компьютерной реализации этих алгоритмов (GAP, BESTFIT, FASTA и TFASTA в пакете программного обеспечения Wisconsin Genetics, Genetics Computer Group, 575 Science Dr., Madison, WI), или путем визуального сравнения (см. в общем Ausubel et al., supra). Другим примером алгоритма, пригодного для определения процента идентичности последовательностей и подобия последовательностей, является алгоритм BLAST, описанный Altschul et al., J. Mol. Biol. 215:403-410, 1990. Программное обеспечение для проведения анализов BLAST является общедоступным и распространяется Национальным центром биотехнологической информации (National Center for Biotechnology Information). В дополнение к расчету процента идентичности последовательностей, алгоритм BLAST также выполняет статистический анализ подобия между двумя последовательностями (см., напр., Karlin et al., Proc. Natl. Acad. Sci. USA 90:5873-5787, 1993).

Термин “вектор” используется по отношению к любой молекуле (напр., нуклеиновой кислоте, плазмиде или вирусу), используемой для переноса кодирующей информации в клетку-хозяина.

“Клонирующий вектор” представляет собой маленький кусочек ДНК, в который может быть вставлен фрагмент чужеродной ДНК. Инсерция фрагмента в клонирующий вектор осуществляется путем обработки носителя и чужеродной ДНК одним и тем же рестрикционным ферментом, а затем лигированием фрагментов друг с другом. Существует большое количество типов клонирующих векторов, и все типы клонирующих векторов используются в изобретении. Генно-инженерные плазмиды и бактериофаги (такие как фаг λ), возможно, чаще всего используются для этих целей. Другие типы клонирующих векторов включают бактериальные искусственные хромосомы (BAC) и искусственные хромосомы дрожжей (YAC).

“Экспрессионный вектор” представляет собой конструкт нуклеиновой кислоты, полученный рекомбинантно или способами синтеза, с рядом определенных элементов нуклеиновой кислоты, обеспечивающих транскрипцию конкретной нуклеиновой кислоты в клетке-хозяине. Экспрессионный вектор может быть частью плазмиды, вируса или фрагмента нуклеиновой кислоты. В определенных аспектах, экспрессионный вектор включает функционально связанную с промотором нуклеиновую кислоту, которая должна транскрибироваться.

Термин “кодирующая последовательность” определяется тут как последовательность нуклеиновой кислоты, которая транскрибируется в мРНК, которая транслируется в полипептид при помещении под контроль соответствующих контрольных последовательностей. Границы кодирующей последовательности в общем определяются старт-кодоном ATG, который обычно является началом открытой рамки считывания на 5′-конце мРНК, и последовательностью терминации транскрипции, расположенной непосредственно за открытой рамкой считывания на 3′-конце мРНК. Кодирующая последовательность может включать, без ограничений, геномную ДНК, кДНК, полусинтетические, синтетические и рекомбинантные последовательности нуклеиновой кислоты. В одном аспекте, промоторная ДНК-последовательность определяется как ДНК-последовательность, расположенная перед ассоциированной с ней кодирующей последовательностью и способная контролировать экспрессию этой кодирующей последовательности.

“Промотор” определяется как совокупность контрольных последовательностей нуклеиновой кислоты, которые направляют транскрипцию нуклеиновой кислоты. В используемом тут значении, промотор включает необходимые последовательности нуклеиновой кислоты вблизи сайта начала транскрипции, такие как, в случае промотора полимеразы II типа, элемент TATA. Промотор также необязательно включает дистальные энхансерные или репрессорные элементы, которые могут быть расположены на расстоянии до нескольких тысяч пар оснований от сайта начала транскрипции. “Конститутивный” промотор представляет собой промотор, активный при большинстве условий окружающей среды и развития. “Индуцируемый” промотор представляет собой промотор, активный при регуляции условий окружающей среды или эволюционной регуляции.

Термин “функционально связанный” относится к функциональной связи между контрольными последовательностями экспрессии нуклеиновой кислоты (такими как промотор или совокупность сайтов связывания фактора транскрипции) и второй последовательностью нуклеиновой кислоты, где контрольная последовательность экспрессии направляет транскрипцию нуклеиновой кислоты, соответствующей второй последовательности.

Термин "трансдукция" используется для обозначения переноса нуклеиновых кислот от одной бактерии к другой, обычно, с помощью фага. "Трансдукция" также относится к поглощению и переносу эукариотических клеточных последовательностей ретровирусами.

Термин "трансфекция" используется для обозначения поглощения чужеродной или экзогенной ДНК клеткой, и клетка "трансфицирована", если экзогенная ДНК была введена внутрь клеточной мембраны. Ряд способов трансфекции хорошо известен специалистам и раскрыт в данном описании. См., например, Graham et al., Virology, 52:456 (1973); Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratories, New York, (1989); Davis et al., Basic Methods in Molecular Biology, Elsevier, (1986); и Chu et al., Gene, 13:197 (1981). Такие методики могут быть использованы для введения одного или более фрагментов экзогенной ДНК в пригодные клетки-хозяева.

Термин "трансформация", в используемом тут значении, относится к изменению генетических характеристик клетки и клетка считается трансформированной, если она была модифицирована путем введения в нее новой ДНК. Например, клетка является трансформированной, если она была генетически модифицирована по сравнению с ее нативным состоянием. После трансфекции или трансдукции, трансформирующая ДНК может рекомбинироваться с ДНК клетки путем физической интеграции в хромосому клетки. В некоторых случаях, ДНК временно поддерживается как эписомальный элемент без репликации или независимо реплицируется в виде плазмиды. Клетка считается стабильно трансформированной, если ДНК реплицируется при делении клетки.

Термин “эндогенный” относится к полипептиду или полинуклеотиду или другому соединению, которое экспрессируется в естественных условиях в организме-хозяине или возникает в клетке, ткани или организме. “Экзогенный” относится к полипептиду, полинуклеотиду или другому соединению, которое возникает вне клетки, ткани или организма.

Термин "агент" или "соединение" описывает любую молекулу, напр. белковую или фармацевтическую, обладающую способностью влиять на биологический параметр по изобретению.

"Контроль", в используемом тут значении, может обозначать активный, позитивный, негативный контроль или контрольный эксперимент с растворителем. Квалифицированным специалистам в данной области техники будет понятно, что контроли используются для установления релевантности экспериментальных результатов и обеспечения сравнения для исследуемого состояния.

Термин "уменьшает тяжесть", по отношению к симптому лайм-боррелиоза или лаймской болезни, означает, что симптом имеет задержку проявления, пониженную тяжесть или причиняет субъекту меньший вред. В общем, тяжесть симптома сравнивают с контролем, напр., не получающим активной профилактической или терапевтической композиции. В этом случае можно сказать, что композиция снижает тяжесть симптома лайм-боррелиоза, если симптом уменьшается на 10%, 25%, 30%, 50%, 80% или 100% (т.е. по существу исчезает), по сравнению с контрольным уровнем симптома.

Термин “антиген” относится к молекуле или части молекулы, способным связываться селективным связывающим агентом, таким как антитело, и дополнительно пригодным для использования у субъекта для продуцирования антител, способных связываться с эпитопом каждого антигена. Антиген, в различных аспектах, имеет один или более эпитопов.

Термин "антитело" относится к молекуле или молекулам, обладающим специфичностью к полипептиду OspA. В используемом тут значении, термины "специфический”, "специфичность" и “специфически связывается с” относятся к способности антитела связываться с полипептидами OspA и не связываться с не-OspA полипептидами. В определенных аспектах, антитело является “нейтрализующим антителом”, если антитело реагирует с инфекционным агентом и разрушает или ингибирует его инфекционность или вирулентность. Изобретение включает иммуногенные композиции, содержащие антитела, которые “нейтрализуют” Borrelia.

Термины "фармацевтически приемлемый носитель" или "физиологически приемлемый носитель", в используемом тут значении, относятся к одному или более материалов композиции, пригодных для обеспечения или увеличения доставки полипептида OspA, молекулы нуклеиновой кислоты OspA или антитела OspA в фармацевтической композиции.

Термин “стабилизатор” относится к веществу или эксципиенту вакцины, который защищает иммуногенную композицию вакцины от неблагоприятных условий, таких как условия, возникающие при нагреве или замораживании, и/или пролонгирует стабильность или срок годности при хранении иммуногенной композиции в стабильном и иммуногенном состоянии или статусе. Примеры стабилизаторов включают, без ограничений, сахара, такие как сахароза, лактоза и манноза; сахароспирты, такие как маннит; аминокислоты, такие как глицин или глутаминовая кислота; и белки, такие как человеческий сывороточный альбумин или желатин.

Термин “антимикробный консервант” относится к любому веществу, прибавляемому к иммуногенной композиции или вакцине, ингибирующей рост микроорганизмов, которая может быть введена путем многоразового отбора доз из мультидозных флаконов, в случае использования таких контейнеров. Примеры антимикробных консервантов включают, без ограничений, такие вещества, как тимеросал, 2-феноксиэтанол, бензетония хлорид и фенол.

Термин “иммуногенная композиция” относится к композиции, содержащей антиген (напр., химерные молекулы OspA), к которому вырабатываются антиген-специфические антитела, адъювант, стимулирующий иммунный ответ субъекта-хозяина, и пригодный иммунологически инертный, фармацевтически приемлемый носитель. Необязательно, иммуногенная композиция содержит один или несколько стабилизаторов. Необязательно, иммуногенная композиция содержит один или несколько антимикробных консервантов.

Термины “вакцина” или “композиция вакцины” относятся к биологическому препарату, который повышает иммунитет к определенной болезни (напр., лаймской болезни или инфекции Borrelia). Вакцина типично содержит агент, напоминающий микроорганизм, вызывающий болезнь (напр., химерные молекулы OspA (антиген) Borrelia). Агент стимулирует иммунную систему организма распознавать агент как чужеродный, уничтожать его и "запоминать" его, так чтобы иммунная система могла легче распознавать и уничтожать любые такие микроорганизмы, с которыми она позднее столкнется. Вакцины, в различных аспектах, являются профилактическими (предотвращают или ослабляют эффекты будущей инфекции любым природным или "диким" патогеном) или терапевтическими (вакцины против присутствующей инфекции). Как было указано выше, такие композиции вакцины включают рецептуры композиций, содержащие фармацевтически приемлемые носители. Необязательно, вакцина также содержит один или более стабилизаторов и/или один или более антимикробных консервантов.

Каждый из терминов “эффективное количество" и “терапевтически эффективное количество” относится к используемому количеству молекул нуклеиновой кислоты, полипептида, композиции или антитела для поддержания наблюдаемого уровня одной или более биологических активностей полипептидов OspA, как описано тут. Например, эффективное количество, в некоторых аспектах изобретения, будет количеством, необходимым для предотвращения, нейтрализации или ослабления инфекции Borrelia.

Термин “комбинация” относится к двум или более молекулам нуклеиновой кислоты по изобретению или двум или более полипептидам по изобретению. В некоторых аспектах, комбинации молекул по изобретению вводятся для обеспечения иммунитета или борьбы с инфекцией по меньшей мере четырьмя из шести серотипов (1-6) Borrelia, описанных тут. В различных аспектах, используются комбинации двух или трех молекул или полипептидов по изобретению. В определенных аспектах, комбинации молекул по изобретению вводятся субъекту для обеспечения иммунитета от всех шести серотипов (1-6) Borrelia, описанных тут. Было показано, что последняя комбинация обеспечивает иммунитет к гетерологичным штаммам Borrelia, экспрессирующим типы OspA, не присутствующие в комбинации молекул нуклеиновой кислоты или полипептидов.

Термин “комбинированная вакцина” относится к рецептуре композиции вакцины, содержащей более одной композиции вакцины или более одного защитного антигена против одной или более болезней. Изобретение включает комбинированную вакцину, содержащую химерные антигены OspA против лаймской болезни или Borrelia в дополнение к антигену против одной или нескольких других болезней. В различных аспектах, одна или несколько других болезней представляет собой переносимую клещами болезнь. В определенных аспектах, другой переносимой клещами болезнью является пятнистая лихорадка Скалистых гор, бабезиоз, возвратная лихорадка, колорадская клещевая лихорадка, моноцитарный эрлихиоз человека (HME), гранулоцитарный эрлихиоз человека (HGE), клещевая сыпная лихорадка STARI, туляремия, клещевой паралич, энцефалит Повассан, ку-лихорадка, конго-крымская геморрагическая лихорадка, цитауксзооноз, марсельская лихорадка или клещевой энцефалит. В конкретных аспектах, изобретение включает комбинированную вакцину, которая содержит одну или более вакцин, включая вакцину клещевого энцефалита, вакцину японского энцефалита и вакцину пятнистой лихорадки Скалистых гор. В некоторых аспектах, комбинированная вакцина содержит композиции вакцин, имеющих сезонный график иммунизации, совместимый с иммунизацией инфекции Borrelia или лаймской болезни. В более конкретных аспектах, комбинированные вакцины пригодны для использования при профилактике множества болезней в географических регионах, где распространены такие болезни.

Термин “Borrelia” относится к видам грамотрицательных бактерий рода Borrelia класса спирохет. В одном аспекте, “Borrelia burgdorferi sensu lato (s.l.)” относится к Borrelia burgdorferi в широком понимании. Почти все случаи лаймской болезни или боррелиоза вызываются одним из трех геновидов - Borrelia afzelii, Borrelia garinii и Borrelia burgdorferi sensu stricto (s.s.), который относится к B. burgdorferi в более строгом понимании). Серотипы OspA Borrelia коррелируют с видами; серотип 1 соответствует B. burgdorferi s.s., серотип 2 соответствует B. afzelii и серотипы 3-7 соответствуют B. garinii. В различных аспектах, иммуногенные композиции или композиции вакцин по изобретению также обеспечивают защиту против других видов Borrelia, включая, без ограничений, Borrelia japonica, Borrelia andersonii, Borrelia bissettii, Borrelia sinica, Borrelia turdi, Borrelia tanukii, Borrelia valaisiana, Borrelia lusitaniae, Borrelia spielmanii, Borrelia miyamotoi или Borrelia lonestar.

“Субъект” рассматривается в его общепринятом значении не-растительного, не-простейшего живого существа. В большинстве аспектов, субъект является животным. В конкретных аспектах, животное является млекопитающим. В более конкретных аспектах, млекопитающее является человеком. В других аспектах, млекопитающее представляет собой комнатное животное или животное-компаньона, одомашненное сельскохозяйственное животное или животное в зоопарке. В определенных аспектах, млекопитающее представляет собой кошку, собаку, лошадь или корову. В различных других аспектах, млекопитающее представляет собой оленя, мышь, бурундука, белку, опоссума или енота.

Лаймская болезнь (боррелиоз или лайм-боррелиоз)

В некоторых аспектах, изобретение включает химерные молекулы OspA и композиции, содержащие такие молекулы, для использования при профилактике лаймской болезни или инфекции Borrelia. Лаймская болезнь также известна специалистам как боррелиоз или лайм-боррелиоз, и поэтому все эти термины включены в изобретение. Аналогично, изобретение включает способы профилактики или лечения лаймской болезни, включающие введение химерных молекул OspA, описанных тут. Лаймская болезнь, или боррелиоз, представляет собой инфекционную болезнь, вызываемую по меньшей мере тремя видами грамнегативных спирохетозных бактерий, принадлежащих к роду Borrelia. Было открыто по меньшей мере 13 видов Borrelia, из которых три определенно связаны с лайм-боррелиозом. Виды Borrelia, вызывающие лаймскую болезнь, коллективно известны как Borrelia burgdorferi sensu lato, и демонстрируют значительное генетическое разнообразие. Группа Borrelia burgdorferi sensu lato состоит из трех близкородственных видов, которые, вероятно, отвечают за подавляющее большинство случаев заболевания. Borrelia burgdorferi sensu stricto является основной причиной лаймской болезни в США (но также присутствует в Европе), в то время как Borrelia afzelii и Borrelia garinii вызывают большинство европейских случаев болезни. Некоторые исследования также позволяют предположить, что виды Borrelia (напр., Borrelia bissettii, Borellia spielmanii, Borrellia lusitaniae и Borrelia valaisiana) могут иногда инфицировать людей. Хотя эти виды, по-видимому, не являются важными факторами болезни, иммуногенная защита против этих видов также включена в изобретение.

Лаймская болезнь является наиболее распространенной переносимой клещами болезнью в Северном полушарии. Название болезни происходит от поселка Лайм (Lyme), штат Коннектикут, где в 1975 г. был идентифицирован ряд случаев заболевания. Borrelia передается людям при укусе инфицированных клещей, принадлежащих к нескольким видам рода Ixodes ("твердые клещи"). Ранние симптомы, в некоторых случаях, включают лихорадку, головную боль, утомление, депрессию и характерную круговую кожную сыпь, называемую мигрирующей эритемой. Без лечения, более поздние симптомы часто могут охватывать суставы, сердце и центральную нервную систему. В большинстве случаев инфекция и ее симптомы устраняются антибиотиками, особенно при лечении болезни на ранней стадии. Однако позднее, запаздывающее или недостаточное лечение может привести к более серьезным симптомам, которые могут приводить к потере трудоспособности и затруднению лечения. В некоторых случаях, симптомы, такие как артрит, сохраняются после устранения инфекции антибиотиками.

Некоторые группы исследователей утверждали, что "хроническая" лаймская болезнь является ответственной за ряд медицински необъяснимых симптомов, помимо общепризнанных симптомов поздней стадии лаймской болезни, и что требуется дополнительное длительное лечение антибиотиками. Однако длительное лечение является спорным и конфликт, связанный с таким лечением, привел к судебному иску по поводу рекомендаций по лечению.

Лаймская болезнь классифицируется как зооноз, поскольку она передается человеку из естественного резервуара, включающего грызунов и птиц, клещами, которые кормятся на обоих группах хозяев. Твердые клещи рода Ixodes являются основными переносчиками лаймской болезни. Большинство случаев инфекции человека вызываются клещами на нимфальной стадии, потому что нимфальные клещи имеют очень маленькие размеры и могут питаться в течение длительных периодов времени незамеченными. Укусы клещей часто остаются незамеченными из-за малых размеров клеща на нимфальной стадии, а также секрета клеща, который предотвращает у хозяина ощущения зуда или боли от укуса.

Лаймская болезнь клинически диагностируется по симптомам, объективным физикальным показателям (таким как мигрирующая эритема, поражение лицевого нерва или артрит), истории возможного контакта с инфицированными клещами, а также серологическим анализам крови. Приблизительно у половины пациентов с лаймской болезнью будет развиваться характерная концентрическая сыпь, но многие не могут вспомнить укуса клеща. Лабораторные анализы не рекомендуются для особ, не имеющих симптомов лаймской болезни.

Из-за сложности культивации бактерий Borrelia в лаборатории, диагноз лаймской болезни типично основан на результатах клинического исследования и истории посещения эндемических областей лайм-боррелиоза. Мигрирующая эритемная (EM) сыпь, которая может наблюдаться только у примерно 50% случаев, считается достаточной для установления диагноза лаймской болезни, даже если серологические анализы крови являются негативными. Серологические анализы могут быть использованы для подтверждения клинически подозрительных случаев, но сами по себе не являются диагностическими. Диагноз поздней стадии лаймской болезни часто трудно установить из-за многоаспектных проявлений, которые могут походить на симптомы многих других болезней. По этой причине, автор одного из обзоров назвал лайм-боррелиоз новым "великим имитатором". Лаймская болезнь, в некоторых случаях, ошибочно диагностируется как множественный склероз, ревматоидный артрит, фибромиалгия, синдром хронической усталости (CFS), волчанка или другие аутоиммунные и нейродегенеративные болезни. Таким образом, у специалистов существует большая потребность в вакцине для предотвращения или лечения лаймской болезни.

Внешний поверхностный белок A (OspA) Borrelia

В различных аспектах, изобретение включает химерные молекулы OspA Borrelia и композиции, содержащие такие молекулы, для использования в профилактике и лечении лаймской болезни или инфекции Borrelia. За последнее десятилетие было идентифицировано несколько внешних поверхностных белков Borrelia, подверженных повышающей регуляции под действием температурных и/или специфических для млекопитающего-хозяина сигналов при переносе такой спирохеты от клещей к млекопитающим.

Основной внешний поверхностный белок, OspA, Borrelia burgdorferi является липопротеином, представляющим особый интерес вследствие его потенциальной пригодности для использования в качестве вакцины-кандидата. Серотипический и генетический анализ OspA как европейских, так и североамериканских штаммов Borrelia продемонстрировали антигенные и структурные гетерогенные признаки. OspA описан в опубликованной патентной заявке PCT WO 92/14488, в работе Jiang et al. (Clin. Diagn. Lab. Immunol. 1: 406-12, 1994) и известен специалистам. Было показано, что OspA индуцирует защитный иммунитет в экспериментах с провокационной пробой у мышей, хомяков и собак. Клинические испытания на людях показали, что композиции OspA являются безопасными и иммуногенными для людей (Keller et al., JAMA (1994) 271:1764 1768).

Хотя OspA экспрессируется в подавляющем большинстве клинических изолятов Borrelia burgdorferi из Северной Америки, другая картина наблюдается при исследованиях клинических изолятов Borrelia в Европе. В Европе, лаймская болезнь вызывается преимущественно тремя геновидами Borrelia, а именно B. burgdorferi, B. garinii и B. afzelii. Изобретение касается химерных молекул OspA, обеспечивающих защитный иммунитет против всех геновидов Borrelia. Изобретение описывает конструирование и синтез трех химерных генов OspA, которые кодируют три разных липидированных молекулы OspA, обладающих общими признаками. Каждый ген представляет два серотипа OspA, и гены были сконструированы ак, чтобы они кодировали стабильные молекулы OspA, являющиеся безопасными и высокоиммуногенными, и обеспечивающие защиту субъекта против инфекции B. burgdorferi sensu lato (s.l.). Изобретение также описывает три исходные химерные гена OspA без мутаций и без оптимизации кодонов, которые кодируют три разных липидированных молекулы OspA, обладающих общими признаками. Каждый ген представляет два серотипа OspA и кодирует молекулы, обеспечивающие защиту субъекта против инфекции B. burgdorferi sensu lato (s.l.).

В европейских изолятах было найдено семь основных серотипов OspA (обозначенных серотипы 1-7, Wilske et al., J. Clin. Microbiol. 31:340-50, 1993). Серотипы OspA коррелируют с видами; серотип 1 соответствует B. burgdorferi s.s., серотип 2 соответствует B. afzelii, и серотипы 3-7 соответствуют B. garinii. Эпидемиологические исследования европейских изолятов Borrelia показывают, что вакцина на основе OspA типов 1, 2, 3, 4, 5 и 6 будет обеспечивать теоретическое покрытие в Европе 98,1% случаев лаймской болезни и охватывают 96,7% изолятов инвазивных заболеваний. Изобретение предусматривает шесть химерных молекул нуклеиновой кислоты OspA (SEQ ID NOS: 1, 3 и 5 и SEQ ID NOS: 168, 170 и 172) и шесть химерных полипептидных молекул OspA (SEQ ID NOS: 2, 4 и 6 и SEQ ID NOS: 169, 171 и 173), которые могут обеспечить защитный иммунитет против всех шести серотипов 1-6. Были сконструированы шесть синтетических генов OspA, кодирующих молекулы OspA с защитными эпитопами OspA серотипов 1 и 2 (lipB sOspA 1/2251 (SEQ ID NOS: 1 (нуклеиновая кислота) и 2 (аминокислота) и orig sOspA 1/2 (SEQ ID NOS: 168 (нуклеиновая кислота) и 169 (аминокислота)); OspA серотипов 6 и 4 (lipB sOspA 6/4 (SEQ ID NOS: 3 (нуклеиновая кислота) и 4 (аминокислота) и orig sOspA 6/4 (SEQ ID NOS: 170 (нуклеиновая кислота) и 171 (аминокислота)); и OspA серотипов 5 и 3 (lipB sOspA 5/3 (SEQ ID NOS: 5 (нуклеиновая кислота) и 6 (аминокислота) и orig sOspA 5/3 (SEQ ID NOS: 172 (нуклеиновая кислота) и 173 (аминокислота)). Химерные гены OspA были получены с использованием синтетических перекрывающихся олигонуклеотидов. Такие рекомбинантные белки, в определенных аспектах, продуцируются с высоким выходом и чистотой и, в различных аспектах, подвергаются манипуляциям для максимизации желательных активностей и минимизации нежелательных.

Химерные молекулы нуклеиновой кислоты и полипептидные молекулы OspA

В различных аспектах, изобретение включает химерные молекулы нуклеиновой кислоты OspA и полипептидов Borrelia. Нуклеиновые кислоты OspA по изобретению включают молекулу нуклеиновой кислоты, содержащую, состоящую по существу из или состоящую из нуклеотидной последовательности, приведенной в SEQ ID NO: 1 (lipB sOspA 1/2251), SEQ ID NO: 3 (lipB sOspA 6/4), SEQ ID NO: 5 (lipB sOspA 5/3), SEQ ID NO: 7 (sOspA 1/2251), SEQ ID NO: 9 (sOspA 6/4), SEQ ID NO: 11 (sOspA 5/3), SEQ ID NO: 168 (orig sOspA 1/2), SEQ ID NO: 170 (orig sOspA 6/4) или SEQ ID NO: 172 (orig sOspA 5/3), или нуклеотидной последовательности, кодирующей полипептид, приведенной в SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3).

Последовательности нуклеиновой кислоты SEQ ID NOS: 7, 9 и 11 не содержат последовательности нуклеиновой кислоты, кодирующей лидерной последовательности lipB (MRLLIGFALALALIG (SEQ ID NO: 13). Кроме того, последовательности нуклеиновой кислоты SEQ ID NOS: 7, 9 и 11 кодируют остаток метионина на амино-конце SEQ ID NOS: 8, 10 и 12 вместо цистеинового остатка, присутствующего на карбокси-конце лидерной последовательности lipB в SEQ ID NOS: 2, 4 и 6. SEQ ID NOS: 1, 3 и 5 представляют собой полинуклеотиды lipB sOspA, а SEQ ID NOS: 2, 4 и 6 - полипептиды lipB sOspA.

В некоторых аспектах, изобретение включает исходные молекулы (“orig”) химерной нуклеиновой кислоты OspA и полипептида Borrelia без мутаций и без оптимизации кодонов. Таким образом, нуклеиновые кислоты OspA по изобретению включают молекулу нуклеиновой кислоты, содержащую, состоящую по существу из или состоящую из нуклеотидной последовательности, приведенной в SEQ ID NO: 168 (orig sOspA 1/2), SEQ ID NO: 170 (orig sOspA 6/4) или SEQ ID NO: 172 (orig sOspA 5/3), или нуклеотидной последовательности, кодирующей полипептид, приведенный в SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3).

Идентификационные номера последовательностей ДНК и аминокислотных последовательностей для химерных молекул OspA приведены в Таблице 1 ниже.

Таблица 1
Химерные ДНК и аминокислотные последовательности OspA
Последовательность ДНК
SEQ ID NO:
Аминокислотная
SEQ ID NO:
Комплементарная нить
SEQ ID NO:
lipB sOspA 1/2251 1 2 48
lipB sOspA 6/4 3 4 49
lipB sOspA 5/3 5 6 50
sOspA 1/2251 7 8 56
sOspA 6/4 9 10 57
sOspA 5/3 11 12 58
Orig sOspA 1/2 168 169
Orig sOspA 6/4 170 171
Orig sOspA 5/3 172 173
lipB sOspA 1/2251
Аминокислотная последовательность (SEQ ID NO: 2)
MRLLIGFALALALIGCAQKGAESIGSVSVDLPGEMKVLVSKEKDKNGKYDLIATVDKLELKGTSDKNNGS
GVLEGVKTNKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITMADGT
RLEYTGIKSDGTGKAKYVLKNFTLEGKVANDKTTLEVKEGTVTLSMNISKSGEVSVELNDTDSSAATKKT
AAWNSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK
ДНК-последовательность (SEQ ID NO: 1)
catatgcgtctgttgatcggctttgctctggcgctggctctgatcggctgcgcacagaaaggtgctgagt
ctattggttccgtttctgtagatctgcccggtgaaatgaaggttctggtgagcaaagaaaaagacaagaa
cggcaagtacgatctcatcgcaaccgtcgacaagctggagctgaaaggtacttctgataaaaacaacggc
tctggtgtgctggagggcgtcaaaactaacaagagcaaagtaaagcttacgatctctgacgatctcggtc
agaccacgctggaagttttcaaagaggatggcaagaccctcgtgtccaaaaaagtaacttccaaagacaa
gtcctctacggaagaaaaattcaacgaaaaaggtgaggtgtctgaaaagatcatcaccatggcagacggc
acccgtcttgaatacaccggtattaaaagcgatggtaccggtaaagcgaaatatgttctgaaaaacttca
ctctggaaggcaaagtggctaatgataaaaccaccttggaagtcaaggaaggcaccgttactctgagcat
gaatatctccaaatctggtgaagtttccgttgaactgaacgacactgacagcagcgctgcgactaaaaaa
actgcagcgtggaattccaaaacttctactttaaccattagcgttaacagcaaaaaaactacccagctgg
tgttcactaaacaagacacgatcactgtgcagaaatacgactccgcaggcaccaacttagaaggcacggc
agtcgaaattaaaacccttgatgaactgaaaaacgcgctgaaataagctgagcggatcc
Комплементарная нить (SEQ ID NO: 48)
catatgcgtctgttgatcggctttgctttggcgctggctttaatcggctgtgcacagaaaggtgctgagt
ctattggttccgtttctgtagatctgcccgggggtatgaaagttctggtaagcaaagaaaaagacaaaaa
cggtaaatacagcctgatggcaaccgtagaaaagctggagcttaaaggcacttctgataaaaacaacggt
tctggcaccctggaaggtgaaaaaactaacaaaagcaaagtaaagcttactattgctgaggatctgagca
aaaccacctttgaaatcttcaaagaagatggcaaaactctggtatctaaaaaagtaaccctgaaagacaa
gtcttctaccgaagaaaaattcaacgaaaagggtgaaatctctgaaaaaactatcgtaatggcaaatggt
acccgtctggaatacaccgacatcaaaagcgataaaaccggcaaagctaaatacgttctgaaagacttta
ctctggaaggcactctggctgctgacggcaaaaccactctgaaagttaccgaaggcactgttactctgag
catgaacatttctaaatccggcgaaatcaccgttgcactggatgacactgactctagcggcaataaaaaa
tccggcacctgggattctgatacttctactttaaccattagcaaaaacagccagaaaactaaacagctgg
tattcaccaaagaaaacactatcaccgtacagaactataaccgtgcaggcaatgcgctggaaggcagccc
ggctgaaattaaagatctggcagagctgaaagccgctttgaaataagctgagcggatcc
lipB sOspA 6/4
Аминокислотная последовательность (SEQ ID NO: 4)
MRLLIGFALALALIGCAQKGAESIGSVSVDLPGGMTVLVSKEKDKNGKYSLEATVDKLELKGTSDKNNGS
GTLEGEKTNKSKVKLTIADDLSQTKFEIFKEDAKTLVSKKVTLKDKSSTEEKFNEKGETSEKTIVMANGT
RLEYTDIKSDGSGKAKYVLKDFTLEGTLAADGKTTLKVTEGTVVLSMNILKSGEITVALDDSDTTQATKK
TGKWDSNTSTLTISVNSKKTKNIVFTKEDTITVQKYDSAGTNLEGNAVEIKTLDELKNALK
ДНК-последовательность (SEQ ID NO: 3)
catatgcgtctgttgatcggctttgctctggcgctggctctgatcggctgcgcacagaaaggtgctgagt
ctattggttccgtttctgtagatctgcccggtggcatgaccgttctggtcagcaaagaaaaagacaaaaa
cggtaaatacagcctcgaggcgaccgtcgacaagcttgagctgaaaggcacctctgataaaaacaacggt
tccggcaccctggaaggtgaaaaaactaacaaaagcaaagtgaaactgaccattgctgatgacctcagcc
agaccaaattcgaaattttcaaagaagatgccaaaaccttagtatccaaaaaagtgaccctgaaagacaa
gtcctctaccgaagaaaaattcaacgaaaagggtgaaacctctgaaaaaaccatcgtaatggcaaatggt
acccgtctggaatacaccgacatcaaaagcgatggctccggcaaagccaaatacgttctgaaagacttca
ccctggaaggcaccctcgctgccgacggcaaaaccaccttgaaagttaccgaaggcactgttgttttaag
catgaacatcttaaaatccggtgaaatcaccgttgcgctggatgactctgacaccactcaggccactaaa
aaaaccggcaaatgggattctaacacttccactctgaccatcagcgtgaattccaaaaaaactaaaaaca
tcgtgttcaccaaagaagacaccatcaccgtccagaaatacgactctgcgggcaccaacctcgaaggcaa
cgcagtcgaaatcaaaaccctggatgaactgaaaaacgctctgaaataagctgagcggatcc
Комплементарная нить (SEQ ID NO: 49)
ggatccgctcagcttatttcagcgcgtttttcagttcatcaagggttttaatttcgactgccgtgccttc
taagttggtgcctgcggagtcgtatttctgcacagtgatcgtgtcttgtttagtgaacaccagctgggta
gtttttttgctgttaacgctaatggttaaagtagaagttttggaattccacgctgcagtttttttagtcg
cagcgctgctgtcagtgtcgttcagttcaacggaaacttcaccagatttggagatattcatgctcagagt
aacggtgccttccttgacttccaaggtggttttatcattagccactttgccttccagagtgaagtttttc
agaacatatttcgctttaccggtaccatcgcttttaataccggtgtattcaagacgggtgccgtctgcca
tggtgatgatcttttcagacacctcacctttttcgttgaatttttcttccgtagaggacttgtctttgga
agttacttttttggacacgagggtcttgccatcctctttgaaaacttccagcgtggtctgaccgagatcg
tcagagatcgtaagctttactttgctcttgttagttttgacgccctccagcacaccagagccgttgtttt
tatcagaagtacctttcagctccagcttgtcgacggttgcgatgagatcgtacttgccgttcttgtcttt
ttctttgctcaccagaaccttcatttcaccgggcagatctacagaaacggaaccaatagactcagcacct
ttctgtgcgcagccgatcagagccagcgccagagcaaagccgatcaacagacgcatatg
lipB sOspA 5/3
Аминокислотная последовательность (SEQ ID NO: 6)
MRLLIGFALALALIGCAQKGAESIGSVSVDLPGGMKVLVSKEKDKNGKYSLMATVEKLELKGTSDKNNGS
GTLEGEKTNKSKVKLTIAEDLSKTTFEIFKEDGKTLVSKKVTLKDKSSTEEKFNEKGEISEKTIVMANGT
RLEYTDIKSDKTGKAKYVLKDFTLEGTLAADGKTTLKVTEGTVTLSMNISKSGEITVALDDTDSSGNKKS
GTWDSDTSTLTISKNSQKTKQLVFTKENTITVQNYNRAGNALEGSPAEIKDLAELKAALK
ДНК-последовательность (SEQ ID NO: 5)
catatgcgtctgttgatcggctttgctttggcgctggctttaatcggctgtgcacagaaaggtgctgagt
ctattggttccgtttctgtagatctgcccgggggtatgaaagttctggtaagcaaagaaaaagacaaaaa
cggtaaatacagcctgatggcaaccgtagaaaagctggagcttaaaggcacttctgataaaaacaacggt
tctggcaccctggaaggtgaaaaaactaacaaaagcaaagtaaagcttactattgctgaggatctgagca
aaaccacctttgaaatcttcaaagaagatggcaaaactctggtatctaaaaaagtaaccctgaaagacaa
gtcttctaccgaagaaaaattcaacgaaaagggtgaaatctctgaaaaaactatcgtaatggcaaatggt
acccgtctggaatacaccgacatcaaaagcgataaaaccggcaaagctaaatacgttctgaaagacttta
ctctggaaggcactctggctgctgacggcaaaaccactctgaaagttaccgaaggcactgttactctgag
catgaacatttctaaatccggcgaaatcaccgttgcactggatgacactgactctagcggcaataaaaaa
tccggcacctgggattctgatacttctactttaaccattagcaaaaacagccagaaaactaaacagctgg
tattcaccaaagaaaacactatcaccgtacagaactataaccgtgcaggcaatgcgctggaaggcagccc
ggctgaaattaaagatctggcagagctgaaagccgctttgaaataagctgagcggatcc
Комплементарная нить (SEQ ID NO: 50)
ggatccgctcagcttatttcagagcgtttttcagttcatccagggttttgatttcgactgcgttgccttc
gaggttggtgcccgcagagtcgtatttctggacggtgatggtgtcttctttggtgaacacgatgttttta
gtttttttggaattcacgctgatggtcagagtggaagtgttagaatcccatttgccggtttttttagtgg
cctgagtggtgtcagagtcatccagcgcaacggtgatttcaccggattttaagatgttcatgcttaaaac
aacagtgccttcggtaactttcaaggtggttttgccgtcggcagcgagggtgccttccagggtgaagtct
ttcagaacgtatttggctttgccggagccatcgcttttgatgtcggtgtattccagacgggtaccatttg
ccattacgatggttttttcagaggtttcacccttttcgttgaatttttcttcggtagaggacttgtcttt
cagggtcacttttttggatactaaggttttggcatcttctttgaaaatttcgaatttggtctggctgagg
tcatcagcaatggtcagtttcactttgcttttgttagttttttcaccttccagggtgccggaaccgttgt
ttttatcagaggtgcctttcagctcaagcttgtcgacggtcgcctcgaggctgtatttaccgtttttgtc
tttttctttgctgaccagaacggtcatgccaccgggcagatctacagaaacggaaccaatagactcagca
cctttctgtgcgcagccgatcagagccagcgccagagcaaagccgatcaacagacgcatatg
sOspA 1/2251
Аминокислотная последовательность (SEQ ID NO: 8)
MAQKGAESIGSVSVDLPGEMKVLVSKEKDKNGKYDLIATVDKLELKGTSDKNNGSGVLEGVKTNKSKVKL
TISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITMADGTRLEYTGIKSDGTGKA
KYVLKNFTLEGKVANDKTTLEVKEGTVTLSMNISKSGEVSVELNDTDSSAATKKTAAWNSKTSTLTISVN
SKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK
ДНК-последовательность (SEQ ID NO: 7)
catatggcacagaaaggtgctgagtctattggttccgtttctgtagatctgcccggtgaaatgaaggttc
tggtgagcaaagaaaaagacaagaacggcaagtacgatctcatcgcaaccgtcgacaagctggagctgaa
aggtacttctgataaaaacaacggctctggtgtgctggagggcgtcaaaactaacaagagcaaagtaaag
cttacgatctctgacgatctcggtcagaccacgctggaagttttcaaagaggatggcaagaccctcgtgt
ccaaaaaagtaacttccaaagacaagtcctctacggaagaaaaattcaacgaaaaaggtgaggtgtctga
aaagatcatcaccatggcagacggcacccgtcttgaatacaccggtattaaaagcgatggtaccggtaaa
gcgaaatatgttctgaaaaacttcactctggaaggcaaagtggctaatgataaaaccaccttggaagtca
aggaaggcaccgttactctgagcatgaatatctccaaatctggtgaagtttccgttgaactgaacgacac
tgacagcagcgctgcgactaaaaaaactgcagcgtggaattccaaaacttctactttaaccattagcgtt
aacagcaaaaaaactacccagctggtgttcactaaacaagacacgatcactgtgcagaaatacgactcca
acggcaccaacttagaaggcacggcagtcgaaattaaaacccttgatgaactgaaaaacgcgctgaaata
agctgagcggatcc
Комплементарная нить (SEQ ID NO: 56)
gtataccgtgtctttccacgactcagataaccaaggcaaagacatctagacgggccactttacttccaag
accactcgtttctttttctgttcttgccgttcatgctagagtagcgttggcagctgttcgacctcgactt
tccatgaagactatttttgttgccgagaccacacgacctcccgcagttttgattgttctcgtttcatttc
gaatgctagagactgctagagccagtctggtgcgaccttcaaaagtttctcctaccgttctgggagcaca
ggttttttcattgaaggtttctgttcaggagatgccttctttttaagttgctttttccactccacagact
tttctagtagtggtaccgtctgccgtgggcagaacttatgtggccataattttcgctaccatggccattt
cgctttatacaagactttttgaagtgagaccttccgtttcaccgattactattttggtggaaccttcagt
tccttccgtggcaatgagactcgtacttatagaggtttagaccacttcaaaggcaacttgacttgctgtg
actgtcgtcgcgacgctgatttttttgacgtcgcaccttaaggttttgaagatgaaattggtaatcgcaa
ttgtcgtttttttgatgggtcgaccacaagtgatttgttctgtgctagtgacacgtctttatgctgaggt
tgccgtggttgaatcttccgtgccgtcagctttaattttgggaactacttgactttttgcgcgactttat
tcgactcgcctagg
sOspA 6/4
Аминокислотная последовательность (SEQ ID NO: 10)
MAQKGAESIGSVSVDLPGGMTVLVSKEKDKNGKYSLEATVDKLELKGTSDKNNGSGTLEGEKTNKSKVKL
TIADDLSQTKFEIFKEDAKTLVSKKVTLKDKSSTEEKFNEKGETSEKTIVMANGTRLEYTDIKSDGSGKA
KYVLKDFTLEGTLAADGKTTLKVTEGTVVLSMNILKSGEITVALDDSDTTQATKKTGKWDSNTSTLTISV
NSKKTKNIVFTKEDTITVQKYDSAGTNLEGNAVEIKTLDELKNALK
ДНК-последовательность (SEQ ID NO: 9)
catatggcacagaaaggtgctgagtctattggttccgtttctgtagatctgcccggtggcatgaccgttc
tggtcagcaaagaaaaagacaaaaacggtaaatacagcctcgaggcgaccgtcgacaagcttgagctgaa
aggcacctctgataaaaacaacggttccggcaccctggaaggtgaaaaaactaacaaaagcaaagtgaaa
ctgaccattgctgatgacctcagccagaccaaattcgaaattttcaaagaagatgccaaaaccttagtat
ccaaaaaagtgaccctgaaagacaagtcctctaccgaagaaaaattcaacgaaaagggtgaaacctctga
aaaaaccatcgtaatggcaaatggtacccgtctggaatacaccgacatcaaaagcgatggctccggcaaa
gccaaatacgttctgaaagacttcaccctggaaggcaccctcgctgccgacggcaaaaccaccttgaaag
ttaccgaaggcactgttgttttaagcatgaacatcttaaaatccggtgaaatcaccgttgcgctggatga
ctctgacaccactcaggccactaaaaaaaccggcaaatgggattctaacacttccactctgaccatcagc
gtgaattccaaaaaaactaaaaacatcgtgttcaccaaagaagacaccatcaccgtccagaaatacgact
ctgcgggcaccaacctcgaaggcaacgcagtcgaaatcaaaaccctggatgaactgaaaaacgctctgaa
ataagctgagcggatcc
Комплементарная нить (SEQ ID NO: 57)
gtataccgtgtctttccacgactcagataaccaaggcaaagacatctagacgggccaccgtactggcaag
accagtcgtttctttttctgtttttgccatttatgtcggagctccgctggcagctgttcgaactcgactt
tccgtggagactatttttgttgccaaggccgtgggaccttccacttttttgattgttttcgtttcacttt
gactggtaacgactactggagtcggtctggtttaagctttaaaagtttcttctacggttttggaatcata
ggttttttcactgggactttctgttcaggagatggcttctttttaagttgcttttcccactttggagact
tttttggtagcattaccgtttaccatgggcagaccttatgtggctgtagttttcgctaccgaggccgttt
cggtttatgcaagactttctgaagtgggaccttccgtgggagcgacggctgccgttttggtggaactttc
aatggcttccgtgacaacaaaattcgtacttgtagaattttaggccactttagtggcaacgcgacctact
gagactgtggtgagtccggtgatttttttggccgtttaccctaagattgtgaaggtgagactggtagtcg
cacttaaggtttttttgatttttgtagcacaagtggtttcttctgtggtagtggcaggtctttatgctga
gacgcccgtggttggagcttccgttgcgtcagctttagttttgggacctacttgactttttgcgagactt
tattcgactcgcctagg
sOspA 5/3
Аминокислотная последовательность (SEQ ID NO: 12)
MAQKGAESIGSVSVDLPGGMKVLVSKEKDKNGKYSLMATVEKLELKGTSDKNNGSGTLEGEKTNKSKVKL
TIAEDLSKTTFEIFKEDGKTLVSKKVTLKDKSSTEEKFNEKGEISEKTIVMANGTRLEYTDIKSDKTGKA
KYVLKDFTLEGTLAADGKTTLKVTEGTVTLSMNISKSGEITVALDDTDSSGNKKSGTWDSDTSTLTISKN
SQKTKQLVFTKENTITVQNYNRAGNALEGSPAEIKDLAELKAALK
ДНК-последовательность (SEQ ID NO: 11)
catatggcacagaaaggtgctgagtctattggttccgtttctgtagatctgcccgggggtatgaaagttc
tggtaagcaaagaaaaagacaaaaacggtaaatacagcctgatggcaaccgtagaaaagctggagcttaa
aggcacttctgataaaaacaacggttctggcaccctggaaggtgaaaaaactaacaaaagcaaagtaaag
cttactattgctgaggatctgagcaaaaccacctttgaaatcttcaaagaagatggcaaaactctggtat
ctaaaaaagtaaccctgaaagacaagtcttctaccgaagaaaaattcaacgaaaagggtgaaatctctga
aaaaactatcgtaatggcaaatggtacccgtctggaatacaccgacatcaaaagcgataaaaccggcaaa
gctaaatacgttctgaaagactttactctggaaggcactctggctgctgacggcaaaaccactctgaaag
ttaccgaaggcactgttactctgagcatgaacatttctaaatccggcgaaatcaccgttgcactggatga
cactgactctagcggcaataaaaaatccggcacctgggattctgatacttctactttaaccattagcaaa
aacagccagaaaactaaacagctggtattcaccaaagaaaacactatcaccgtacagaactataaccgtg
caggcaatgcgctggaaggcagcccggctgaaattaaagatctggcagagctgaaagccgctttgaaata
agctgagcggatcc
Комплементарная нить (SEQ ID NO: 58)
gtataccgtgtctttccacgactcagataaccaaggcaaagacatctagacgggcccccatactttcaag
accattcgtttctttttctgtttttgccatttatgtcggactaccgttggcatcttttcgacctcgaatt
tccgtgaagactatttttgttgccaagaccgtgggaccttccacttttttgattgttttcgtttcatttc
gaatgataacgactcctagactcgttttggtggaaactttagaagtttcttctaccgttttgagaccata
gattttttcattgggactttctgttcagaagatggcttctttttaagttgcttttcccactttagagact
tttttgatagcattaccgtttaccatgggcagaccttatgtggctgtagttttcgctattttggccgttt
cgatttatgcaagactttctgaaatgagaccttccgtgagaccgacgactgccgttttggtgagactttc
aatggcttccgtgacaatgagactcgtacttgtaaagatttaggccgctttagtggcaacgtgacctact
gtgactgagatcgccgttattttttaggccgtggaccctaagactatgaagatgaaattggtaatcgttt
ttgtcggtcttttgatttgtcgaccataagtggtttcttttgtgatagtggcatgtcttgatattggcac
gtccgttacgcgaccttccgtcgggccgactttaatttctagaccgtctcgactttcggcgaaactttat
tcgactcgcctagg
Orig sOspA 1/2
Аминокислотная последовательность (SEQ ID NO: 169)
MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLEL
KGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKF
NEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSK
NISKSGEVSVELNDTDSSAATKKTAAWNSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAG
TNLEGTAVEIKTLDELKNALK
ДНК-последовательность (SEQ ID NO: 168)
atgaaaaaatatttattgggaataggtctaatattagccttaatagcatgtaagcaaaatgt
tagcagccttgacgagaaaaacagcgtttcagtagatttgcctggtgaaatgaaagttcttg
taagcaaagaaaaaaacaaagacggcaagtacgatctaattgcaacagtagacaagcttgag
cttaaaggaacttctgataaaaacaatggatctggagtacttgaaggcgtaaaagctgacaa
aagtaaagtaaaattaacaatttctgacgatctaggtcaaaccacacttgaagttttcaaag
aagatggcaaaacactagtatcaaaaaaagtaacttccaaagacaagtcatcaacagaagaa
aaattcaatgaaaaaggtgaagtatctgaaaaaataataacaagagcagacggaaccagact
tgaatacacaggaattaaaagcgatggatctggaaaagctaaagaggttttaaaaaacttta
ctcttgaaggaaaagtagctaatgataaagtaacattggaagtaaaagaaggaaccgttact
ttaagtaaaaatatttcaaaatctggggaagtttcagttgaacttaatgacactgacagtag
tgctgctactaaaaaaactgcagcttggaattcaaaaacttctactttaacaattagtgtta
acagcaaaaaaactacacaacttgtgtttactaaacaagacacaataactgtacaaaaatac
gactccgcaggtaccaatttagaaggcacagcagtcgaaattaaaacacttgatgaacttaa
aaacgctttaaaatag
Orig sOspA 6/4
Аминокислотная последовательность (SEQ ID NO: 171)
MKKYLLGIGLILALIACKQNVSTLDEKNSVSVDLPGGMTVLVSKEKDKDGKYSLEATVDKLE
LKGTSDKNNGSGTLEGEKTDKSKVKLTIADDLSQTKFEIFKEDAKTLVSKKVTLKDKSSTEE
KFNEKGETSEKTIVRANGTRLEYTDIKSDGSGKAKEVLKDFTLEGTLAADGKTTLKVTEGTV
VLSKNILKSGEITVALDDSDTTQATKKTGKWDSNTSTLTISVNSKKTKNIVFTKEDTITVQK
YDSAGTNLEGNAVEIKTLDELKNALK
ДНК-последовательность (SEQ ID NO: 170)
atgaaaaaatatttattgggaataggtctaatattagccttaatagcatgtaagcaaaatgt
tagcacgcttgatgaaaaaaatagcgtttcagtagatttacctggtggaatgacagttcttg
taagtaaagaaaaagacaaagacggtaaatacagtctagaggcaacagtagacaagcttgag
cttaaaggaacttctgataaaaacaacggttctggaacacttgaaggtgaaaaaactgacaa
aagtaaagtaaaattaacaattgctgatgacctaagtcaaactaaatttgaaattttcaaag
aagatgccaaaacattagtatcaaaaaaagtaacccttaaagacaagtcatcaacagaagaa
aaattcaacgaaaagggtgaaacatctgaaaaaacaatagtaagagcaaatggaaccagact
tgaatacacagacataaaaagcgatggatccggaaaagctaaagaagttttaaaagacttta
ctcttgaaggaactctagctgctgacggcaaaacaacattgaaagttacagaaggcactgtt
gttttaagcaagaacattttaaaatccggagaaataacagttgcacttgatgactctgacac
tactcaggctactaaaaaaactggaaaatgggattcaaatacttccactttaacaattagtg
tgaatagcaaaaaaactaaaaacattgtatttacaaaagaagacacaataacagtacaaaaa
tacgactcagcaggcaccaatctagaaggcaacgcagtcgaaattaaaacacttgatgaact
taaaaacgctttaaaataa
Orig sOspA 5/3
Аминокислотная последовательность (SEQ ID NO: 173)
MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGGMKVLVSKEKDKDGKYSLMATVEKLE
LKGTSDKNNGSGTLEGEKTDKSKVKLTIAEDLSKTTFEIFKEDGKTLVSKKVTLKDKSSTEE
KFNEKGEISEKTIVRANGTRLEYTDIKSDKTGKAKEVLKDFTLEGTLAADGKTTLKVTEGTV
TLSKNISKSGEITVALDDTDSSGNKKSGTWDSDTSTLTISKNSQKTKQLVFTKENTITVQNY
NRAGNALEGSPAEIKDLAELKAALK
ДНК-последовательность (SEQ ID NO: 172)
atgaaaaaatatttattgggaataggtctaatattagccttaatagcatgtaagcaaaatgt
tagcagccttgatgaaaaaaatagcgtttcagtagatttacctggtggaatgaaagttcttg
taagtaaagaaaaagacaaagatggtaaatacagtctaatggcaacagtagaaaagcttgag
cttaaaggaacttctgataaaaacaacggttctggaacacttgaaggtgaaaaaactgacaa
aagtaaagtaaaattaacaattgctgaggatctaagtaaaaccacatttgaaatcttcaaag
aagatggcaaaacattagtatcaaaaaaagtaacccttaaagacaagtcatcaacagaagaa
aaattcaacgaaaagggtgaaatatctgaaaaaacaatagtaagagcaaatggaaccagact
tgaatacacagacataaaaagcgataaaaccggaaaagctaaagaagttttaaaagacttta
ctcttgaaggaactctagctgctgacggcaaaacaacattgaaagttacagaaggcactgtt
actttaagcaagaacatttcaaaatccggagaaataacagttgcacttgatgacactgactc
tagcggcaataaaaaatccggaacatgggattcagatacttctactttaacaattagtaaaa
acagtcaaaaaactaaacaacttgtattcacaaaagaaaacacaataacagtacaaaactat
aacagagcaggcaatgcgcttgaaggcagcccagctgaaattaaagatcttgcagagcttaa
agccgctttaaaataa

Полипептиды OspA по изобретению включают полипептид, содержащий, состоящий по существу из или состоящий из аминокислотной последовательности SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3), и родственные полипептиды. Родственные полипептиды включают аналоги полипептида OspA, варианты полипептида OspA и производные полипептида OspA. В некоторых аспектах, полипептид OspA имеет амино-концевой остаток метионина, в зависимости от способа их получения. В родственных аспектах, полипептид OspA по изобретению содержит OspA активность.

В одном варианте воплощения, родственные молекулы нуклеиновой кислоты содержат или состоят из нуклеотидной последовательности, примерно на 70 процентов (70%) идентичной или подобной нуклеотидной последовательности, приведенной в SEQ ID NO: 1 (lipB sOspA 1/2251), SEQ ID NO: 3 (lipB sOspA 6/4), SEQ ID NO: 5 (lipB sOspA 5/3), SEQ ID NO: 7 (sOspA 1/2251), SEQ ID NO: 9 (sOspA 6/4), SEQ ID NO: 11 (sOspA 5/3), SEQ ID NO: 168 (orig sOspA 1/2), SEQ ID NO: 170 (orig sOspA 6/4) или SEQ ID NO: 172 (orig sOspA 5/3), в определенных аспектах, содержат, состоят по существу из, или состоят из нуклеотидной последовательности, кодирующей полипептид, примерно на 70 процентов (70%) идентичный полипептиду, приведенному в SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3). В различных вариантах воплощения нуклеотидные последовательности примерно на 70 процентов, или примерно на 71, 72, 73, 74, 75, 76, 77, 78 или 79 процентов, или примерно на 80 процентов, или примерно на 81, 82, 83, 84, 85, 86, 87, 88 или 89 процентов, или примерно на 90 процентов, или примерно на 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентов идентичны нуклеотидной последовательности, приведенной в SEQ ID NO: 1 (lipB sOspA 1/2251), SEQ ID NO: 3 (lipB sOspA 6/4), SEQ ID NO: 5 (lipB sOspA 5/3), SEQ ID NO: 7 (sOspA 1/2251), SEQ ID NO: 9 (sOspA 6/4), SEQ ID NO: 11 (sOspA 5/3), SEQ ID NO: 168 (orig sOspA 1/2), SEQ ID NO: 170 (orig sOspA 6/4) или SEQ ID NO: 172 (orig sOspA 5/3), или нуклеотидные последовательности кодируют полипептид, примерно на 70 процентов, или примерно на 71, 72, 73, 74, 75, 76, 77, 78 или 79 процентов, или примерно на 80 процентов, или примерно на 81, 82, 83, 84, 85, 86, 87, 88 или 89 процентов, или примерно на 90 процентов, или примерно на 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентов идентичный полипептидной последовательности, приведенной в SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3).

В некоторых вариантах воплощения, разработаны способы определения идентичности и/или подобия последовательностей для получения наибольшего совпадения сравниваемых последовательностей. Способы определения идентичности и подобия описаны в публично доступных компьютерных программах. В некоторых аспектах, способы определения идентичности и подобия двух последовательностей с помощью компьютерной программы включают, без ограничений, программный пакет GCG, включая GAP (Devereux et al., Nucl. Acid. Res., 12:387 (1984); Genetics Computer Group, University of Wisconsin, Madison, WI, BLASTP, BLASTN и FASTA (Altschul et al., J. Mol. Biol., 215:403-410 (1990)). Программа BLASTX является общедоступной и распространяется Национальным центром биотехнологической информации (National Center for Biotechnology Information, NCBI) и из других источников (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, MD 20894; Altschul et al., supra (1990)). Хорошо известный алгоритм Смита-Уотермана также используется для определения идентичности.

Определенные схемы выравнивания для сравнения двух аминокислотных последовательностей, в некоторых аспектах, приводят к совмещению только короткого участка двух последовательностей, и этот маленький совмещенный участок может иметь очень высокую идентичность последовательностей, даже если между двумя полноразмерными последовательностями нет значительного родства. Соответственно, в одном варианте воплощения, выбранный способ выравнивания (программа GAP) будет приводить к выравниванию, охватывающему по меньшей мере 50 последовательно расположенных аминокислот целевого полипептида. Например, при использовании компьютерного алгоритма GAP (Genetics Computer Group, University of Wisconsin, Madison, WI), два полипептида, для которых нужно определить процент идентичности последовательностей, выравнивают для достижения оптимального совпадения их соответствующих аминокислот (“совпадающая протяженность”, как определено в алгоритме). В сочетании с алгоритмом используются штраф за открытие делеции (который рассчитывается как 3× среднюю диагональ; “средняя диагональ” представляет собой среднее значение диагонали используемой матрицы сравнения; “диагональ” является количественным показателем или числом, присваиваемым каждому полному совпадению аминокислот в конкретной матрице сравнения) и штраф за продолжение делеции (который обычно составляет 1/10 от штрафа за открытие делеции), а также матрица сравнения, такая как PAM 250 или BLOSUM 62. Алгоритмом также используется стандартная матрица сравнения (см. Dayhoff et al., Atlas of Protein Sequence and Structure, 5(3)(1978) - про матрицу сравнения PAM 250; Henikoff et al., Proc. Natl. Acad. Sci USA, 89:10915-10919 (1992) - про матрицу сравнения BLOSUM 62).

В различных аспектах, параметры сравнения полипептидных последовательностей включают:

Алгоритм: Needleman et al., J. Mol. Biol., 48:443-453 (1970);

Матрица сравнения: BLOSUM 62 по Henikoff et al., supra (1992);

Штраф за открытие делеции: 12

Штраф за продолжение делеции: 4

Порог подобия: 0

Программа GAP является пригодной для использования с приведенными выше параметрами. Вышеуказанные параметры являются параметрами по умолчанию для сравнения полипептидов (вместе с отсутствием штрафа за завершение делеции) с использованием алгоритма GAP.

В некоторых аспектах, параметры сравнения последовательностей молекул нуклеиновой кислоты включают:

Алгоритм: Needleman et al., supra (1970);

Матрица сравнения: совпадение = +10, несовпадение = 0

Штраф за открытие делеции: 50

Штраф за продолжение делеции: 3

Программа GAP также пригодна для использования с приведенными выше параметрами. Вышеуказанные параметры являются параметрами по умолчанию для сравнения молекул нуклеиновой кислоты. Другие типичные примеры алгоритмов, штрафов за открытие делеции, штрафов за продолжение делеции, матриц сравнения, порогов подобия и т.п., используются квалифицированными специалистами в данной области техники, включая приведенные в руководстве к программе Wisconsin Package, Version 9, September, 1997. Процедура выбора конкретных параметров понятна квалифицированным специалистам в данной области техники и будет зависеть от конкретного сравнения, которое необходимо провести, такого как ДНК-с-ДНК, белок-с-белком, белок-с-ДНК; и, дополнительно, от того, проводится ли сравнение между данными парами последовательностей (в этом случае в общем предпочтительными являются GAP или BestFit) или между одной последовательностью и большой базой данных последовательностей (в этом случае предпочтительны FASTA или BLASTA).

Различия в последовательностях нуклеиновой кислоты, в некоторых аспектах, приводят к консервативным и/или неконсервативным модификациям аминокислотной последовательности по сравнению с аминокислотной последовательностью SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3).

Консервативные модификации аминокислотной последовательности SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3) (и соответствующие модификации кодирующих нуклеотидов) будут давать полипептиды OspA, имеющие функциональные и химические характеристики, схожие с природным полипептидом OspA. В отличие от этого, существенные модификации функциональных и/или химических характеристик полипептидов OspA осуществляются путем выбора замещений в аминокислотной последовательности SEQ ID NO: 2 (lipB sOspA 1/2251), SEQ ID NO: 4 (lipB sOspA 6/4), SEQ ID NO: 6 (lipB sOspA 5/3), SEQ ID NO: 8 (sOspA 1/2251), SEQ ID NO: 10 (sOspA 6/4), SEQ ID NO: 12 (sOspA 5/3), SEQ ID NO: 169 (orig sOspA 1/2), SEQ ID NO: 171 (orig sOspA 6/4) или SEQ ID NO: 173 (orig sOspA 5/3), которые значительно отличаются по своему влиянию на поддержание (а) структуры основной цепи молекулы в области замещения, например, в листовой или спиральной конформации, (б) заряда или гидрофобности молекулы в сайте-мишени, или (в) объема боковой цепи.

Например, "консервативное аминокислотное замещение", в некоторых аспектах, включает замещение нативного аминокислотного остатка не-нативным остатком так, чтобы при этом отсутствовал или возникал незначительный эффект на полярность или заряд аминокислотного остатка в данном положении. Кроме того, любой нативный остаток в полипептиде, в определенных аспектах, также замещается аланином, как было ранее описано для "сканирующего аланинового мутагенеза".

Консервативные аминокислотные замещения также охватывают неприродные аминокислотные остатки, которые типично вводятся способами химического синтез пептидов, а не синтезом в биологических системах. Они включают пептидомиметики и другие среверсированные или инвертированные формы аминокислотных фрагментов.

Природные остатки, в различных аспектах, делятся на классы по общим свойствам боковых цепей:

1) гидрофобные: норлейцин, Met, Ala, Val, Leu, Ile;

2) нейтральные гидрофильные: Cys, Ser, Thr, Asn, Gln;

3) кислотные: Asp, Glu;

4) основные: His, Lys, Arg;

5) остатки, влияющие на ориентацию цепи: Gly, Pro; и

6) ароматические: Trp, Tyr, Phe.

Например, неконсервативные замещения, в некоторых аспектах, включают замену члена одного из этих классов на член из другого класса. Такие замещенные остатки, в различных аспектах, вводятся в области полипептида OspA, являющиеся гомологичными, или подобными, ортологам полипептида OspA, или в негомологичные области молекулы.

При выполнении таких изменений часто принимается во внимание гидропатический индекс аминокислот. Каждой аминокислоте был присвоен гидропатический индекс на основании ее характеристик гидрофобности и заряда. Они имеют следующие значения: изолейцин (+4,5); валин (+4,2); лейцин (+3,8); фенилаланин (+2,8); цистеин/цистин (+2,5); метионин (+1,9); аланин (+1,8); глицин (-0,4); треонин (-0,7); серин (-0,8); триптофан (-0,9); тирозин (-1,3); пролин (-1,6); гистидин (-3,2); глутамат (-3,5); глутамин (-3,5); аспартат (-3,5); аспарагин (-3,5); лизин (-3,9); и аргинин (-4,5).

Важность гидропатического индекса аминокислоты в придании белку функций интерактивного биологического взаимодействия понятна специалистам (Kyte et al., J. Mol. Biol., 157:105-131 (1982)). Известно, что определенные аминокислоты могут быть замещены другими аминокислотами, имеющими схожий гидропатический индекс или балльную оценку, и сохранять при этом схожую биологическую активность. При внесении изменений на основе гидропатического индекса замещение аминокислот с гидропатическими индексами в пределах ±2, в определенных аспектах, является предпочтительным, в других аспектах, с индексами в пределах ±1 - является особенно предпочтительным, и в пределах ±0,5, в различных аспектах - наиболее предпочтительным.

Специалистам в данной области техники понятно также, что замещение подобных аминокислот может быть эффективно проведено на основе гидрофильности, особенно в тех случаях, когда в результате этого должен быть получен биологически функциональный эквивалент белка или пептида, в частности, для использования в иммунологических вариантах воплощения, как в данном случае. Наибольшая локальная средняя гидрофильность белка, определяемая гидрофильностью его расположенных рядом аминокислот, коррелирует с его иммуногенностью и антигенностью, т.е. с биологическими свойствами белка.

Указанным аминокислотным остаткам были присвоены следующие значения гидрофильности: аргинин (+3,0); лизин (+3,0); аспартат (+3,0 ± 1); глутамат (+3,0 ± 1); серин (+0,3); аспарагин (+0,2); глутамин (+0,2); глицин (0); треонин (-0,4); пролин (-0,5 ± 1); аланин (-0,5); гистидин (-0,5); цистеин (-1,0); метионин (-1,3); валин (-1,5); лейцин (-1,8); изолейцин (-1,8); тирозин (-2,3); фенилаланин (-2,5) и триптофан (-3,4). При внесении изменений на основе сходных значений гидрофильности, замещение аминокислот, значения гидрофильности которых отличаются в пределах ±2, в определенных аспектах, являются предпочтительными, отличающиеся на ±1, в других аспектах, являются особенно предпочтительными, и на ±0,5 - в различных аспектах, являются наиболее предпочтительными. Специалист также идентифицирует эпитопы по первичным аминокислотным последовательностям на основе гидрофильности. Такие участки также называются "участки ядра эпитопа".

Желательные аминокислотные замещения (консервативные или неконсервативные) могут быть определены квалифицированными специалистами в данной области техники в момент времени, когда такие замещения будут желательными. Например, аминокислотные замещения могут быть использованы для идентификации важных остатков полипептида OspA или для увеличения или уменьшения аффинности полипептидов OspA к их субстратам, описанным тут.

В некоторых аспектах, замещения нуклеотидов в нуклеотидных последовательностях и аминокислот в аминокислотных последовательностях включены в изобретение. Замещения включают от одного до 5, от одного до 10, от одного до 15, от одного до 20, от одного до 25, от одного до 30, от одного до 35, от одного до 40, от одного до 45, от одного до 50, от одного до 55, от одного до 60, от одного до 65, от одного до 70, от одного до 75, от одного до 80, от одного до 85, от одного до 90, от одного до 95, от одного до 100, от одного до 150 и от одного до 200 нуклеотидов. Аналогично, замещения включают от одного до 5, от одного до 10, от одного до 15, от одного до 20, от одного до 25, от одного до 30, от одного до 35, от одного до 40, от одного до 45, от одного до 50, от одного до 55, от одного до 60, от одного до 65, от одного до 70, от одного до 75, от одного до 80, от одного до 85, от одного до 90, от одного до 95 и от одного до 100 аминокислот. Замещения, в различных аспектах, являются консервативными или неконсервативными.

Типичные примеры аминокислотных замещений приведены в Таблице 2.

Таблица 2
Аминокислотные замещения
Исходные остатки Примеры замещений Предпочтительные замещения
Ala Val, Leu, Ile Val
Arg Lys, Gln, Asn Lys
Asn Gln Gln
Asp Glu Glu
Cys Ser, Ala Ser
Gln Asn Asn
Glu Asp Asp
Gly Pro, Ala Ala
His Asn, Gln, Lys, Arg Arg
Ile Leu, Val, Met, Ala, Phe, норлейцин Leu
Leu норлейцин, Ile, Val, Met, Ala, Phe Ile
Lys Arg, 1,4-диаминомасляная кислота, Gln, Asn Arg
Met Leu, Phe, Ile Leu
Phe Leu, Val, Ile, Ala, Tyr Leu
Pro Ala Gly
Ser Thr, Ala, Cys Thr
Thr Ser Ser
Trp Tyr, Phe Tyr
Tyr Trp, Phe, Thr, Ser Phe
Val Ile, Met, Leu, Phe, Ala, норлейцин Leu

Квалифицированный специалист может определить пригодные аналоги или варианты полипептида, приведенные в SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173, используя хорошо известные методики. Для идентификации пригодных областей молекулы, которые могут быть изменены без уничтожения активности, квалифицированный специалист в данной области техники может выбрать в качестве мишени области, которые считаются неважными для проявления активности. Например, если известны схожие полипептиды со схожими активностями от одного и того же вида или от других видов, квалифицированный специалист в данной области техники может сравнивать аминокислотную последовательность полипептида OspA с такими схожими полипептидами. При таком сравнении, можно идентифицировать остатки и участки молекул, являющиеся консервативными в схожих полипептидах. Следует понимать, что изменения в областях полипептида OspA, не являющихся консервативными по сравнению с такими схожими полипептидами, будут с меньшей вероятностью оказывать нежелательное влияние на биологическую активность и/или структуру полипептида OspA. Квалифицированный специалист в данной области техники будет также знать, что, даже в относительно консервативных областях, можно заменять химически схожие аминокислоты на природные остатки, сохраняя при этом активность (консервативные замещения аминокислотных остатков).

В некоторых вариантах воплощения, полипептидные варианты OspA включают гликозилирование варианты, в которых число и/или тип сайтов гликозилирования были изменены по сравнению с аминокислотной последовательностью, приведенной в SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173. В одном варианте воплощения, полипептидные варианты OspA содержат большее или меньшее число N-связанных сайтов гликозилирования, чем аминокислотная последовательность, приведенная в SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173. N-связанный сайт гликозилирования характеризуется последовательностью: Asn-X-Ser или Asn-X-Thr, где аминокислотный остаток, обозначенный как X, может быть любым аминокислотным остатком, кроме пролина. Замещение аминокислотных остатков для создания этой последовательности создает потенциальный новый сайт для аддиции N-связанной углеводной цепи. Альтернативно, замещения, уничтожающие такую последовательность, будут удалять существующую N-связанную углеводную цепь. Также предусматривается перегруппировка N-связанной углеводной цепи, когда удаляется один или более N-связанных сайтов гликозилирования (типично, являющихся природными) и создается один или более новых N-связанны сайтов. Дополнительные варианты OspA включают цистеиновые варианты, в которых один или более цистеиновых остатков удалены или замещены на другую аминокислоту (напр., серин) по сравнению с аминокислотной последовательностью, приведенной в SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173. Цистеиновые варианты полезны в тех случаях, когда полипептиды OspA должны быть подвергнуты переукладке в биологически активную конформацию, такой как после выделения нерастворимых телец включения. Цистеиновые варианты в общем содержат меньше цистеиновых остатков, чем нативный белок, и типично имеют четное их количество, для минимизации взаимодействий, вызываемых неспаренными цистеинами.

Изобретение далее предусматривает полипептиды, содержащие несущий эпитоп участок белка, как показано в SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173. Термин “эпитоп” относится к области белка, с которой может связываться антитело. См., напр., Geysen et al., Proc. Natl. Acad. Sci. USA 81:3998-4002 (1984). Эпитопы могут быть линейными или конформационными, причем последние состоят из прерывистых участков белка, которые образуют эпитоп при укладке белка. Линейные эпитопы обычно имеют по меньшей мере 6 аминокислотных остатков в длину. Относительно короткие синтетические пептиды, имитирующие часть белковой последовательности, нормально способны вызывать образование антисыворотки, которая реагирует с частично имитируемым белком. См., Sutcliffe et al., Science 219:660-666 (1983). Антитела, распознающие короткие линейные эпитопы, являются особенно пригодными для использования в аналитических и диагностических областях применения, использующих денатурированный белок, таких как вестерн-блоттинг. См. Tobin, Proc. Natl. Acad. Sci. USA, 76:4350-4356 (1979). Антитела к коротким пептидам, в определенных случаях, также распознают белки в нативной конформации и, таким образом, будут полезны для контроля экспрессии белка и выделения белка и для детектирования OspA-белков в растворе, например, способом ELISA (иммуноферментного твердофазного анализа) или при проведении исследований способом иммунопреципитации.

Синтез химерных молекул нуклеиновой кислоты и полипептидных молекул OspA

Молекулы нуклеиновой кислоты кодируют полипептид, содержащий аминокислотную последовательность полипептида OspA, и могут быть легко получены различными способами, включая, без ограничений, способы рекомбинантных ДНК и химический синтез.

Способы рекомбинантных ДНК в общем описаны в Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1989), и/или Ausubel et al., eds., Current Protocols in Molecular Biology, Green Publishers Inc. и Wiley and Sons, NY (1994). Методики рекомбинантной экспрессии, которые проводят в соответствии с приведенным ниже описанием, в различных аспектах, используют для продуцирования таких полинуклеотидов и для экспрессии кодируемых полипептидов. Например, с помощью инсерции последовательности нуклеиновой кислоты, кодирующей аминокислотную последовательность полипептида OspA в пригодный вектор, квалифицированный специалист в данной области техники может легко получить большие количества желательной нуклеотидной последовательности. Последовательности могут быть затем использованы для получения зондов для детектирования или праймеров для амплификации. Альтернативно, полинуклеотид, кодирующий аминокислотную последовательность полипептида OspA, может быть вставлен в экспрессионный вектор. В результате введения экспрессионного вектора пригодному хозяину, в некоторых аспектах, получают в больших количествах кодируемый полипептид OspA или полипептиды OspA.

Аналогично, химический синтез нуклеиновых кислот и полипептидов хорошо известен специалистам, такой как описанный Engels et al., Angew. Chem. Intl. Ed., 28:716-734 (1989). Такие способы включают, inter alia, фосфотриэфирный, фосфорамидитный и H-фосфонатный способы синтеза нуклеиновой кислоты. В одном аспекте, способ такого химического синтеза представляет собой синтез на полимерной подложке с использованием стандартной фосфорамидитной химии. Типично, ДНК, кодирующая аминокислотную последовательность полипептида OspA, будет содержать несколько сотен нуклеотидов в длину. Нуклеиновые кислоты размером более примерно 100 нуклеотидов синтезируют с использованием таких способов в виде нескольких фрагментов. Фрагменты затем лигируют вместе для получения полноразмерных нуклеотидных последовательностей по изобретению. В конкретных аспектах, фрагмент ДНК, кодирующий амино-конец полипептида, содержит ATG, кодирующий остаток метионина.

В конкретном аспекте изобретения, химерные кодирующие последовательности OspA получают с использованием синтетических перекрывающихся олигонуклеотидов. Поскольку ДНК из клеток Borrelia не используется, дополнительный полезный эффект синтетического подхода заключается в предотвращении загрязнения случайными агентами, содержащимися в материале животного происхождения (т.е. сыворотке или сывороточном альбумине), присутствующем в культуральной среде Borrelia. Эта стратегия также существенно уменьшает число манипуляций, необходимых для получения химерных генов, поскольку она позволяет осуществлять изменения последовательности за одну стадию, такие как модификации с целью оптимизации экспрессии (лидерная последовательность OspB), для введения сайтов рестрикции для облегчения клонирования, или во избежание потенциальных проблем, связанных с интеллектуальной собственностью. Она также позволяет оптимизировать использование кодонов для использования в качестве хозяина E. coli, поскольку известно, что присутствие кодонов, редко используемых в E. coli, представляет собой потенциальные препятствия для высоких уровней экспрессии чужеродных генов (Makoff et al., Nucleic Acids Res. 17:10191-202, 1989; Lakey et al., Infect. Immun. 68:233-8, 2000). Также используются другие способы, известные квалифицированному специалисту.

В определенных вариантах воплощения, варианты нуклеиновой кислоты содержат кодоны, которые были изменены для оптимальной экспрессии полипептида OspA в данной клетке-хозяине. Конкретные изменения кодонов зависят от полипептида (полипептидов) OspA и клетки-хозяина (клеток-хозяев), выбранных для экспрессии. Такая “оптимизация кодонов” может быть проведена различными способами, например, путем выбора кодонв, являющихся предпочтительными для использования в генах с высокой экспрессией в данной клетке-хозяине. В некоторых случаях используются компьютерные алгоритмы, которые включают таблицы частоты встречаемости кодонов, такие как “Ecohigh.cod” для кодонов, предпочтительных для бактериальных генов с высокой экспрессией, предоставленные University of Wisconsin Package Version 9.0, Genetics Computer Group, Madison, WI. Другие пригодные таблицы частоты встречаемости кодонов включают “Celegans_high.cod”, “Celegans_low.cod”, “Drosophila_high.cod”, “Human_high.cod”, “Maize_high.cod” и “Yeast_high.cod”.

Молекулу нуклеиновой кислоты, кодирующую аминокислотную последовательность полипептида OspA, в определенных аспектах, вставляют в пригодный экспрессионный вектор с помощью стандартных способов лигирования. Вектор типично выбирают таким образом, чтобы он был функциональным в конкретной спользуемой клетке-хозяине (т.е. вектор является совместимым с механизмами клетки-хозяина, так чтобы могла происходить амплификация гена и/или экспрессия гена). Молекула нуклеиновой кислоты, кодирующая аминокислотную последовательность полипептида OspA, в различных аспектах, амплифицируется/экспрессируется в прокариотических, дрожжевых, принадлежащих насекомым (бакуловирусные системы) и/или эукариотических клетках-хозяевах. Выбор клетки-хозяина зависит частично от того, должен ли полипептид OspA подвергаться посттрансляционному модифицированию (напр., гликозилированию и/или фосфорилированию). Если должен, то предпочтительными клетками-хозяевами являются клетки дрожжей, насекомых или млекопитающего. Обзор экспрессионных векторов приведен в Meth. Enz., vol.185, D.V. Goeddel, ed., Academic Press Inc., San Diego, CA (1990).

Клонирующие векторы включают все векторы, известные специалистам. См., напр., Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition. Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press, 1989. В одном аспекте, в качестве клонирующего вектора для всех промежуточных стадий используется pUC18, потому что генетические манипуляции и секвенирование с этой плазмидой проводить проще, чем с вектором pET30a. Основными отличительными признаками являются генный фрагмент lacZ, кодирующий альфа-пептид LacZ, пары оснований от 149 до 469 (промотор lac от пары оснований 507), ген bla, кодирующий детерминанту резистентности к ампициллину, пары оснований от 1629 до 2486 (промотор bla от пары оснований 2521), точка начала репликации у пары оснований 867 и сайты множественного клонирования, пары оснований от 185 до 451 (Фиг. 12).

Экспрессионные векторы включают все векторы, известные специалистам, включая, без ограничений, космиды, плазмиды (напр., «голые» или содержащиеся в липосомах) и вирусы, включающие рекомбинантный полинуклеотид. Экспрессионный вектор вставляют (напр., путем трансформации или трансдукции) в пригодную клетку-хозяина для экспрессии полинуклеотида и полипептида с помощью трансформации или трансфекции с использованием способов, известных специалистам. См., напр., Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition. Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press, 1989. В одном аспекте, pET30a (Novagen) используется в качестве экспрессионного вектора для конечной вставки полного гена OspA. В векторах pET, гены клонируются под контролем промотора T7 и экспрессия индуцируется путем обеспечения источника T7 РНК-полимеразы в клетке-хозяине (экспрессия не протекает до обеспечения источника T7 РНК-полимеразы). Основными признаками являются ген, кодирующий резистентность к канамицину (kan) от пары оснований 4048 до 4860, ген lacI, пары оснований 826-1905, точка начала репликации F1, пары оснований 4956-5411, и сайты множественного клонирования, пары оснований от 158 до 346 (Фиг. 13).

После того, как вектор будет сконструирован и молекула нуклеиновой кислоты, кодирующая полипептид OspA, будет вставлена в требуемый сайт вектора, готовый вектор вводят в пригодную клетку-хозяина для амплификации и/или экспрессии полипептида. Трансформация экспрессионного вектора для полипептида OspA в выбранную клетку-хозяина, в различных аспектах, осуществляется хорошо известными способами, такими как трансфекция, инфекция, медиируемая хлоридом кальция трансформация, электропорация, микроинъекция, липофекция или способ DEAE-декстран, или другими известными способами. Выбранный способ будет частично определяться типом клетки-хозяина, которая должна быть использована. Такие способы и другие пригодные способы хорошо известны квалифицированному специалисту и приведены, например, в Sambrook et al., supra.

Клетки-хозяева, в некоторых аспектах, являются прокариотическими клетками-хозяевами (такими как E. coli) или эукариотическими клетками-хозяевами (такими как клетки дрожжей, насекомых или позвоночных). Клетка-хозяин, при культивации в пригодных условиях, синтезирует полипептид OspA, который затем может быть выделен из культуральной среды (если клетка-хозяин секретирует его в среду) или непосредственно из продуцирующей его клетки-хозяина (если он не секретируется). Выбор пригодной клетки-хозяина зависит от различных факторов, таких как желательные уровни экспрессии, модификации полипептида, желательные или необходимые для проявления активности (такие как гликозилирование или фосфорилирование) и легкости укладки в биологически активную молекулу. Такие клетки-хозяева включают, без ограничений, клетки-хозяева бактериального, дрожжевого, грибкового, вирусного происхождения, беспозвоночных и млекопитающих. Примеры таких клеток-хозяев приведены в Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1989). В дополнительных аспектах, клетки-хозяева, которые стали использоваться специалистами после публикации руководства Maniatis (supra), также используются в изобретении.

В одном аспекте, клетка-хозяин представляет собой клетку E. coli. Пригодные штаммы E. coli включают, без ограничений, BL21, DH5α, HMS174(DE3), DH10B или E. CLONI 10G (Lucigen, Middleton, Wis.). В некоторых вариантах воплощения, клетки-хозяева подвергают генно-инженерным способам воздействия для повышения эффективности трансформации и/или поддержания вектора.

В одном аспекте, штамм DH5α E. coli [генотип: end A1 hsdR17 (rK-mK+) supE44 thi-1 recA1 gyrA (Nalr) relA1 D(lacZYA-argF)U169 deoR (F80dlacD(lacZ)M15] (Gibco BRL) используется для всех промежуточных стадий клонирования. Этот штамм был получен из штамма K12 E. coli, одного из наиболее широко используемых хозяев в генной инженерии. Штамм является amp- для обеспечения возможности селекции трансформантов векторами, содержащими ген резистентности к ампициллину (amp).

В другом аспекте, в качестве хозяина для экспрессии используется штамм E. coli HMS174(DE3). Клетки-хозяева E. coli HMS174(DE3) [генотип: F- recA1 hsdR (rk12- mk12+) RifR (DE3)] (Novagen) используются в различных описанных тут примерах для конечных стадий клонирования. Штамм является kan- для обеспечения возможности селекции трансформантов векторами, содержащими ген резистентности к канамицину (kan).

Клетки-хозяева, содержащие экспрессионный вектор полипептида OspA, культивируют с использованием стандартных сред, хорошо известных квалифицированному специалисту. Среды обычно будут содержать все питательные вещества, необходимые для роста и выживания клеток. Пригодные среды для культивации клеток E. coli включают, например, среду Луриа (LB) и/или Terrific Broth (TB). Пригодные среды для культивации эукариотических клеток включают среду Roswell Park Memorial Institute 1640 (RPMI 1640), минимальную существенную среду (MEM) и/или модифицированную по Дульбекко среда Игла (DMEM), все, в некоторых случаях, с добавкой сыворотки и/или факторов роста, требуемых для конкретной культивируемой клеточной линии. Пригодной средой для культур насекомых является среда Грейса (Grace's) с добавкой автолизата дрожжей Yeastolate, гидролизата лактальбумина и/или фетальной телячьей сыворотки, при необходимости.

Типично, антибиотик или другое соединение, пригодное для селективного выращивания трансформированных клеток, прибавляют к среде в качестве добавки. Какое соединение должно быть использовано - будет определяться селектируемым маркерным элементом, присутствующим в плазмиде, которой трансформирована клетка-хозяин. Например, в тех случаях, когда селектируемым маркерным элементом является резистентность к канамицину, прибавляемое к культуральной среде соединение будет канамицином. Другие соединения для селективного выращивания включают ампициллин, тетрациклин и неомицин.

Количество полипептида OspA, продуцируемого клеткой-хозяином, можно оценить с помощью стандартных способов, известных специалистам. Такие способы включают, без ограничений, анализ способом вестерн-блоттинга, электрофорез на полиакриламидном геле с добавкой ДСН, электрофорез в неденатурирующем геле, хроматографическое разделение, такое как высокоэффективная жидкостная хроматография (ВЭЖХ), иммунодетектирование, такое как иммунопреципитация, и/или анализы активности, такие как анализы связывания ДНК способом задержки в геле (gel shift assays).

В некоторых случаях, полипептид OspA не является биологически активным после выделения, и различные способы “переукладки” или перевода полипептида в его третичную структуру и создания дисульфидных связей используются для восстановления биологической активности. Такие способы включают воздействие на солюбилизированный полипептид значениями pH обычно выше 7 и в присутствии определенной концентрации хаотропного агента. Выбор хаотропного агента очень похож на выбор вариантов, используемых для солюбилизации телец включения, но обычно хаотропный агент используется в меньших концентрациях и не обязательно совпадает с хаотропными агентами, используемыми для солюбилизации. В некоторых случаях, раствор для переукладки/оксидации также содержит восстановитель или восстановитель плюс его окисленная форма в определенном соотношении для создания определенного значения окислительно-восстановительного потенциала, позволяющего проводить перетасовку дисульфидных связей при образовании цистеинового мостика (мостиков) белка. Некоторые из широко используемых окислительно-восстановительных пар включают цистеин/цистамин, глутатион (GSH)/дитиобис-GSH, хлорид меди, дитиотреит (DTT)/дитиан-DTT и 2-2-меркаптоэтанол (bME)/дитио-b(ME). Сорастворитель часто используется для увеличения эффективности переукладки и наиболее часто используемые с этой целью реагенты включают глицерин, полиэтиленгликоль различного молекулярного веса, аргинин и т.п.

Если тельца включения не образуются в значительных количествах при экспрессии полипептида OspA, то после центрифугирования клеточного гомогената полипептид будет находиться преимущественно в супернатанте. Полипептид затем выделяют из супернатанта с помощью способов, описанных тут, или других способов, известных специалистам.

Очистка полипептида OspA из раствора может быть проведена с использованием различных методик, известных специалистам. Если полипептид был синтезирован так, чтобы он содержал метку, такую как гексагистидин (полипептид OspA/hexaHis) или другой малый пептид, такой как FLAG (Eastman Kodak Co., New Haven, CT) или myc (Invitrogen, Carlsbad, CA) на любом из его карбоксильного или амино-концов, полипептид часто очищают одностадийным способом путем пропускания раствора через аффинную колонку, где матрикс колонки имеет высокую аффинность к метке. Например, полигистидин связывается с высокой аффинностью и специфичностью с никелем; таким образом, аффинная колонка с никелем (такая как никелевые колонки Qiagen®) может быть использована для очистки полипептида OspA/polyHis. См., например, Ausubel et al., eds., Current Protocols in Molecular Biology, Section 10.11.8, John Wiley & Sons, New York (1993).

Дополнительно, полипептид OspA может быть очищен путем использования моноклонального антитела, способного специфически распознавать и связываться с полипептидом OspA. Таким образом, пригодные процедуры очистки включают, без ограничений, аффинную хроматографию, иммуноаффинную хроматографию, ионообменную хроматографию, молекулярно-ситовую хроматографию, высокоэффективную жидкостную хроматографию (ВЭЖХ), электрофорез (включая нативный гелевый электрофорез) с последующим элюированием геля и препаративным изоэлектрическим фокусированием (аппарат/методика "Isoprime", Hoefer Scientific, San Francisco, CA). В некоторых случаях, комбинируют две или более методики очистки для достижения повышенной степени чистоты.

Полипептиды OspA также получают способами химического синтеза (такими как твердофазовый пептидный синтез) с использованием способов, известных специалистам, таких как описанные Merrifield et al., J. Am. Chem. Soc., 85:2149 (1963), Houghten et al., Proc. Natl. Acad. Sci. USA, 82:5132 (1985), и Stewart and Young, «Solid Phase Peptide Synthesis», Pierce Chemical Co., Rockford, IL (1984). Такие полипептиды синтезируют с метионином на амино-конце или без него. Химически синтезированные полипептиды OspA, в некоторых аспектах, окисляют с использованием способов, описанных в этих первоисточниках, с образованием дисульфидных мостиков. Ожидается, что химически синтезированные полипептиды OspA будут иметь сравнимую биологическую активность с соответствующими полипептидами OspA, полученными рекомбинантными способами или очисткой из природных источников и, таким образом, часто используются взаимозаменяемо с рекомбинантным полипептидом OspA. Подразумевается, что специалистам известен ряд дополнительных способов получения нуклеиновых кислот и полипептидов, и такие способы могут быть использованы для продуцирования полипептидов OspA.

Химические производные молекул полипептида OspA

Химически модифицированные производные полипептидов OspA могут быть получены квалифицированным специалистом в данной области техники с учетом приведенного ниже описания. Производные полипептида OspA модифицируют способами, различающимися по типу или положению молекул, в естественных условиях присоединенных к полипептиду. Производные, в некоторых аспектах, включают молекулы, образующиеся в результате удаления одной или более присоединенных в естественных условиях химических групп. Полипептид, содержащий аминокислотную последовательность SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173, или вариант полипептида OspA, в одном аспекте, модифицируют путем ковалентного присоединения одного или более полимеров. Например, выбранный полимер типично является водорастворимым, чтобы белок, к которому он присоединен, не выпадал в осадок в водной среде, такой как физиологическая среда. Пригодные полимеры включают смесь полимеров. В определенных аспектах, для терапевтического применения готового препарата, полимер будет фармацевтически приемлемым.

Каждый полимер, в различных аспектах, может иметь любой молекулярный вес и быть разветвленным или неразветвленным. Каждый полимер типично имеет средний молекулярный вес от примерно 2 кДа до примерно 100 кДа (термин "примерно" указывает, что в препаратах водорастворимого полимера некоторые молекулы будут весить больше, а некоторые меньше, чем указанный молекулярный вес). Средний молекулярный вес каждого полимера, в различных аспектах, составляет от примерно 5 кДа до примерно 50 кДа, от примерно 12 кДа до примерно 40 кДа и от примерно 20 кДа до примерно 35кДа.

Пригодные водорастворимые полимеры или их смеси включают, без ограничений, N-связанные или O-связанные углеводы; сахара; фосфаты; полиэтиленгликоль (ПЭГ) (включая формы ПЭГ используемые для дериватизации белков, включая моно-(C1-C10)-алкокси- или арилокси-полиэтиленгликоль); монометоксиполиэтиленгликоль; декстран (такой как низкомолекулярный декстран, например, примерно 6 кДа); целлюлозу; или другие полимеры на основе углеводов, поли-(N-винилпирролидон) полиэтиленгликоль, гомополимеры пропиленгликоля, сополимер полипропиленоксида/этиленоксида, полиоксиэтилированные полиолы (напр., глицерин) и поливиниловый спирт. Настоящее изобретение также охватывает бифункциональные сшивающие молекулы, которые иногда используются для получения ковалентно присоединенных мультимеров полипептида, содержащего аминокислотную последовательность SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173, или вариант полипептида OspA.

В некоторых аспектах, химическая дериватизация осуществляется в любых пригодных условиях, используемых для проведения реакции белка с активированной полимерной молекулой. Способы получения химических производных полипептидов в общем включают стадии (а) проведения реакции полипептида с активированной полимерной молекулой (такой как реакционно-способное сложноэфирное или альдегидной производное полимерной молекулы) в условиях, при которых полипептид, содержащий аминокислотную последовательность SEQ ID NO: 2, 4, 6, 8, 10, 12, 169, 171 или 173, или вариант полипептида OspA, присоединяется к одной или более полимерным молекулам, и (б) получения продукта (продуктов) реакции. Оптимальные реакционные условия определяют на основании известных параметров и желательного результата. Например, чем больше величина отношения полимерные молекулы: белок, тем выше процентная доля присоединенных полимерных молекул. В одном варианте воплощения, производное полипептида OspA содержит один фрагмент полимерной молекулы на аминоконце (см., например, патент США № 5234784).

Пегилирование полипептида, в определенных аспектах, конкретно осуществляют с помощью любой из реакций пегилирования, известных специалистам, как описано, например, в следующих источниках: Francis et al., Focus on Growth Factors, 3:4-10 (1992); EP 0154316; EP 0401384 и патент США № 4179337. Например, пегилирование проводят по реакции ацилирования или реакции алкилирования с реакционно-способной молекулой полиэтиленгликоля (или аналогичного реакционно-способного водорастворимого полимера) как описано тут. Для реакций ацилирования, выбранный полимер(ы) должен иметь одну реакционно-способную сложноэфирную группу. Для восстановительного алкилирования, выбранный полимер(ы) должен иметь одну реакционно-способную альдегидную группу. Реакционно-способным альдегидом является, например, полиэтиленгликоль-пропиональдегид, который является водостойким, или его моно-C1-C10-алкокси- или -арилокси-производные (см. патент США № 5252714).

В другом варианте воплощения, полипептиды OspA химически присоединяют к биотину и конъюгированным молекулам биотин/полипептид OspA затем позволяют связываться с авидином с образованием тетравалентных молекул авидин/биотин/полипептид OspA. Полипептиды OspA также ковалентно присоединяют к динитрофенолу (DNP) или тринитрофенолу (TNP) и полученные конъюгаты осаждают анти-DNP или анти-TNP-IgM с образованием декамерных конъюгатов с валентностью 10. Производные полипептида OspA, раскрытые тут, в определенных аспектах, обладают дополнительными активностями, повышенной или пониженной биологической активностью, или другими характеристиками, такими как увеличенный или уменьшенный период полувыведения, по сравнению с недериватизированными молекулами.

Иммуногенные композиции, вакцины и антитела

Некоторые аспекты изобретения включают иммуногенные композиции и вакцины. Иммуногенные химерные молекулы OspA по изобретению используются в комбинации в качестве антигена (антигенов), вызывающего анти-OspA иммунный ответ у субъекта (т.е. действуют как вакцина). Типичные примеры иммуногенных полипептидов OspA (SEQ ID NOS: 2, 4, 6, 169, 171 и 173) вводятся в комбинации для того, чтобы вызвать иммунный ответ на любой один или более серотипов 1-6 Borrelia и, в более общем случае, на многие другие виды Borrelia, описанные тут. Иммунный ответ также может быть вызван путем доставки плазмидных векторов, кодирующих полипептиды OspA по изобретению (т.е. введение "голых ДНК"). В некоторых аспектах, молекулы нуклеиновой кислоты OspA (SEQ ID NOS: 1, 3, 5, 168, 170 и 172) вводятся инъекцией, с помощью липосом, или другими средствами введения, описанными тут. После иммунизации субъект вырабатывает усиленный иммунный ответ против белка OspA серотипов 1-6 Borrelia и против других видов Borrelia.

Таким образом, как описано выше, как полипептиды OspA, так и молекулы нуклеиновой кислоты OspA включаются в качестве антигенов для использования в иммуногенных композициях и/или композициях вакцин по изобретению. В определенных аспектах субъекту вводятся как нуклеиновая кислота, так и белок. В конкретных аспектах, предлагается усиливать иммунный ответ на вакцину на основе нуклеиновой кислоты путем одновременного введения когнатного белка (см. WO 99/30733). Нуклеиновая кислота и белок не должны обязательно вводиться в одной и той же композиции. Оба просто должны быть введены во время фазы индукции иммунного ответа белком, в некоторых аспектах, замаскированной или задержанной до тех пор, пока нуклеиновая кислота не сенсибилизирует иммунную систему. В конкретном аспекте, вакцины предназначены для доставки нуклеиновой кислоты и белкового антигена в антигенпрезентирующие клетки (см. WO 97/28818). В различных аспектах, нуклеиновая кислота и белок закомплексованы, напр., путем ковалентной конъюгации. В дополнительных аспектах, для усиления иммуногенности антигенов вакцины также включают липосомальные композиции.

В определенных аспектах, иммуногенная композиция по изобретению включает любую одну или более молекул OspA, описанных тут, в сочетании с фармацевтическим носителем, причем композиция индуцирует продуцирование антитела, которое специфически связывается с внешним поверхностным белком A (OspA). В некоторых аспектах, иммуногенная композиция также содержит стабилизатор или антимикробный консервант. В конкретных аспектах, иммуногенная композиция индуцирует продуцирование антитела, которое специфически связывается с Borrelia. В других аспектах, композиция индуцирует продуцирование антитела, нейтрализующего Borrelia.

В некоторых аспектах, изобретение включает использование адъювантов в иммуногенных композициях, содержащих химерные молекулы OspA (антигены), описанные тут. В определенных аспектах, иммуногенность значительно усиливается, если антиген вводится совместно с адъювантом. В некоторых аспектах, адъювант используется в виде 0,001-50% раствора в фосфатно-солевом буфере (PBS). Адъюванты усиливают иммуногенность антигена, но сами не обязательно являются иммуногенными.

Адъюванты, в различных аспектах, оказывают ряд позитивных эффектов на вакцинацию. В некоторых случаях, адъюванты ускоряют выработку сильного иммунного ответа у субъектов. Адъюванты, в других случаях, повышают уровень иммунного ответа, пролонгируют его длительность и улучшают иммунную память. Адъюванты часто используются для борьбы с ослабленным иммунитетом в определенных группах субъектов (напр., у лиц пожилого возраста или пациентов с иммунной суппрессией) или для усиления иммуногенности в конкретной “группе риска” (такой как, без ограничений, очень молодые или лица пожилого возраста). Эффекты иммунного усиления адъюванта, в различных случаях, приводят к снижению требуемого количества антигена в готовой композиции для получения защитного ответа (т.е. уменьшению дозы).

В общем, адъюванты классифицируют по их преимущественному механизму действия на две основные группы: Первая группа представляет собой агонисты рецепторов или сенсоры врожденной иммунной системы, такие как агонисты Toll-подобного рецептора (TLR), агонисты лектинового рецептора C-типа, агонисты (индуцируемый ретиноевой кислотой ген-1 (RIG-1))-подобного рецептора (RLR) и агонисты (нуклеотид-связывающий домен и лейцин-богатый повтор)-содержащего рецептора (NLR). Вторая группа представляет собой вещества, действующие как системы доставки, также известные как TLR-независимые адъюванты. Примерами адъювантов TLR-агонистов являются ASO4 (Glaxo Smith Kline), TLR-4 агонист, используемый в качестве адъюванта в коммерческих вакцинах против гепатита B и вируса папилломы; Vaxinate, агонист флагеллин-слитого белка TLR-5; и многочисленные адъюванты TLR-9 агонистов, такие как использующие двухцепочечную ДНК (дцДНК) и олигонуклеотиды CpG или ODN1a. Другие TLR-агонисты, попадающие в эту категорию адъювантов, включают гликолипиды (TLR-1), липотейхоевую кислоту и липопротеин (TLR-1/TLR-2 и TLR-2/TLR-6) липополисахарид, липоолигосахариды и монофосфорил (липид A (MPL) (TLR-4), двухцепочечную РНК (TLR-3); пептидогликан (TLR-6), одноцепочечную РНК (TLR-7). Примеры двух адъювантов агониста лектинового рецептора C-типа включают ß-глюканы (Dectin-1) и маннаны (Dectin-2), оба выделенные из клеточных оболочек грибов. Адъюванты агониста RLR-рецептора включают одноцепочечные вирусные РНК и двухцепочечные вирусные ДНК, в то время как адъюванты NLR-агониста включают продукты деградации пептидогликана, микробные продукты и неинфекционные кристаллические частицы. Во всех случаях агонисты действуют путем прямой активации рецептора врожденной иммунной системы для запуска усиливающего иммунитет воспалительного ответа. Вторая группа адъювантов, TLR-независимые адъюванты, преимущественно действуют как системы доставки и усиливают поглощение антигена и его презентацию антигенпрезентирующей клеткой. В некоторых случаях, такие адъюванты могут также действовать путем локального удерживания антигена вблизи места введения для продуцирования эффекта депо, способствующего медленному пролонгированному выделению антигена в клетки иммунной системы. Адъюванты также привлекают клетки иммунной системы к депо антигена и стимулируют такие клетки для того, чтобы вызвать иммунные ответы. Примеры TLR-независимых адъювантов включают минеральные соли, такие как гидроксид алюминия и фосфат алюминия (коллективно называемые квасцами) и фосфат кальция; эмульсию типа масло-в-воде (напр., MF59, AS03 и ProVax); эмульсию типа вода-в-масле (Montanide, TiterMax); биополимеры (Advax); растительные производные, особенно, фракции сапонина, тритерпеноидный экстракт коры южноамериканского мыльного дерева Quillaja saponaria Molina (SFA-1, QS21, Quil A); иммуностимулирующие комплексы (ISCOM и ISCOM matrix), состоящие из фракций сапонина, стерола и, необязательно, фосфолипидов (ISCOMATRIX и Matrix-M); липосомы, представляющие собой фосфолипидные сферы различного размера и заряда (Vaxfectin и Vaxisome); вирусоподобные частицы и виросомы, представляющие собой липосомы, содержащие вирусные поверхностные антигены, такие как гемагглютинин и нейраминидаза Influenza; наночастицы различного состава; хитозан, пептиды, такие как полиаргинин и пептид, известный как пептид KLK.

Адъюванты, перечисленные выше, используются по одному или в комбинации. Комбинации TLR-зависимых и TLK-независимых адъювантов часто являются предпочтительными для использования в качестве антигена, и считается, что TLR-зависимые адъюванты транспортируются к антигенпрезентирующим клеткам TLR-независимым адъювантом, который также будет стимулировать поглощение и стабильность, в то время как TLR-зависимый адъювант будет непосредственно усиливать иммунитет путем активации сигнализации TLR.

Примеры комбинаций TLR-зависимых и TLR-независимых адъювантов включают AS01: смесь MPL (агонист TLR-4), липосомы и QS-21 (оба - TLR-независимые адъюванты); AS04: MPL (агонист TLR-4) и гидроксид алюминия/фосфат; IC31: ODN1a (агонист TLR-9) и пептид KLK (TLR-независимый адъювант); и полный адъювант Фрейнда, экстракт мембран Mycobacterium tuberculosis (агонист TLR-4) и эмульсию типа масло-в-воде (TLR-независимый адъювант).

Комбинации, состоящие из множества TLR-зависимых адъювантов, также используются для максимизации иммуноусиливающего эффекта композиций вакцин с адъювантами. Агонисты TLR, использующие разные адапторные белки, часто комбинируют (напр., комбинация агониста к связанному с плазматической мембраной рецептору TLR-3 или TLR-4, использующему TRIF (Toll/интерлейкин 1 рецепторный домен-содержащий адапторный белок, индуцирующий INF-ß) адапторный путь с агонистом TLR (TLR-7, TLR-8 и TLR-9), которые экспрессируются в эндосомальных или лизосомальных органеллах и используют путь адапторного белка MyD88 (белок первичного ответа миелоидной дифференциации)).

Такие иммуностимулирующие агенты или адъюванты также усиливают иммунный ответ хозяина на вакцины. В некоторых случаях такие вещества, как липополисахариды, могут выступать в роли внутренних адъювантов, поскольку они нормально являются компонентами убитых или аттенуированных бактерий, используемых в качестве вакцины. Внешние адъюванты, такие как перечисленные выше, являются иммуномодуляторами, которые типично нековалентно связаны с антигенами и включаются в рецептуру композиции для усиления иммунного ответа хозяина.

Широкий спектр внешних адъювантов может вызывать сильный иммунный ответы на антигены. Они включают сапонины в виде комплексов с антигенами мембранных белков (иммуностимулирующие комплексы), полимеры Pluronic с минеральным маслом, убитые микобактерии в минеральном масле, полный адъювант Фрейнда, бактериальные продукты, такие как мурамилдипептид (MDP) и липополисахарид (LPS), а также липид A и липосомы. Для эффективного индуцирования гуморального иммунного ответа (HIR) и клеточно-медиируемого иммунитета (CMI), иммуногены, в определенных аспектах, эмульгируют в адъювантах.

Желательные характеристики идеальных адъювантов включают любые или все из: отсутствия токсичности; способности стимулировать длительный иммунный ответ; простоты производства и стабильности при длительном хранении; способности вызывать как CMI, так и HIR к антигенам, введенным различными путями; синергии с другими адъювантами; способности к селективному взаимодействию с популяциями антигенпрезентирующих клеток (APC); способности специфически вызывать соответствующие TH1 или TH2 клеточно-специфические иммунные ответы; и способности селективно повышать уровни соответствующего изотипа антитела (например, IgA) против антигенов.

Патент США № 4855283, включенный сюда в качестве ссылки, описывает для этих же целей гликолипидые аналоги, включая N-гликозиламиды, N-гликозилмочевины и N-гликозилкарбаматы, каждый из которых замещен в остатке сахара аминокислотой, в качестве иммуномодуляторов или адъювантов. Патент США № 4855283 сообщает, что N-гликолипидные аналоги, демонстрирующие структурное сходство с природными гликолипидами, такие как гликосфинголипиды и гликоглицеролипиды, способны вызывать сильные иммунные ответы в вакцинах вируса простого герпеса и вируса псевдобешенства. Некоторые гликолипиды были синтезированы из длинноцепочечных алкиламинов и жирных кислот, связанных непосредственно с сахаром через аномерный атом углерода, для имитации функций природных липидных остатков.

В некоторых аспектах, иммуногенная композиция содержит количество адъюванта, достаточное для усиления иммунного ответа на иммуноген. Пригодные адъюванты включают, без ограничений, соли алюминия (фосфат алюминия или гидроксид алюминия), смеси сквалена (SAF-1), мурамилпептид, производные сапонина, препараты клеточных мембран микобактерий, монофосфорил липид A, производные миколовой кислоты, неионные блок-сополимерные поверхностно-активные вещества, Quil A, B-субъединицу холерного токсина, полифосфазен и производные, и иммуностимулирующие комплексы (ISCOM), такие как описанные Takahashi et al. (Nature 344:873-875, 1990). В некоторых аспектах, адъювант представляет собой синтетический адъювант. В конкретном аспекте, синтетический адъювант является глюкопиранозил-липидным адъювантом (GLA).

Дополнительным аспектом изобретения является вакцина, содержащая иммуногенную композицию по изобретению и фармацевтически приемлемый носитель. Как было описано выше, вакцина, в определенных аспектах, включает один или более стабилизаторов и/или один или более консервантов.

В одном аспекте, предусматривается вакцина, содержащая по меньшей мере один рекомбинантный экспрессионный конструкт, который включает промотор, функционально связанный с последовательностью нуклеиновой кислоты, кодирующей антиген (химерный полипептид OspA, описанный тут), и адъювант. В одном варианте воплощения рекомбинантный экспрессионный конструкт (экспрессионный вектор, содержащий полинуклеотид OspA) присутствует в вирусном векторе, который в определенных дополнительных вариантах воплощения присутствует в вирусе, выбранном из аденовируса, адено-ассоциированного вируса, герпесвируса, лентивируса, поксвируса и ретровируса.

Дополнительные аспекты изобретения включают антитела к химерным молекулам OspA, описанным тут. В различных аспектах, изобретение включает химерные молекулы OspA для получения анти-OspA антител и для обеспечения иммунитета от инфекции Borrelia. В некоторых аспектах, такие анти-OspA антитела, напр. мышиные, человеческие, или гуманизированные моноклональные антитела или одноцепочечные антитела, вводятся субъекту (напр., пассивная иммунизация) для того, чтобы вызвать иммунный ответ против белка OspA любого одного или более серотипов 1-6 Borrelia. В используемом тут значении, термин “антитела” относится к молекуле, которая обладает специфичностью по отношению к одному или более полипептидам OspA. Пригодные антитела получают с использованием способов, известных специалистам. В определенных аспектах, антитело OspA способно связывать определенный участок полипептида OspA, тем самым ингибируя связывание полипептида с рецептором (рецепторами) полипептида OspA. Антитела и фрагменты антител, которые связывают химерные полипептиды OspA по изобретению, входят в объем настоящего изобретения.

В некоторых аспектах, антитела по изобретению включают антитело или его фрагмент, которые специфически связываются с одним или более полипептидами OspA, продуцируемыми путем иммунизации животного полипептидом, содержащим аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NOS: 2, 4, 6, 8, 10, 12, 169, 171 и 173. В других аспектах, изобретение включает антитело или его фрагмент, которые специфически связываются с полипептидом, кодируемым последовательностью нуклеиновой кислоты, выбранной из группы, состоящей из SEQ ID NOS: 1, 3, 5, 7, 9, 11, 168, 170 и 172. В различных аспектах, антитело или его фрагмент являются человеческими, гуманизированными, поликлональными или моноклональными. В дополнительных аспектах, антитело редставляет собой антитело Fab или Fab'. В конкретных аспектах, антитело содержит детектируемую метку. В некоторых аспектах, антитело представляет собой химически модифицированное производное антитела.

Введение химерных молекул OspA в соответствии с изобретением стимулирует иммунный или гуморальный ответ у людей или животных. В некоторых аспектах, три химерные молекулы OspA (напр., липидированный OspA 1/2251, липидированный OspA 6/4 OspA и липидированный OspA 5/3; или исходный OspA 1/2, исходный OspA 6/4 и исходный OspA 5/3) вводятся вместе для того, чтобы вызвать гуморальный ответ против всех шести серотипов (1-6), описанных тут. Этот гуморальный ответ означает, что способы по изобретению, в различных аспектах, используются просто для стимулирования иммунного ответа (в отличие от обеспечения также защитного ответа), потому что полученные антитела (без защиты), тем не менее, являются полезными. Из полученных антител, хорошо известными специалистам способами, получают моноклональные антитела; и используют такие моноклональные антитела в хорошо известных анализах связывания антител, диагностических наборах или тестах для определения присутствия или отсутствия Borrelia burgdorferi s.l., или для определения того, был ли иммунный ответ на спирохету просто стимулированным. Моноклональные антитела, в определенных аспектах, используются в иммуноадсорбционной хроматографии для извлечения или выделения антигенов Borrelia, таких как OspA.

Антитела OspA по изобретению, в различных аспектах, являются поликлональными, включая моноспецифические поликлональные, моноклональные (MAb), рекомбинантные, химерные, гуманизированные, такие как CDR-привитые, человеческие, одноцепочечные и/или биспецифические, а также их фрагментами, вариантами или производными. Фрагменты антитела включают участки антитела, которые связываются с эпитопом полипептида OspA. Примеры таких фрагментов включают фрагменты Fab и F(ab'), получаемые ферментативным расщеплением полноразмерных антител. Другие связывающие фрагменты включают получаемые способами рекомбинантных ДНК, такими как экспрессия рекомбинантных плазмид, содержащих последовательности нуклеиновой кислоты, кодирующей вариабельные области антитела.

Поликлональные антитела, направленные против полипептида OspA, в общем, продуцируются у субъекта (включая кроликов, мышей или другое животное или млекопитающее) с помощью множества подкожных, внутримышечных или интраперитонеальных инъекций полипептида OspA и адъюванта. В определенных аспектах является полезным конъюгировать полипептид OspA по изобретению с белком-носителем, иммуногенным в иммунизируемом виде, таким как гемоцианин моллюска блюдечко, сывороточный альбумин, бычий тиреоглобулин, или соевый ингибитор трипсина. Для усиления иммунного ответа также используются адъюванты, такие как квасы. После иммунизации, берут образцы крови у иммунизированного субъекта и сыворотку оценивают на титр антител против полипептида OspA.

Моноклональные антитела, направленные против полипептида OspA, продуцируются с использованием любого способа, обеспечивающего продуцирование молекул антитела непрерывными клеточными линиями в культуре. Примеры пригодных способов получения моноклональных антител включают гибридомные способы Kohler et al., Nature, 256:495-497 (1975) и способ человеческой B-клеточной гибридомы, Kozbor, J. Immunol., 133:3001 (1984), и Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987). Изобретение также предусматривает гибридомные клеточные линии, продуцирующие моноклональные антитела, реакционно-способные по отношению к полипептидам OspA.

Моноклональные антитела по изобретению, в некоторых случаях, модифицируют для использования в качестве терапевтических средств. Один из вариантов воплощения представляет собой “химерное” антитело, в котором часть тяжелой и/или легкой цепи идентична с или гомологична соответствующей последовательности антител, полученных от определенного вида или принадлежащих к определенному классу или подклассу антител, в то время как остальная цепь (цепи) идентична (идентичны) с или гомологична соответствующей последовательности антител, полученных от другого вида, или принадлежащей к другому классу или подклассу антител. Также включены фрагменты таких антител, при условии, что они проявляют желательную биологическую активность. См. патент США № 4816567 и Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1985).

В другом варианте воплощения, моноклональное антитело по изобретению представляет собой “гуманизированное” антитело. Способы гуманизации не-человеческих антител хорошо известны специалистам (см. патенты США №№ 5585089 и 5693762). В общем, гуманизированное антитело содержит один или более аминокислотных остатков, введенных в него из источника, не принадлежащего человеку. Гуманизация может быть осуществлена, например, с использованием способов, описанных в литературе (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988)), путем замещения по меньшей мере частью гипервариабельного участка (CDR) грызуна соответствующих областей человеческого антитела.

В альтернативном варианте воплощения, человеческие антитела продуцируются из библиотеки фагового дисплея (Hoogenboom et al., J. Mol. Biol. 227:381 (1991) и Marks et al., J. Mol. Biol. 222:581 (1991)). Эти способы имитируют иммунную идентификацию путем экспонирования репертуаров антител на поверхности нитчатого бактериофага и последующей селекции фагов по их связыванию с выбранным антигеном. Одна такая методика описана в заявке PCT № PCT/US98/17364 (Adams et al.), которая описывает выделение высокоаффинных и функционально агонистических антител к MPL- и msk-рецепторам с использованием такого подхода.

Химерные, CDR-привитые и гуманизированные антитела типично продуцируют рекомбинантными способами. Нуклеиновые кислоты, кодирующие антитела, вводятся в клетки-хозяева и экспрессируются с использованием материалов и процедур, описанных тут или известных специалистам. В одном варианте воплощения, антитела продуцируются в клетках-хозяевах млекопитающего, таких как клетки CHO. Моноклональные (напр., человеческие) антитела, в различных аспектах, продуцируются путем экспрессии рекомбинантной ДНК в клетках-хозяевах или путем экспрессии в гибридомных клетках, как описано тут. В некоторых аспектах, моноклональное антитело или его фрагмент является гуманизированным. В конкретном аспекте, моноклональное антитело представляет собой F237/BK2, как описано тут.

В определенных аспектах, изобретение включает способы профилактики или лечения инфекции Borrelia или лаймской болезни у субъекта, включающие стадию введения субъекту антитела или его фрагмента, как описано тут, в количестве, обеспечивающем эффективную профилактику или лечение инфекции Borrelia или лаймской болезни. В конкретных аспектах, антитело или его фрагмент представляет собой гипериммунную сыворотку, гипериммунную плазму или его очищенную иммуноглобулиновую фракцию. В других аспектах, антитело или его фрагмент представляет собой очищенный препарат иммуноглобулина или препарат иммуноглобулинового фрагмента.

Анти-антитела OspA по изобретению, в различных аспектах, используются в любом известном способе анализа, таком как конкурентные анализы связывания, прямые и непрямые сэндвич-анализы и анализы иммунопреципитации (Sola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc., 1987)) для детектирования и количественного определения полипептидов OspA. Антитела будут связывать полипептиды OspA с аффинностью, соответствующей используемому способу анализа.

Для диагностического или клинического применения, в определенных вариантах воплощения, анти-антитела OspA метят детектируемым фрагментом. Детектируемый фрагмент может быть любым, способным продуцировать, прямо или опосредованно, детектируемый сигнал. Например, в определенных аспектах, детектируемый фрагмент представляет собой радиоактивный изотоп, такой как 3H, 14C, 32P, 35S или 125I; флуоресцентное или хемолюминесцентное соединение, такое как флуоресцеинизотиоцианат, родамин или люциферин; или фермент, такой как щелочная фосфатаза, β-галактозидаза или пероксидаза хрена (Bayer et al., Meth. Enzym. 184:138-163 (1990)).

Конкурентные анализы связывания основаны на способности меченого стандарта (напр., полипептида OspA, или его иммунологически реакционно-способного участка) конкурировать с исследуемым образцом аналита (полипептид OspA) за связывание с ограниченным количеством анти-OspA антитела. Количество полипептида OspA в исследуемом образце обратно пропорционально количеству стандарта, связывающегося с антителами. Для облегчения определения количества связываемого стандарта, антитела типично переводят в нерастворимую форму перед или после конкурентного анализа, так чтобы стандарт и аналит, связанные с антителом, можно было удобно отделить от остающихся несвязанными стандарта и аналита.

Сэндвич-анализы типично предусматривают использование двух антител, каждое из которых способно связываться с разными иммуногенными участками, или эпитопами, детектируемого и/или количественно определяемого белка. При сэндвич-анализе исследуемый образец аналита типично связывается первым антителом, которое иммобилизовано на твердом носителе, и после этого второе антитело связывается с аналитом, тем самым образуя нерастворимый трехкомпонентный комплекс. См., напр., патент США № 4376110. Второе антитело, в некоторых случаях, является меченым детектируемым фрагментом (прямые сэндвич-анализы) или измеряется с помощью анти-иммуноглобулинового антитела, меченого детектируемым фрагментом (непрямые сэндвич-анализы). Например, одним из типов сэндвич-анализа является твердофазовый иммуноферментный анализ (ELISA), в этом случае детектируемый фрагмент представляет собой фермент.

Анти-OspA антитела также пригодны для in vivo визуализации. Антитело, меченное детектируемым фрагментом, в определенных аспектах, вводят животному в кровоток и оценивают присутствие и местонахождение меченого антитела в хозяине. Антитело, в различных аспектах, метят любым фрагментом, являющимся детектируемым у животного способами ядерного магнитного резонанса, радиологии или другими способами детектирования, известными специалистам. В некоторых аспектах изобретения, антитела OspA используются в качестве терапевтических средств.

Композиции химерного OspA и их введение

Для введения субъектам химерных полипептидов OspA, описанных тут, готовят композиции полипептидов OspA, содержащие один или более фармацевтически приемлемых носителей. Фраза “фармацевтически или фармакологически приемлемый” относится к молекулярным частицам и композициям, которые не вызывают аллергических или других нежелательных реакций при введении путями, хорошо известными специалистам, как описано ниже. “Фармацевтически приемлемые носители” включают любые из и все клинически пригодные растворители, дисперсионные среды, покрытия, антибактериальные и антигрибковые агенты, изотонические и замедляющие всасывание агенты и т.п. В некоторых аспектах, композиция образует сольваты с водой или обычными органическими растворителями. Такие сольваты также включены в настоящее изобретение.

Иммуногенная композиция или композиция вакцины по изобретению, в различных аспектах, вводится перорально, местно, трансдермально, парентерально, с помощью спрея для ингаляции, вагинально, ректально или с помощью внутричерепной инъекции. Термин парентеральный в используемом тут значении включает подкожные инъекции, внутривенные, внутримышечные, интрацистернальные инъекции или инфузионные способы. Также предусматривается введение с помощью внутривенной, интрадермальной, внутримышечной, интрамаммарной, интраперитонеальной, интратекальной, ретробульбарной, внутрилегочной инъекции и или хирургической имплантации в определенное место. В общем, композиции по существу не содержат пирогенов, а также других примесей, которые могли бы быть вредными для реципиента.

Рецептура фармацевтической композиции будет меняться в зависимости от выбранного пути введения (напр., раствор, эмульсия). Пригодную композицию, содержащую предназначенную для введения композицию, готовят в физиологически приемлемом растворителе или носителе. Для растворов или эмульсий, пригодные носители включают, например, водные или спиртово-водные растворы, эмульсии или суспензии, включая солевые и забуференные среды. Парентеральные носители, в некоторых аспектах, включают раствор хлорида натрия, декстрозу Рингера, декстрозу и хлорид натрия, лактатный раствор Рингера или нелетучие масла. Внутривенные носители, в определенных аспектах, включают различные добавки, консерванты или жидкости, питательные вещества или средства для восстановления электролитного баланса.

Фармацевтические композиции, пригодные для использования в соединениях и способах по настоящему изобретению, включающих полипептиды OspA в качестве активного ингредиента, содержат, в различных аспектах, фармацевтически приемлемые носители или добавки, определяемые в зависимости от пути введения. Примеры таких носителей или добавок включают воду, фармацевтически приемлемый органический растворитель, коллаген, поливиниловый спирт, поливинилпирролидон, карбоксивинильный полимер, карбоксиметилцеллюлозу натрия, полиакрилат натрия, альгинат натрия, водорастворимый декстран, карбоксиметилкрахмал натрия, пектин, метилцеллюлозу, этилцеллюлозу, ксантановую камедь, гуммиарабик, казеин, желатин, агар, диглицерин, глицерин, пропиленгликоль, полиэтиленгликоль, вазелин, парафин, стеариловый спирт, стеариловую кислоту, человеческий сывороточный альбумин (HSA), маннит, сорбит, лактозу, фармацевтически приемлемое поверхностно-активное вещество и т.п. Используемые добавки выбирают, без ограничений, из вышеперечисленных материалов или их комбинаций, при необходимости, в зависимости от лекарственной формы по настоящему изобретению.

Различные водные носители, напр. вода, забуференная вода, 0,4% солевой раствор, 0,3% глицин, или водные суспензии содержат, в различных аспектах, активное соединение в смеси с эксципиентами, пригодными для производства водных суспензий. Такие эксципиенты представляют собой суспендирующие агенты, например, натрия карбоксиметилцеллюлоза, метилцеллюлоза, гидроксипропилметилцеллюлоза, альгинат натрия, поливинилпирролидон, трагакантовая камедь и аравийская камедь; диспергирующие или смачивающие агенты, в некоторых случаях, природный фосфатид, например, лецитин, или продукты конденсации алкиленоксида с жирными кислотами, например, полиоксиэтиленстеарат, или продукты конденсации этиленоксида с длинноцепочечными алифатическими спиртами, например, гептадекаэтиленоксицетанол, или продукты конденсации этиленоксида с неполными сложными эфирами жирных кислот и гексита, такими как полиоксиэтиленсорбитмоноолеат, или продукты конденсации этиленоксида с неполными сложными эфирами жирных кислот и ангидридов гексита, например, полиэтиленсорбитанмоноолеат. Водные суспензии, в некоторых аспектах, содержат один или более консервантов, например, этил- или н-пропил-, п-гидроксибензоат.

В некоторых аспектах, композиции OspA лиофилизируют для хранения и восстанавливают в пригодном носителе перед использованием. Эффективность этой методики была продемонстрирована на обычных иммуноглобулинах. Используются любые пригодные методики лиофилизация и восстановления, известные специалистам. Квалифицированным специалистам в данной области техники понятно, что лиофилизация и восстановление приводят к различным степеням потери активности антител, и что уровни использования часто регулируют в целях компенсации.

Диспергируемые порошки и гранулы, пригодные для получения водных суспензий путем прибавления воды, дают активное соединение в смеси с диспергирующим или смачивающим агентом, суспендирующим агентом и одним или более консервантами. Типичные примеры пригодных диспергирующих или смачивающих агентов и суспендирующих агентов были уже указаны выше.

В определенных аспектах, концентрация OspA в таких композициях меняется в широких пределах, например, от менее чем примерно 0,5%, обычно около или по меньшей мере примерно 1%, и до 15 или 20% мас., и будет выбираться преимущественно на основании объемов жидкости, вязкостей и т.д., в соответствии с выбранным конкретным способом введения. Так, например, и без ограничений, типичная фармацевтическая композиция для парентеральной инъекции готовится таким образом, чтобы она содержала 1 мл стерильной забуференной воды и 50 мг фактора свертывания крови. Типичная композиция для внутривенной инфузии может быть приготовлена так, чтобы она содержала 250 мл стерильного раствора Рингера и 150 мг фактора свертывания крови. Фактические способы получения пригодных для парентерального введения композиций известны или понятны квалифицированным специалистам в данной области техники и описаны более подробно, например, в Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980). Эффективная доза обычно находится в интервале значений от 0,01 мг до 1000 мг на кг веса тела на введение.

В различных аспектах, фармацевтические композиции имеют вид стерильных водных, масляных суспензий для инъекции, дисперсий или стерильных порошков для приготовления предназначенных для немедленного применения стерильных растворов или дисперсий для инъекций. Суспензия, в некоторых аспектах, готовится в соответствии с известным уровнем техники с использованием пригодных диспергирующих или смачивающих агентов и суспендирующих агентов, указанных выше. Стерильный препарат для инъекций, в определенных аспектах, представляет собой стерильный раствор или суспензию для инъекций в нетоксичном приемлемом для парентерального введения разбавителе или растворителе, например, в виде раствора в 1,3-бутандиоле. В некоторых вариантах воплощения, носитель представляет собой растворитель или дисперсионную среду, содержащую, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль и т.п.), их пригодные смеси, растительные масла, раствор Рингера и изотонический раствор хлорида натрия. Кроме того, в качестве растворителя или суспендирующей среды обычно используются стерильные нелетучие масла. С этой целью используют любое обычное нелетучее масло, в различных аспектах, включая синтетические моно- или диглицериды. Кроме того, жирные кислоты, такие как олеиновая кислота, находят применение при приготовлении композиций для инъекций.

Во всех случаях лекарственная форма должна быть стерильной и текучей до степени, позволяющей легко вводить ее шприцом. Надлежащая текучесть поддерживается, например, путем использования покрытия, такого как лецитин, путем поддержания требуемого размера частиц в случае дисперсии, и путем использования поверхностно-активных веществ. Она должна быть стабильной в условиях производства и хранения и должна быть защищена от загрязняющего действия микроорганизмов, таких как бактерии и грибы. Предотвращение воздействия микроорганизмов обеспечивается различными антибактериальными и антигрибковыми агентами, например парабенами, хлорбутанолом, фенолом, сорбиновой кислотой, тимеросалом и т.п. Во многих случаях будет желательным включение изотонических агентов, например сахара или хлорида натрия. В определенных аспектах, пролонгирование всасывание композиций для инъекций обеспечивается путем использования в композициях агентов, замедляющих всасывание, например, моностеарата алюминия и желатина.

Композиции, пригодные для введения, в определенных аспектах, готовят с использованием средств, усиливающих всасывание или абсорбцию для увеличения их эффективности. Такие средства-энхансеры, включают, например, салицилат, гликохолат/линолеат, глихолат, апротинин, бацитрацин, ДСН, капрат и т.п. См., напр., Fix (J. Pharm. Sci., 85:1282-1285, 1996) и Oliyai et al. (Ann. Rev. Pharmacol. Toxicol., 32:521-544, 1993).

Кроме того, свойства гидрофильности и гидрофобности композиций, используемых в составах и способах по изобретению, хорошо сбалансированы, что повышает их пригодность для in vitro и особенно in vivo применения, в то время как другие композиции, не имеющие такой сбалансированности, являются значительно менее пригодными. Конкретнее, композиции по изобретению имеют соответствующую степень растворимости в водных средах, что обеспечивает абсорбцию и биодоступность в организме, и в то же время имеют также определенную степень растворимости в липидах, что позволяет соединениям проходить через клеточные мембраны к предполагаемому месту действия.

В конкретных аспектах, из полипептидов OspA, описанных тут, готовят композиции вакцины, содержащие адъювант. Любой адъювант, известный специалистам, используется в различных аспектах композиции вакцины, включая масляные адъюванты, такие как полный адъювант Фрейнда и неполный адъювант Фрейнда, адъюванты на основе миколата (напр., трегалозы димиколат), бактериальный липополисахарид (LPS), пептидогликаны (т.е. муреины, мукопептиды, или гликопротеины, такие как N-Opaca, мурамилдипептид [MDP], или аналоги MDP), протеогликаны (напр., экстрагированные из Klebsiella pneumoniae), стрептококковые препараты (напр., OK432), Biostim™ (напр., 01K2), иммуностимулирующие комплексы "Iscoms" по EP 109942, EP 180564 и EP 231039, гидроксид алюминия, сапонин, DEAE-декстран, нейтральные масла (такие как миглиол), растительные масла (такие как арахисовое масло), липосомы, полиолы Pluronic®, система адъюванта Ribi (см., например, GB-A-2189141), или интерлейкины, особенно, стимулирующие клеточно-медиируемый иммунитет. Альтернативный адъювант, состоящий из экстрактов Amycolata, рода бактерий порядка Actinomycetales, был описан в патенте США № 4877612. В дополнение к этому, имеются коммерчески доступные фирменные смеси адъювантов. Используемый адъювант зависит, частично, от субъекта-реципиента. Количество адъюванта для введения зависит от типа и размеров субъекта. Оптимальные дозировки легко определяются обычными способами.

Композиция вакцины необязательно включает совместимые с вакциной фармацевтически приемлемые (т.е. стерильные и нетоксичные) жидкие, полутвердые или твердые разбавители, которые служат фармацевтическими носителями, эксципиентами или средами. Используется любой разбавитель, известный специалистам. Типичные примеры разбавителей включают, без ограничений, полиоксиэтиленсорбитан монолаурат, стеарат магния, метил- и пропилгидроксибензоат, тальк, альгинаты, крахмалы, лактозу, сахарозу, декстрозу, сорбит, маннит, аравийскую камедь, фосфат кальция, минеральное масло, масло какао и масло купуасу.

Композиция вакцины упаковывается в формы, удобные для доставки. Композиции помещают в капсулу, таблетку в виде капсулы, саше, облатку, желатиновый, бумажный или другой контейнер. Такие формы для доставки являются предпочтительными, когда они совместимы с введением иммуногенной композиции в организм реципиента и, в частности, когда иммуногенная композиция доставляется в виде дозированной лекарственной формы. Дозированные формы упаковывают, напр., в виде таблеток, капсул, суппозиториев, флаконов или облаток.

Изобретение включает способы индуцирования иммунологического ответа у субъекта, в том числе антител OspA у млекопитающего-хозяина, включающие введение эффективного количества композиций OspA, описанных тут. Аналогично, изобретение включает способы профилактики или лечения инфекции Borrelia или лаймской болезни у субъекта, включающие стадию введения субъекту эффективного количества композиций вакцины, описанных тут.

Композиция вакцины вводится субъекту, иммунизация которого проводится, любым обычным способом, как детально описано выше. В определенных аспектах, композицию вводят в виде разовой дозы или множества доз на протяжении периода времени (как описано более подробно ниже).

Дозировка композиций химерного OspA/Способы индуцирования иммунологического ответа

Пригодная для введения доза иммуногенной композиции или композиции вакцины будет меняться в зависимости от различных факторов, модифицирующих действие лекарственных средств, напр. возраста, состояния, веса тела, пола и режима питания субъекта, тяжести любой инфекции, времени введения, способа введения и других клинических факторов.

В некоторых аспектах, составы или композиции по изобретению вводятся с помощью начальной ударной дозы с последующей доставкой бустер-доз по истечении периода времени. В определенных аспектах, композиции по изобретению вводятся с помощью начальной ударной дозы с последующей непрерывной инфузией для поддержания терапевтических уровней готовой лекарственной формы в циркуляции. В конкретных аспектах, иммуногенные композиции или композиции вакцины по изобретению вводятся по схеме вакцинации через различные периоды времени. В некоторых аспектах, вакцинация проводится по схеме быстрой иммунизации для людей, совершающих поездки в регионы, подверженные инфекции Borrelia. В качестве другого примера, состав или композицию по изобретению вводят в виде разовой дозы. Рядовые специалисты в данной области техники могут легко оптимизировать эффективные дозы и графики введения, определяемые добросовестной медицинской практикой и клиническим состоянием индивидуума. Частота доз зависит от фармакокинетических параметров агентов и пути введения.

Рецептура фармацевтической композиции определяется квалифицированным специалистом в данной области техники в зависимости от пути введения и желательной дозы. См., например, Remington's Pharmaceutical Sciences, 18th Ed. (1990, Mack Publishing Co., Easton, PA 18042) pages 1435-1712, описание которого включено сюда в качестве ссылки. Такие композиции, в некоторых случаях, влияют на физическое состояние, стабильность, скорость высвобождения in vivo и скорость клиренса in vivo введенной композиции. В зависимости от пути введения, пригодную дозу рассчитывают, в конкретных аспектах, с учетом веса тела, площади поверхности тела или размера органа. В некоторых аспектах, пригодные дозы устанавливают с помощью общепризнанных анализов для определения уровней доз в крови в сочетании с соответствующими данными доза-реакция. В определенных аспектах, измеряют титр антитела у индивидуума для определения оптимальной дозы и схемы введения. Конечная схема введения дозы будет определяться лечащим врачом или терапевтом, с учетом различных факторов, модифицирующих действие фармацевтических композиций, напр., специфической активности композиции, восприимчивости субъекта, возраста, состояния, веса тела, пола и режима питания субъекта, тяжести какой-либо инфекции или злокачественного состояния, времени введения и других клинических факторов. При проведении исследований будет появляться дополнительная информация, касающаяся пригодных уровней доз и продолжительности лечения для профилактики и/или лечения релевантных состояний.

В определенных аспектах, иммуногенная композиция или композиция вакцины OspA содержит любую дозу молекул нуклеиновой кислоты (кислот) или полипептида (полипептидов) OspA, достаточную для того, чтобы вызвать иммунный ответ у субъекта. Эффективное количество иммуногенной композиции или композиции вакцины OspA для терапевтического использования будет зависеть, например, от терапевтического контекста и целей. Квалифицированному специалисту в данной области техники будет понятно, что, таким образом, соответствующие уровни доз для вакцинации или лечения будут различаться, в зависимости, частично, от доставляемой молекулы, показания для использования молекулы (молекул) OspA, пути введения и размеров (веса тела, поверхности тела или размера органа) и состояния (возраста и общего состояния здоровья) пациента. Соответственно, клинический врач, в некоторых случаях, титрует дозу и модифицирует путь введения для достижения оптимального терапевтического эффекта.

Типичная доза, в различных аспектах, находится в интервале значений от примерно 0,1 мкг/кг до примерно 100 мг/кг или более, в зависимости от вышеуказанных факторов. В других вариантах воплощения, доза может составлять от 0,1 мкг/кг до примерно 100 мг/кг; или от 1 мкг/кг до примерно 100 мг/кг; или от 5 мкг/кг до примерно 100 мг/кг. В качестве примера, доза полипептида OspA, пригодная для использования по настоящему изобретению, содержит приблизительно 10 мкг/мл, 20 мкг/мл, 30 мкг/мл, 40 мкг/мл, 50 мкг/мл, 60 мкг/мл, 70 мкг/мл, 80 мкг/мл, 90 мкг/мл, 100 мкг/мл, 110 мкг/мл, 120 мкг/мл, 130 мкг/мл, 140 мкг/мл, 150 мкг/мл, 160 мкг/мл, 170 мкг/мл, 180 мкг/мл, 190 мкг/мл, 200 мкг/мл, 210 мкг/мл, 220 мкг/мл, 230 мкг/мл, 240 мкг/мл, 250 мкг/мл, 260 мкг/мл, 270 мкг/мл, 280 мкг/мл, 290 мкг/мл, 300 мкг/мл, 320 мкг/мл, 340 мкг/мл, 360 мкг/мл, 380 мкг/мл, 400 мкг/мл, 420 мкг/мл, 440 мкг/мл, 460 мкг/мл, 480 мкг/мл, 500 мкг/мл, 520 мкг/мл, 540 мкг/мл, 560 мкг/мл, 580 мкг/мл, 600 мкг/мл, 620 мкг/мл, 640 мкг/мл. В конкретных аспектах, типичная доза содержит от 0,1 до 5,0 мл на субъекта. В более конкретных аспектах, типичная доза содержит от 0,2 до 2,0 мл на субъекта. В определенных аспектах, доза составляет от 0,5 до 1,0 мл на субъекта.

Частота введения доз будет зависеть от фармакокинетических параметров молекулы OspA в используемой композиции. Типично, клинический врач будет вводить композицию до достижения дозы, обеспечивающей желательный эффект. Композиция, в различных аспектах, вводится поэтому в виде разовой дозы, или в виде двух или более доз (которые могут содержать одинаковое или разное количество желательных молекул) со временем, или в виде непрерывной инфузии с помощью имплантированного приспособления или катетера. Дополнительное уточнение соответствующей дозы выполняется в повседневной практике рядовыми специалистами в данной области техники и не выходит за пределы выполняемых ими повседневных работ. Требуемые дозы часто уточняют путем использования соответствующих данных доза-реакция, которые получают в обычном порядке.

Наборы

Как дополнительный аспект, изобретение включает наборы, содержащие одну или более фармацевтических композиций для введения полипептида (полипептидов) OspA субъекту, упакованные так, чтобы облегчить их использование для введения субъектам.

В конкретном варианте воплощения, изобретение включает наборы для приготовления устройства для введения разовой дозы. Каждый наборы, в различных аспектах, содержит первый контейнер с сухим белком и второй контейнер с водной композицией. В объем настоящего изобретения также входят наборы, содержащие одно- и многокамерные предварительно наполненные шприцы (напр., шприцы для жидкостей и лиошприцы).

В другом варианте воплощения, такой набор включает фармацевтическую композицию, описанную тут (напр., композицию, содержащую терапевтический белок или пептид), упакованную в контейнер, такой как герметически закрытая бутылка или сосуд, с прикрепленным к контейнеру или входящим в состав упаковки ярлыком, описывающим использование соединения или композиции для практической реализации способа. В одном варианте воплощения, фармацевтическая композиция упакована в контейнер так, чтобы объем свободного пространства в контейнере (напр., количество воздуха между жидкой композицией и верхушкой контейнера) был очень маленьким. Предпочтительно, объем свободного пространства является пренебрежимо малым (т.е. почти отсутствует).

В одном аспекте, набор содержит первый контейнер, содержащий терапевтическую композицию белка или пептида, и второй контейнер, содержащий физиологически приемлемый раствор для восстановления композиции. В одном аспекте, фармацевтическая композиция упакована в виде дозированной лекарственной формы. Набор необязательно дополнительно включает приспособление, пригодное для введения фармацевтической композиции определенным путем введения. В некоторых аспектах, набор содержит ярлык, описывающий использование фармацевтических композиций.

Каждая публикация, патентная заявка, патент и другие первоисточники, упоминаемые в данном описании, целиком включены сюда в качестве ссылок в степени, не противоречащей целям данного описания.

Следует понимать, что примеры и варианты воплощения, описанные тут, приведены только с иллюстративными целями, и что квалифицированные специалисты в данной области техники смогут предложить на их основе различные модификации или изменения, которые должны считаться входящими в сущность и границы данной заявки и в объем приложенной формулы изобретения. Все публикации, патенты и патентные заявки, упоминаемые тут, настоящим по существу целиком включены сюда в качестве ссылок.

ПРИМЕРЫ

Дополнительные аспекты и детали изобретения будут понятны из следующих примеров, которые должны рассматриваться как иллюстративные, а не ограничительные.

Пример 1

Анализ последовательности OspA европейских штаммов Borrelia burgdorferi sensu lato (молекулярная эпидемиология) для определения рецептуры композиции вакцины OspA

Целью данных исследований было определение пригодной рецептуры композиции вакцины OspA лаймской болезни для Европы. Исследования были основаны на анализе последовательности гена OspA (молекулярная эпидемиология) из большой и разнообразной коллекции штаммов B. burgdorferi sensu lato, которая адекватно представляет обширный географический регион Европы, различных клинических синдромов, ассоциированных с болезнью, и каждого из трех патогенных геновидов (B. afzelii, B. garinii и B. burgdorferi ss), ассоциированных с лаймской болезнью. Лаймская болезнь вызывается видом Borrelia burgdorferi sensu lato, оторый включает в общей сложности 13 геновидов, три из которых (B. afzelii, B. garinii и B. burgdorferi ss) признаны патогенными для человека.

В начале были проведены крупномасштабные эпидемиологические исследования (см. Таблицу 3 ниже), в которых были проанализированы штаммы Borrelia burgdoferi sensu lato от пациентов с лаймской болезнью (и от клещей) из 21 европейской страны. Было изучено в общей сложности 553 изолята европейских Borrelia, собранных в 16 европейских странах. Каждый вид определяли способом ПЦР с использованием наборов праймеров, специфических по отношению к генам 16s rРНК каждого вида.

Изоляты каждого из трех видов Borrelia, которые, как известно, вызывают у человека лаймскую болезнь в Европе были хорошо представлены: B. afzelii (n=309, 55,9%), B. burgdorferi sensu stricto (n=67, 12,1%) и B. garinii (n=173, 31,3%). Из 359 человеческих изолятов, 56,8% принадлежали к B. afzelii, и B. afzelii был преобладающим видом, определенным в человеческих изолятах в большинстве регионов. Аналогично, B. afzelii был выделен из 54,1% изолятов клещей. B. burgdorferi s.s. был выделен из 11,7% человеческих штаммов и 12,9% клещевых изолятов. B. burgdorferi s.s. был выделен из человеческих изолятов из юго-восточной Европы, а именно, Италии, Венгрии, Словении и Австрии. Штаммы B. garinii были выделены из 30,4% человеческих изолятов и 33% изолятов клещей. Штаммы B. garinii, выделенные у людей и клещей, были получены из большей части географических регионов по всей Европе. Данные этих исследований хорошо коррелируют с данными, содержащимися в других европейских исследованиях, и позволяют предположить, что изученная коллекция изолятов представляет точную картину лаймской болезни в Европе.

Секвенирование OspA проводилось для определения оптимальной рецептуры композиции вакцины для Европы. На основании этих данных, вакцина, включающая типы OspA 1-6, будет охватывать 98,1% штаммов и 96,7% случаев инвазивного заболевания. Результаты эпидемиологических исследований европейских изолятов Borrelia показывают, что вакцина на основе типов OspA 1, 2, 3, 4, 5 и 6 будет обеспечивать в Европе теоретический охват 98% случаев лаймской болезни и 96,7% инвазивных изолятов нейроборрелиоза.

Таблица 3
Результаты эпидемиологических исследований
Тип OspA Человеческие изоляты Изоляты инвазивных случаев болезни Уровень охвата вакцины в целом1 Уровень охвата вакцины инвазивной болезни2
B. afzelii тип 2 56,8% (204) 3% (7) 56,8 % 11,7%
B. b s.s. тип 1 11,7% (42) 17% (7) 68,5% 23,3%
B. garinii тип 6 15,9% (57) 40% (23) 84,4% 61,7%
B. garinii тип 5 7,2% (26) 35% (9) 91,6% 76,7%
B. garinii
тип 4
4,5% (16) 44% (7) 96,1% 88,3%
B. garinii тип 3 2,0% (7) 71% (5) 98,1% 96,7%
B. garinii тип 7 0,8% (3) 67% (2) 98,9% 100%
B. spielmanii 1,1% (4) 0% 100%

1 Прогнозируемый уровень охвата вакцины на основании количества изолятов; итоговые значения являются кумулятивными.

2 Прогнозируемый уровень охвата вакцины изолятов случаев нейроборрелиоза; итоговые значения являются кумулятивными.

Таким образом, вакцина, содержащая три новых рекомбинантных OspA (1/2, 6/4 и 5/3), каждый из которых представляет 2 серотипа OspA, сохраняет ключевые структурные элементы, необходимые для защиты против всех 6 распространенных серотипов OspA (1-6), ассоциированных с лайм-боррелиозом в Европе и против единственного серотипа OspA, ассоциированного с лайм-боррелиозом в США.

Включение конструкта OspA 5/3, представляющего серотипы OspA 5 и 3 B. garinii (вместе с серотипами OspA 1/2 и 6/4), должно обеспечивать защиту против 98,1% случаев болезни и 96,7% инвазивных изолятов. Можно ожидать, что вакцина без OspA 5/3 будет защищать только от приблизительно 88,9% случаев болезни и только приблизительно 73,4% инвазивных случаев болезни. Таким образом, вакцина, содержащая все шесть серотипов, является более эффективной для профилактики лаймской болезни, чем вакцина с лишь четырьмя серотипами.

Пример 2

Стратегия конструирования синтетических генов OspA, кодирующих липидированный OspA

Целью исследований было получение липидированных химерных конструктов OspA из нескольких штаммов Borrelia для приготовления вакцины, которая защищала бы реципиента от лаймской болезни, вызываемой любыми из таких нескольких штаммов Borrelia. Общая стратегия представлена на Фиг. 1 и описана ниже.

Для каждого нового гена OspA было синтезировано четыре набора олигонуклеотидов размером 30-60 оснований. Каждый набор олигонуклеотидов состоял из 8-12 комплементарных перекрывающихся олигонуклеотидов. Олигонуклеотиды из каждого набора отжигают вместе, в отдельных экспериментах, для получения двухцепочечных фрагментов ДНК со специфическими сайтами распозначания рестрикционных ферментов на обоих концах, т.е. фрагментов N-H (Nde I - Hind III), H-K (Hind III - Kpn I), K-E (Kpn I - EcoR I) и E-B (EcoR I - BamH I). Каждый из четырех фрагментов независимо клонируют в pUC18, разрезают соответствующими рестрикционными ферментами и трансформируют в хозяина E. coli DH5α, после чего проверяют последовательность клонированного фрагмента.

Штамм E. coli DH5α [генотип: end A1 hsdR17 (rk-mk+) supE44 thi-1 recA1 gyrA (Nalr) relA1 Δ(lacZYA-argF)U169 deoR (Φ80dlacΔ(lacZ)M15] (Gibco BRL) используют для всех промежуточных стадий клонирования. Этот штамм получен из штамма E. coli K12, одного из наиболее широко используемых хозяев в генной инженерии. Штамм является amp- для обеспечения возможности селекции трансформантов с помощью векторов, содержащих ген резистентности к ампициллину (amp). E. coli HMS174(DE3) была выбрана в качестве хозяина для экспрессии. Клетки-хозяева E. coli HMS174(DE3) [генотип: F- recA1 hsdR (rk12- mk12+) RifR (DE3)] (Novagen) использовались для конечных стадий клонирования. Штамм является kan- для обеспечения возможности селекции трансформантов с помощью векторов, содержащих ген резистентности к канамицину (kan).

pUC18 (Gibco BRL, Basel, Switzerland) используют в качестве клонирующего вектора для всех промежуточных стадий, потому что генетические манипуляции и секвенирование с этой плазмидой проще выполнять, чем с pET30a. Основными признаками являются, в частности, генный фрагмент lacZ, кодирующий альфа-пептид LacZ, пары оснований от 149 до 469 (lac-промотор от пары оснований 507), ген bla, кодирующий детерминанту резистентности к ампициллину, пары оснований от 1629 до 2486 (промотор bla от пары оснований 2521), точка начала репликации от пары оснований 867 и сайты множественного клонирования, пары оснований от 185 до 451 (Фиг. 12).

pET30a (Novagen) используют в качестве экспрессионного вектора для окончательной вставки полного гена OspA. В векторах pET гены клонируются под контролем промотора T7 и экспрессия индуцируется путем обеспечения источника РНК-полимеразы T7 в клетке-хозяине (экспрессия не происходит до тех пор, пока не обеспечен источник РНК-полимеразы T7). Основными признаками являются ген, кодирующий резистентность к канамицину (kan) от пары оснований 4048 до 4860, ген lacI, пары оснований 826-1905, точка начала репликации F1, пары оснований 4956-5411, и сайты множественного клонирования, пары оснований от 158 до 346 (Фиг. 13).

Четыре фрагмента, необходимые для приготовления полноразмерного гена OspA, были выделены с помощью набора DNA miniprep. ДНК выделяют из каждого из четырех клонов с использованием тех же рестрикционных ферментов, что и используемые для начальной стадии клонирования. Фрагменты ДНК очищают и лигируют вместе с ДНК pUC18, разрезанной Nde I и BamH I, и трансформируют в DH5α-компетентные клетки E. coli. Полноразмерный ген OspA, клонированный в pUC18, секвенируют для подтверждения того, что на этой стадии не было внесено ошибок.

Ген OspA затем субклонируют в экспрессионный вектор pET-30a с помощью рестрикционных ферментов Nde I и BamH I и трансформируют в хозяина E. coli HMS 174(DE3). В векторе pET30a, ген OspA контролируется промотором T7 бактериофага.

Три синтетических гена OspA были сконструированы так, чтобы они кодировали молекулы OspA с защитными эпитопами из OspA серотипов 1 и 2 (lipB sOspA 1/2251), OspA серотипов 6 и 4 (lipB sOspA 6/4) и OspA серотипов 5 и 3 (lipB sOspA 5/3) Borrelia. Первичные аминокислотные последовательности этих молекул (SEQ ID NOS: 2, 4 и 6, соответственно) приведены на Фигурах 2-8 и описаны тут, причем в их конструкцию включено полное описание основных признаков.

Олигонуклеотиды для конструкта lipB sOspA 1/2 были синтезированы собственными силами на синтезаторе ABI 394 ДНК/РНК. Олигонуклеотиды для конструктов lipB sOspA 5/3 и lipB sOspA 6/4 были приобретены у GenXpress (Wiener Neudorf, Austria) и очищены способом ВЭЖХ.

Таблица 4
Олигонуклеотиды для генных фрагментов lipB sOspA 1/2*
Название Последовательность (5' - 3') L S SEQ ID NO
Фрагмент Hin dIII - Kpn I
NH1 TATGCGTCTGTTGATCGGCTTTGCTCTGGCGCTGGCTCTGATCGG 45 C 59
NH2 CTGCGCACAGAAAGGTGCTGAGTCTATTGGTTCCGTTTCTGTAGATCTGC 50 C 60
NH3 CCGGTGAAATGAAGGTTCTGGTGAGCAAAGAAAAAGACAAGAACGGCAAG 50 C 61
NH4 TACGATCTCATCGCAACCGTCGACAAGCTGGAGCTGAAAGGTACTTCTGA 50 C 62
NH5 TAAAAACAACGGCTCTGGTGTGCTGGAGGGCGTCAAAACTAACAAGAGCAAAGTAA 56 C 63
NH6 AGCTTTACTTTGCTCTTGTTAGTTTTGACGCCCTCCAGCA 40 C' 64
NH7 CACCAGAGCCGTTGTTTTTATCAGAAGTACCTTTCAGCTCCAGCTTGTCG 50 C' 65
NH8 ACGGTTGCGATGAGATCGTACTTGCCGTTCTTGTCTTTTTCTTTGCTCAC 50 C' 66
NH9 CAGAACCTTCATTTCACCGGGCAGATCTACAGAAACGGAACCAATAGACT 50 C' 67
NH10 CAGCACCTTTCTGTGCGCAGCCGATCAGAGCCAGCGCCAGAGCAAAGCCGATCAACAGACGCA 63 C' 68
Фрагмент Hin dIII - Kpn I
HK1 AGCTTACGATCTCTGACGATCTCGGTCAGACCAC 34 C 69
HK2 GCTGGAAGTTTTCAAAGAGGATGGCAAGACCCTCGTGTCCAAAAAAGTAA 50 C 70
HK3 CTTCCAAAGACAAGTCCTCTACGGAAGAAAAATTCAACGAAAAAGGTGAG 50 C 71
HK4 GTGTCTGAAAAGATCATCACCATGGCAGACGGCACCCGTC 40 C 72
HK5 TTGAATACACCGGTATTAAAAGCGATGGTAC 31 C 73
HK6 CATCGCTTTTAATACCGGTGTATTCAAGACGGGTGCCGTCTGCCAT 47 C' 74
G
HK7 GTGATGATCTTTTCAGACACCTCACCTTTTTCGTTGAATTTTTCTTCCGT 50 C' 75
HK8 AGAGGACTTGTCTTTGGAAGTTACTTTTTTGGACACGAGGGTCTTGCCAT 50 C' 76
HK9 CCTCTTTGAAAACTTCCAGCGTGGTCTGACCGAGATCGTCAGAGATCGTA 40 C' 77
Фрагмент Kpn I - EcoR I
KE1 CGGTAAAGCGAAATATGTTCTGAAAAACTTCACTCTGGA 39 C 78
KE2 AGGCAAAGTGGCTAATGATAAAACCACCTTGGAAGTCAAGGAAGGCACCG 50 C 79
KE3 TTACTCTGAGCATGAATATCTCCAAATCTGGTGAAGTTTCCGTTGAACTG 50 C 80
KE4 AACGACACTGACAGCAGCGCTGCGACTAAAAAAACTGCAGCGTGG 45 C 81
KE5 AATTCCACGCTGCAGTTTTTTTAGTCGCA 29 C' 82
KE6 GCGCTGCTGTCAGTGTCGTTCAGTTCAACGGAAACTTCACCAGATTTGGA 50 C' 83
KE7 GATATTCATGCTCAGAGTAACGGTGCCTTCCTTGACTTCCAAGGTGGTTT 50 C' 84
KE8 TATCATTAGCCACTTTGCCTTCCAGAGTGAAGTTTTTCAGAACATATTTCGCTTTACCGGTAC 63 C' 85
Фрагмент EcoR I - BamH I
EB1 AATTCCAAAACTTCTACTTTAACCATTAGCGTTAACAGCAAAAAA 45 C 86
EB2 ACTACCCAGCTGGTGTTCACTAAACAAGACACGATCACTGTGCAGAAATA 50 C 87
EB3 CGACTCCAACGGCACCAACTTAGAAGGCACGGCAGTCGAAATTAAAACCC 50 C 88
EB4 TTGATGAACTGAAAAACGCGCTGAAATAAGCTGAGCG 40 C 89
EB5 GATCCGCTCAGCTTATTTCAGCGCGTTTTTCAGTTCATCAAGGGTTTTAATTTCGACTGCC 60 C' 90
EB6 GTGCCTTCTAAGTTGGTGCCGTTGGAGTCGTATTTCTGCACAGTGATCGT 50 C' 91
EB7 GTCTTGTTTAGTGAACACCAGCTGGGTAGTTTTTTTGCTGTTAACG 50 C' 92
CTAA
EB8 TGGTTAAAGTAGAAGTTTTGG 21 C' 93

* Замена отдельной аминокислоты производилась способом ПЦР, конструкт до внесения изменений назывался lipB sOspA 1/2, и lipB sOspA 1/2251 - после внесения изменений.

L - Длина олигонуклеотида в основаниях

S - Нить: C - кодирующая, или C' - комплементарная

Таблица 5
Олигонуклеотиды для генных фрагментов lipB sOspA 5/3
Название Последовательность (5' - 3') L S SEQ ID NO
Фрагмент Nde I - Hin dIII
N51 TATGCGTCTGTTGATCGGCTTTGCTTTGGCGCTGGCTTTAATCGGCTG 48 C 94
N52 TGCACAGAAAGGTGCTGAGTCTATTGGTTCCGTTTCTGTAGATCTGCCCG 50 C 95
N53 GGGGTATGAAAGTTCTGGTAAGCAAAGAAAAAGACAAAAACGGTAAATAC 50 C 96
N54 AGCCTGATGGCAACCGTAGAAAAGCTGGAGCTTAAAGGCACTTCTGATAA 50 C 97
N55 AAACAACGGTTCTGGCACCCTGGAAGGTGAAAAAACTAACAAAAGCAAAGTAA 53 C 98
N56 AGCTTTACTTTGCTTTTGTTAGTTTTTTCACCTTCCA 37 C' 99
N57 GGGTGCCAGAACCGTTGTTTTTATCAGAAGTGCCTTTAAGCTCCAGCTTT 50 C' 100
N58 TCTACGGTTGCCATCAGGCTGTATTTACCGTTTTTGTCTTTTTCTTTGCT 50 C' 101
N59 TACCAGAACTTTCATACCCCCGGGCAGATCTACAGAAACGGAACCAATAG 50 C' 102
N510 ACTCAGCACCTTTCTGTGCACAGCCGATTA 30 C' 103
N511 AAGCCAGCGCCAAAGCAAAGCCGATCAACAGACGCA 36 C' 104
Фрагмент Hin dIII - Kpn I
H51 AGCTTACTATTGCTGAGGATCTGAGCAAAACCACCTTTGAAATCTTC 47 C 105
H52 AAAGAAGATGGCAAAACTCTGGTATCTAAAAAAGTAACCCTGAAAGACAA 50 C 106
H53 GTCTTCTACCGAAGAAAAATTCAACGAAAAGGGTGAAATC 40 C 107
H54 TCTGAAAAAACTATCGTAATGGCAAATGGTAC 32 C 108
H55 AAGGTGGTTTTGCTCAGATCCTCAGCAATAGTA 33 C' 109
H56 AGAGTTTTGCCATCTTCTTTGAAGATTTCA 30 C' 110
H57 ATTTTTCTTCGGTAGAAGACTTGTCTTTCAGGGTTACTTTTTTAGATACC 50 C' 111
H58 CATTTGCCATTACGATAGTTTTTTCAGAGATTTCACCCTTTTCGTTGA 48 C' 112
Фрагмент Kpn I - EcoR I
K51 CCGTCTGGAATACACCGACATCAAAAGCGATAAAACCGGCAAAGCTAA 48 C 113
K52 ATACGTTCTGAAAGACTTTACTCTGGAAGGCACTCTGGCTGCTGACGGCA 50 C 114
K53 AAACCACTCTGAAAGTTACCGAAGGCACTGTTACTCTGAGCATGAACATT 50 C 115
K54 TCTAAATCCGGCGAAATCACCGTTGCACTGGATGACACTGACTCTAGCGG 50 C 116
K55 CAATAAAAAATCCGGCACCTGGGATTCTGATACTTCTACTTTAACCATTA 50 C 117
K56 GCAAAAACAGCCAGAAAACTAAACAGCTGGG 31 C 118
K57 GCTTTTGATGTCGGTGTATTCCAGACGGGTAC 31 C' 119
K58 CCTTCCAGAGTAAAGTCTTTCAGAACGTATTTAGCTTTGCCGGTTTTATC 50 C' 120
K59 CAGTGCCTTCGGTAACTTTCAGAGTGGTTTTGCCGTCAGCAGCCAGAGTG 50 C' 121
K510 CAGTGCAACGGTGATTTCGCCGGATTTAGAAATGTTCATGCTCAGAGTAA 50 C' 122
K511 TCAGAATCCCAGGTGCCGGATTTTTTATTGCCGCTAGAGTCAGTGTCATC 50 C' 123
K512 AATTCCCAGCTGTTTAGTTTTCTGGCTGTTTTTGCTAATGGTTAAAGTAGAAGTA 55 C' 124
Фрагмент EcoR I - BamH I
E51 AATTCAAACAGCTGGTATTCACCAAAGAAAACACTATCACCGTAC 125
E52 AGAACTATAACCGTGCAGGCAATGCGCTGGAAGGCAGCCC 45 C 126
E53 GGCTGAAATTAAAGATCTGGCAGAGCTGAAAGCCGCTTTGAAATAAGCTGAGCG 40 C 127
E54 GATCCGCTCAGCTTATTTCAAAGCGGCT 54 C 128
E55 TTCAGCTCTGCCAGATCTTTAATTTCAGCCGGGCTGCCTTCCAGCGCATT 28 C' 129
E56 GCCTGCACGGTTATAGTTCTGTACGGTGATAGTGTTTTCTTTGGTGAATACCAGCTGTTTG 50 C' 130

L - Длина олигонуклеотида в основаниях

S - Нить: C - кодирующая, или C' - комплементарная

Таблица 6
Олигонуклеотиды для генных фрагментов lipB sOspA 6/4
Название Последовательность (5' - 3') L S SEQ ID NO
Фрагмент Nde I - Hin dIII
KNH1 TATGCGTCTGTTGATCGGCTTTGCTCTGGCGCTGGCTCTGATCGGCTG 131
KNH2 CGCACAGAAAGGTGCTGAGTCTATTGGTTCCGTTTCTGTAGATCTGCCCG 48 C 132
KNH3 GTGGCATGACCGTTCTGGTCAGCAAAGAAAAAGACAAAAACG 50 C 133
KNH4 GTAAATACAGCCTCGAGGCGACCGTCGACA 42 C 134
KNH5 AGCTTGTCGACGGTCGCCTCGAGGCTGTATTTACCGTTTTTGTCTTTTTCTTTGCT 30 C 135
KNH6 GACCAGAACGGTCATGCCACCGGGCAGATCTACAGAAACG 56 C' 136
KNH7 GAACCAATAGACTCAGCACCTTTCTGTGCGCAGCCGATCAGAGCCAG 40 C' 137
CGC
KNH8 CAGAGCAAAGCCGATCAACAGACGCA 50 C' 138
Фрагмент Hin dIII - Kpn I
KHK1 AGCTTGAGCTGAAAGGCACCTCTGATAAAAACAACGGTTCCGGCACCCTG 50 C 139
KHK2 GAAGGTGAAAAAACTAACAAAAGCAAAGTGAAACTGACCATTGCTGAT 48 C 140
KHK3 GACCTCAGCCAGACCAAATTCGAAATTTTCAAAGAAGATGCCAAAACCTT 50 C 141
KHK4 AGTATCCAAAAAAGTGACCCTGAAAGACAAGTCCTCTACCGAAGAAAAAT 50 C 142
KHK5 TCAACGAAAAGGGTGAAACCTCTGAAAAAACCATCGTAATGGCAAATGGTAC 52 C 143
KHK7 CATTTGCCATTACGATGGTTTTTTCAGA 28 C' 144
KHK8 GGTTTCACCCTTTTCGTTGAATTTTTCTTCGGTAGAGGAC 40 C' 145
KHK9 TTGTCTTTCAGGGTCACTTTTTTGGATACTAAGGTTTTGGCATCTTCTTT 50 C' 146
KHK10 GAAAATTTCGAATTTGGTCTGGCTGAGGTCATCAGCAATGGTCAGTTTCA 50 C' 147
KHK11 CTTTGCTTTTGTTAGTTTTTTCACCTTCCAGGGTGCCGGA 40 C' 148
KHK12 ACCGTTGTTTTTATCAGAGGTGCCTTTCAGCTCA 34 C' 149
Фрагмент Kpn I - EcoR I
KKE1 CCGTCTGGAATACACCGACATCAAAAGCGATGGCTCCGGCAAAGCCAA 48 C 150
KKE2 ATACGTTCTGAAAGACTTCACCCTGGAAGGCACCCTCGCTGCCGACGG 48 C 151
KKE3 CAAAACCACCTTGAAAGTTACCGAAGGCACTGTTGTTTTAAG 42 C 152
KKE4 CATGAACATCTTAAAATCCGGTGAAATCACCGTTGCGCTG 40 C 153
KKE5 GATGACTCTGACACCACTCAGGCCACTAAAAAAACCGGCAAATGGGATTC 50 C 154
KKE6 TAACACTTCCACTCTGACCATCAGCGTG 28 C 155
KKE7 AATTCACGCTGATGGTCAGAGTGGAAGTGTTAGAATCCCATTTGCCG 47 C' 156
KKE8 GTTTTTTTAGTGGCCTGAGTGGTGTCAGAGTCATCCAGCGCAACGGTGATTTCAC 55 C' 157
KKE9 CGGATTTTAAGATGTTCATGCTTAAAACAACAGTGCCTTCGGTAACTTTC 50 C' 158
KKE10 AAGGTGGTTTTGCCGTCGGCAGCGAGGGTGCCTTCCAGGG 40 C' 159
KKE11 TGAAGTCTTTCAGAACGTATTTGGCTTTGCCGGAGCCATC 40 C' 160
KKE12 GCTTTTGATGTCGGTGTATTCCAGACGGGTAC 32 C' 161
Фрагмент EcoR I - BamH I
KEB1 AATTCCAAAAAAACTAAAAACATCGTGTTCACCAAAGAAGACACCATCACCG 162
KEB2 TCCAGAAATACGACTCTGCGGGCACCAACCTCGAAGGCAACGCAGTCGAA 52 C 163
KEB3 ATCAAAACCCTGGATGAACTGAAAAACGCTCTGAAATAAGCTGAGCG 50 C 164
KEB4 GATCCGCTCAGCTTATTTCAGAGCGTTTTTCAGTTCATCCAGGGTTTTGATTT
CGACTGCGTTGCCTTCGA
47 C 165
KEB5 GGTTGGTGCCCGCAGAGTCGTATTTCTGGACGGTGATGGTGTCTTCTTTG 71 C' 166
KEB6 GTGAACACGATGTTTTTAGTTTTTTTGG 50 C' 167
L - Длина олигонуклеотида в основаниях
S - Нить: C - кодирующая, или C' - комплементарная

Приготовление компетентных клеток E. coli. Используют одну колонию для инокуляции 5 мл модифицированного бульона LB (5,5 г NaCl, 5 г экстракта дрожжей, 10 г соевого пептона, который не был получен от животного или генетически модифицированного растительного источника - на литр воды). Культуру инкубируют, пока она не помутнеет, после чего культуру разводят до объема 25 мл предварительно подогретым модифицированным бульоном LB. Культуру инкубируют далее до достижения значения OD600нм в интервале от 0,2 до 0,6 (40-60 мин) и разводят до объема 125 мл, переносят в колбу на 500 мл и инкубируют до достижения OD600нм, равного 0,6. Культуру быстро охлаждают осторожным встряхиванием в течение 5 мин на ледяной бане и клетки осаждают центрифугированием (центрифуга Beckman, 4000 об/мин в течение 10 мин), осторожно промывают буфером TfBI (Teknova Hollister, CA) (30 мМ K-ацетата, 50 мМ MnCl2, 100 мМ KCL, 10 мМ CaCl2 15% глицерина), ресуспендируют в 5 мл TfBII (10 мМ Na-MOPS, 75 мМ CaCl2, 10 мМ KCL, 15% глицерина) и выдерживают на льду в течение 15 мин. Затем пипеткой берут аликвоты клеток 100 мкл и подвергают быстрому замораживанию непосредственно в сухом льду.

Отжиг олигонуклеотидных смесей для получения фрагментов гена OspA (синтез de novo). Были сконструированы три синтетических гена OspA, кодирующие молекулы OspA с защитными эпитопами из OspA серотипов 1 и 2 (lipB sOspA 1/2), OspA серотипов 6 и 4 (lipB sOspA 6/4) и OspA серотипов 5 и 3 (lipB sOspA 5/3). Для каждого нового гена OspA (липидированного) были синтезированы четыре набора олигонуклеотидов размером 30-60 пар оснований (см. Таблицы 4-6). Фигуры 16-18 изображают оптимизированные по кодонам последовательности каждого из конструктов, выровненные с нуклеотидными последовательностями, расшифрованными из опубликованных последовательностей). Каждый набор олигонуклеотидов состоит из 8-12 комплементарных перекрывающихся олигонуклеотидов. Олигонуклеотиды из каждого набора отжигают вместе, в отдельных экспериментах, для получения двухцепочечных фрагментов ДНК со специфическими сайтами распознания рестрикционных ферментов на обоих концах, т.е. фрагменты N-H (Nde I - Hind III), H-K (Hind III - Kpn I), K-E (Kpn I - EcoR I) и E-B (EcoR I - BamH I).

Лиофилизированные олигонуклеотиды восстанавливают дистиллированной водой, измеряют OD260нм и концентрацию доводят до 10 мкМ. Для каждого фрагмента OspA, 2 мкл каждого из олигонуклеотидов смешивают с 1 мкл T4 полинуклеотидкиназы и буфером T4 ДНК-лигазы (10×) и смесь инкубируют при комнатной температуре в течение 30 минут для обеспечения возможности фосфорилирования олигосоединений (для конструкта lipB sOspA 6/4 эту стадию опускают, поскольку олигосоединения уже фосфорилированы). Смесь нагревают до 95°C в течение 1 минуты (стадия денатурирования) и затем олигосоединения подвергают отжигу, оставляя смесь медленно охлаждаться до комнатной температуры. Подвергнутую отжигу смесь непосредственно используют для лигирования или хранят при -20°C до дальнейшей необходимости.

Клонирование фрагментов гена OspA. Каждый из четырех фрагментов, требуемых для конструирования индивидуального синтетического гена OspA, независимо клонируют в pUC18 и трансформируют в хозяина E. coli DH5α (см. Фигуру 1).

Для каждого нового гена OspA были синтезированы четыре набора олигонуклеотидов размером 30-60 оснований. Каждый набор олигонуклеотидов состоит из 8-12 комплементарных перекрывающихся олигонуклеотидов. Олигонуклеотиды из каждого набора отжигают вместе, в отдельных экспериментах, для получения двухцепочечных фрагментов ДНК со специфическими сайтами распознания рестрикционных ферментов на обоих концах, т.е. фрагменты N-H (Nde I - Hind III), H-K (Hind III - Kpn I), K-E (Kpn I - EcoR I) и E-B (EcoR I - BamH I). Каждый из четырех (4) фрагментов независимо клонируют в pUC18, разрезают соответствующими рестрикционными ферментами и трансформируют в хозяина E. coli DH5α, после чего проверяют последовательность клонированного фрагмента.

Плазмиду ДНК (pUC18) очищают из ночной культуры E. coli (бульон LB) с помощью системы очистки плазмид QIAGEN в соответствии с протоколом производителя. Вектор ДНК затем гидролизуют парами рестрикционных ферментов; Nde I и Hind III, Hind III и Kpn I, Kpn I и EcoR I, EcoR I и BamH I, в соответствии с протоколами производителя. Гидролизованные образцы наносят на 0,8% агарозный гель и электрофоретически разделяют. Линеаризованный вектор ДНК вырезают и элюируют с помощью коммерческого набора для элюирования геля (QIAquick Gel Extraction Kit, Qiagen) в соответствии с протоколом производителя, и лигируют, используя T4 ДНК-лигазу, с отожженной смесью олигонуклеотидов. Продукты лигирования трансформируют в конкурентные клетки E. coli DH5α и трансформанты, содержащие плазмиду, селектируют на агаре LB, содержащем ампициллин (100 мкг/мл).

Присутствие вставки ожидаемого размера в клонирующем векторе, pUC18, подтверждают путем очистки плазмидной ДНК, гидролиза ДНК ферментами, используемыми для клонирования, и анализа фрагментов ДНК электрофорезом на агарозном геле с использованием ранее описанных процедур. Клонированный фрагмент ДНК секвенируют, используя очищенную плазмидную ДНК в качестве ДНК-матрицы и праймеры секвенирования 5'-TCGGGGCTGGCTTAACTATG-3 (SEQ ID NO: 14) и 5'-GCTTCCGGCTCGTAT (SEQ ID NO:15) (которые находятся в векторе pUC18 за пределами сайтов множественного клонирования, п.о. 130-150 и п.о. 530-515, соответственно). Последовательность реакций выполняется на автоматическом секвенаторе (ABI 310). Последовательности редактируют с помощью SequenceEditor и последовательности импортируют в VectorNTI для анализа. Только клоны с правильными последовательностями используют в качестве строительных блоков для конструирования полноразмерных генов OspA.

Для гена lipB sOspA 5/3 используют другую стратегию, поскольку во фрагменте Kpn I - BamH I не удалось найти пригодного уникального внутреннего сайта и аминокислотная последовательность не позволяла использовать внутренний сайт EcoR I (см. Фигуру 14). Сайт Pvu II имеется во фрагменте Kpn I - BamH I, однако в векторе pUC18 присутствует два сайта Pvu II, что означает невозможность прямого клонирования фрагментов в pUC18. Поэтому, олигосоединения для конструктов были сконструированы так, чтобы сайт EcoR I был вставлен вовне и рядом с сайтом Pvu II, позволяя клонировать фрагменты Kpn I - EcoR I и EcoR I - BamH I в pUC18. Последующий гидролиз вставленных фрагментов с помощью Kpn I, EcoR I и BamH I давал фрагменты, которые затем гидролизуют Pvu II. Гидролизованные Pvu II фрагменты (Kpn I - Pvu II и Pvu II - BamH I) затем используют для тройного лигирования с ДНК вектора pUC18, разрезанной Kpn I и BamH I для получения фрагмента Kpn I - BamH I.

Конструирование полноразмерных генов OspA. На следующей стадии, каждый из четырех фрагментов, необходимых для конструирования индивидуального синтетического гена OspA, вырезают из вектора pUC18 и повторно клонируют, за одну стадию, в вектор pUC18 для получения полноразмерного гена OspA (см. Фигуру 1).

Четыре фрагмента, необходимые для приготовления полноразмерных генов, вырезают с помощью набора miniprep ДНК. ДНК, выделенную с использованием одних и тех же рестрикционных ферментов, используют для начальной стадии клонирования. Гидролизованные образцы наносят на агарозный гель и электрофоретически разделяют. ДНК каждого из соответствующих 4 фрагментов вставок вырезают и элюируют с помощью коммерческого набора для элюирования геля (QiaQuick Gel Extraction Kit) в соответствии с протоколом производителя и лигируют, используя T4 ДНК-лигазу, с линеаризованным векторной ДНК, гидролизованной Nde I и BamH I и очищенной с помощью QIAquick Gel Extraction Kit. Лигированную ДНК трансформируют в конкурентные клетки E. coli DH5α и клоны, содержащие плазмиду, селектируют на LB-агаре, содержащем ампициллин (100 мкг/мл). Колонии подвергают скринингу способом ПЦР на присутствие вставок ожидаемого размера (ок. 830 п.о.).

Единичные колонии используют в качестве матричной ДНК в ПЦР-реакциях с использованием 10× буфера (15 мМ Tris-HCl (pH 8,0), 50 мМ KCl, 1,5 мМ MgCl2), 200 мкМ dNTPs, 1,25 ед. Amplitaq ДНК-полимеразы, 400 нМ прямого праймера 5'-TCGGGGCTGGCTTAACTATG-3 (SEQ ID NO: 14) и 400 нМ обратного праймера 5'-GCTTCCGGCTCGTAT (SEQ ID NO: 15). Используют следующие условия ПЦР-реакции: 94°C в течение 5 мин, 35 × (94°C в течение 30 с, 48°C в течение 30 с, 72°C в течение 1 мин 30 с) с последующим вымачиванием при 72°C в течение 5 минут и выдерживанием при 4°C. Продукты ПЦР используют непосредственно или хранят при ≤15°C до дальнейшего использования. Продукты ПЦР анализируют электрофорезом на агарозном геле на присутствие вставок правильного размера (ок. 980 п.о.). Вставки правильного размера секвенируют для подтверждения того, что не было внесено ошибок, т.е. последовательность реакций была проведена с использованием плазмидной ДНК, выделенной (QIAGEN Plasmid Purification kit) из ночных культур (бульон LB для амплификации) и с использованием праймеров секвенирования, фланкирующих сайты клонирования (5'-TCGGGGCTGGCTTAACTATG-3'(SEQ ID NO: 14) и 5'-GCTTCCGGCTCGTATGTTGT-3' (SEQ ID NO: 16), п.о. 130-150 и 530-510, соответственно). Последовательность реакций выполняется с помощью автоматического секвенатора (ABI 310). Последовательности редактируют с помощью SequenceEditor и последовательности импортируют в VectorNTI для анализа.

Субклонирование новых генов OspA в экспрессионный вектор pET30a. После проверки полноразмерного гена OspA в pUC18, гены OspA субклонируют в экспрессионный вектор pET-30a с помощью рестрикционных ферментов NdeI и BamH I и трансформируют в хозяина E. coli HMS 174(DE3).

Miniprep-ДНК из клонов pUC18 с правильными последовательностями гидролизуют с помощью Nde I и BamH I. Аналогично, ДНК вектора pET30a гидролизуют с помощью Nde I и BamH I. Гидролизованные ДНК наносят на агарозный гель и электрофоретически разделяют. Вырезают фрагмент вставки размером приблизительно 830 п.о. и линеаризованный вектор ДНК и очищают, как описано ранее. Вектор и ДНК вставки лигируют, используя T4 ДНК-лигазу, и продукты лигирования трансформируют в конкурентные клетки E. coli HMS174(DE3) (Novagen). Трансформанты высеивают на чашки со средой LB, содержащей канамицин (30 мкг/мл). Единичные колонии подвергают скринингу способом ПЦР с использованием праймеров 5'-TTATGCTAGTTATTGCTCAGCG-3' (SEQ ID NO:17) и 5'-TTCCCCTCTAGAAATAATTTTGT-3' (SEQ ID NO: 18). Продукты ПЦР наносят на агарозный гель и электрофоретически разделяют. Колонии, вырабатывающие продукт правильного размера (ок. 1 т.п.н.) впоследствии используют для получения ночных культур, из которых выделяют miniprep-ДНК с помощью набора для очистки плазмид QIAGEN (QIAGEN Plasmid Purification kit) в соответствии с протоколом производителя. Последовательность снова проверяют (с использованием праймеров 5'-TTATGCTAGTTATTGCTCAGCG-3' (SEQ ID NO: 17) и 5'-TTCCCCTCTAGAAATAATTTTGT-3' (SEQ ID NO:18), п.о. 65-86 и 395-373, соответственно) и селектируют колонии для испытаний экспрессии.

Получение lipB sOspA 1/2251 из lipB sOspA 1/2. Изменяют единичную аминокислоту в конструкте lipB sOspA 1/2, а именно аминокислоту аланин в положении 251 заменяют на остаток аспарагина для усиления иммуногенности. Замену аминокислоты проводят способом ПЦР. Во-первых, проводят ПЦР с внешним прямым праймером и внутренним обратным праймером, получая продукт размером примерно 730 п.о. с внесенной заменой аминокислоты (см. Фигуру 15). Во-вторых, проводят ПЦР с внутренним прямым праймером и внешним обратным праймером, получая продукт размером 100 п.о., содержащий внесенную замену аминокислоты. Два продукта ПЦР, последовательности которых перекрываются, затем используют в качестве матричной ДНК для конечной ПЦР-реакции с внешним прямым и внешним обратным праймерами для получения конечного полноразмерного продукта OspA, содержащего внесенную замену аминокислоты.

Конструкт pET30a используют в качестве источника матричной ДНК. Проводят ПЦР-реакции с 10× буфером [15 мМ Tris-HCl (pH 8,0), 50 мМ KCl, 1,5 мМ MgCl2], 200 мкМ dNTPs, 1,25 ед. Amplitaq ДНК-полимеразы и 400 нМ каждой пары праймеров (пара праймеров 5'-GGA ATT CCA TAT GCG TCT GTT GAT CGG CT (SEQ ID NO: 19) и 5'-TTG GTG CCT GCG GAG TCG (SEQ ID NO:20) и пара праймеров 5'-AAT ACG ACT CCG CAG GCA CC (SEQ ID NO: 21) и 5'-CTG-GGA TCC GCT CAG CTT ATT TCA (SEQ ID NO: 22)). ПЦР-реакции проводят в таких условиях: 94°C в течение 5 мин, 35× (94°C в течение 30 с, 48°C в течение 30 с, 72°C в течение 1 мин 30 с) с последующим вымачиванием при 72°C в течение 5 минут и выдерживанием при 4°C. Реакции дают 2 разных перекрывающихся продукта, и 2 продукта используют в качестве матричной ДНК для третьей ПЦР-реакции с использованием внешних праймеров 5'-GGA ATT CCA TAT GCG TCT GTT GAT CGG CT (SEQ ID NO:19) и 5'-CTG-GGA TCC GCT CAG CTT ATT TCA (SEQ ID NO: 22), включающих сайты рестрикции Nde I и BamH I. Используют условия реакции 94°C в течение 60 с с последующими 35 циклами (30 с при 94°C, 60 с при 49°C, 90 с при 72°C), а затем 72°C в течение 5 мин. Амплифицированный продукт очищают с помощью набора для очистки QiaQuick (Qiagen) в соответствии со спецификацией производителя и продукт гидролизуют с помощью Nde I и BamH I и лигируют в векторную ДНК pET30a, разрезанную Nde I и BamH I. Продукты лигирования трансформируют в конкурентные клетки E. coli DH5α. Трансформанты высеивают на чашки со средой LB, содержащей канамицин (30 мкг/мл). Единичные колонии подвергают скринингу способом ПЦР с использованием праймеров 5'-TTATGCTAGTTATTGCTCAGCG-3' (SEQ ID NO:17) и 5'-TTCCCCTCTAGAAATAATTTTGT-3' (SEQ ID NO: 18). Продукты ПЦР наносят на агарозный гель и электрофоретически разделяют. Колонии, дающие продукт правильного размера (ок. 1 т.п.н.) используют впоследствии для получения ночных культур, из которых выделяют miniprep-ДНК с помощью системы для очистки плазмид QIAGEN в соответствии с протоколом производителя. Последовательность подтверждают (с использованием праймеров 5'-TTATGCTAGTTATTGCTCAGCG-3' (SEQ ID NO: 17) и 5-TTCCCCTCTAGAAATAATTTTGT-3' (SEQ ID NO: 18)) и полученный конструкт трансформируют в компетентные клетки E. coli HMS174(DE3), и полученным позитивным трансформантам было присвоено наименование lipB sOspA 1/2251.

Получение конструктов без лидерной последовательности. Были получены конструкты с лидерной последовательность lipB, в которых липидный фрагмент типично присоединен к амино-концевому цистеиновому остатку. Экспериментальные исследования рекомбинантных липидированных OspA подтвердили присутствие липидного фрагмента. Однако были также получены конструкты, не содержащие лидерной последовательности lipB. Конструкты, не содержащие лидерную последовательность lipB, были приготовлены способом ПЦР амплификации каждого из трех lipB конструктов (в pET30a) с использованием праймеров, выбранных для получения конечного продукт размером 769-771 п.о. без последовательности нуклеиновой кислоты, кодирующей лидерную последовательность и с заменой кодона цистеинового остатка на кодон остатка метионина.

ПЦР-реакции используют 10× буфер [15 мМ Tris-HCl (pH 8,0), 50 мМ KCl, 1,5 мМ MgCl2], 200 мкМ dNTPs, 1,25 ед. Amplitaq ДНК-полимеразы, 400 нМ прямого праймера 5'-CGTGCGTACCATATGGCACAGAAAGGTGCTGAGTCT-3' (SEQ ID NO: 23) и 400 нМ обратного праймера 5'-CTGGGATCCGCTCAGCTTATTTCA-3' (SEQ ID NO: 22) и матричной ДНК. Используют условия ПЦР: 94°C в течение 5 мин, 35× (94°C в течение 30 с, 48°C в течение 30 с, 72°C в течение 1 мин 30 с) с последующим вымачиванием при 72°C в течение 5 мин и выдерживанием при 4°C. ПЦР-реакции используют непосредственно или хранят при ≤15°C до дальнейшего использования.

Продукты ПЦР очищают с помощью набора для очистки ПЦР QiaQuick (Qiagen), гидролизуют с помощью Nde I и BamH I и лигируют с векторной ДНК pET30a, гидролизованной с помощью Nde I и BamH I. Смеси лигирования используют для трансформации E. coli HMS174(DE3) и колонии, содержащие рекомбинантные плазмиды, селектируют по их резистентности к канамицину и проверяют последовательность продуктов ПЦР.

Оценка экспрессии в E. coli HMS 174(DE3). Выбранные колонии испытывают на их способность к экспрессии соответствующего нового белка OspA. В каждом случае используют единичные колонии для инокуляции бульона LB, содержащего канамицин (30 мкг/мл) и инкубируют при 37°C на протяжении 1-5 часов до достижения значения OD (600 нм) более 0,6 и менее 1. В этот момент времени берут образец культуры (представляющий собой неиндуцированный образец) и остальную культуру индуцируют прибавлением IPTG до конечной концентрации 1 мМ. Неиндуцированный образец (1 мл) центрифугируют и осадок собирают и хранят при -20°C. Индуцированной культуре позволяют расти еще три часа, после чего берут образец 1 мл, измеряют OD (600 нм), образец центрифугируют и осадок собирают и хранят при -20°C.

Приготовление первичных клеток. Первичные клетки готовят для каждого из трех липидированных конструктов и для каждого из трех нелипидированных конструктов. Первичные клетки представляют собой клетки E. coli (HMS174(DE3)), несущие плазмиду pET30a, экспрессирующую соответствующий OspA. Для получения первичных клеток, берут единичную колонию из соответствующего экземпляра культуры с чашки, содержащей канамицин (30 мкг/мл) и рифампицин (200 мкг/мл) и используют для инокуляции 500 мкл среды SMK (SOP 8114) и инкубируют в течение ночи. Сто микролитров этой культуры затем используют для инокуляции 100 мл среды SMK (в двух экземплярах) и культуру инкубируют в течение 17-20 часов при 37°C со встряхиванием. Затем прибавляют к культуре стерильный глицерин в конечной концентрации 15% и материал отбирают пипеткой аликвотами по 500 мкл в 60 ампул, получая таким образом 60 ампул с первичными клетками, которые немедленно направляют на хранение при -80°C.

Три синтетически гена OspA были сконструированы так, чтобы они кодировали молекулы OspA с защитными эпитопами OspA серотипов 1 и 2 (lipB sOspA 1/2251), OspA серотипов 6 и 4 (lipB sOspA 6/4) и OspA серотипов 5 и 3 (lipB sOspA 5/3). Первичные аминокислотные последовательности этих молекул и описание основных признаков, включенных в их конструкцию, приведены в следующих Примерах.

Пример 3

Описание липидированного 1/2251 OspA (lipB sOspA1/2251)

Целью исследований было конструирование нового антигена OspA, липидированного 1/2 251 OspA (lipB sOspA 1/2251), содержащего серотипы 1 и 2. LipB sOspA 1/2251 содержит проксимальный участок последовательности OspA серотипа 1 (штамм B31, номер доступа GenBank X14407), слитый с дистальным участком последовательности серотипа 2 (штамм Pko, номер доступа GenBank S48322). Началом последовательности, уникальным для серотипа типа 2, является лизиновый (K) остаток в положении 216. Конструкт сначала был сконструирован так, чтобы он кодировал аминокислоту аланин (A) в положении 251. Однако конструкт был впоследствии изменен способом ПЦР для кодирования аспарагинового (N) остатка (фактический остаток в опубликованной последовательности Pko) для усиления иммуногенности, вследствие чего он получил наименование lipB sOspA 1/2251.

Вторичные признаки lipB sOspA 1/2251 изображены на аннотированной аминокислотной последовательности lipB sOspA 1/2251 на Фигуре 2 и включают:

• замещение предположительного артритогенного эпитопа (Gross et al., 1998), hLFA-1 (YVLEGTLTA) (SEQ ID NO:24), в проксимальном участке молекулы (аминокислоты 161-185) на эквивалентную последовательность (выделенную курсивом и фланкирующую последовательность) из последовательности OspA серотипа 2 (штамм Pko; номер доступа GenBank S48322): последовательность, которая отличается от эпитопа hLFA-1;

• лидерную последовательность OspB (аминокислоты 1-15 Фигуры 2) и различные замещения для того, чтобы обеспечить отличия от известного уровня техники. Остатки аспарагина (N) и аспарагиновой кислоты (D) в положениях 44 и 46 были замещены на аспарагиновую кислоту (D) и аспарагин (N), соответственно, для получения последовательности KEKDKN (SEQ ID NO: 25). Остатки аланина (A) и аспарагиновой кислоты (D) в положениях 78 и 79 были замещены на треонин (T) и аспарагин (N), соответственно, для получения последовательность KTNKSK (SEQ ID NO: 26);

• стабилизацию мутаций, как описано в международной патентной публикации № WO 02/16421A2 (Luft & Dunn). Например, метионин (M) замещает аргинин (R) в положении аминокислоты 136 (R139M); тирозин (Y) замещает глутаминовую кислота (E) в положении аминокислоты 157 (E160Y); и метионин (M) замещает лизин (K) в положении аминокислоты 186 (K189M); и

• дополнительную стабилизацию мутаций. Например, треонин (T) замещает валин (V) в положении аминокислоты 173 (аминокислота (aa) 176 описания). Удаление предположительного артритогенного эпитопа (положения 161-185) путем замещения последовательности B. burgdorferi на последовательность B. afzelii, приводит к разрыву водородной связи между аминокислотами 173 и 174 (aa 176 и 177 описания). Это приводит к ослаблению связывания с защитными моноклональными антителами (105.5 и LA-2 (Jiang et al., J. Immunol. 144: 284-9, 1990; Golde et al., Infect. Immun. 65: 882-9, 1997; и Ding et al., J. Mol. Biol. 302: 1153-64, 2000). Треонин (T) вводят в положение 173, вместо валина (V), для восстановления водородной связи и увеличения реакционной способности с защитными моноклональными антителами 105.5 и LA2.

Кроме того, аминокислоты 16-25 (начало зрелого белка) идентичны последовательности OspB (номер доступа GenBank X74810).

Нуклеотид и расшифрованные аминокислотные последовательности lipB sOspA 1/2251 приведены на Фигуре 3. Лидерная последовательность (зеленая) отщепляется во время секреции белка. Последовательность зрелого белка OspA начинается с цистеинового остатка (подчеркнут), который образует сайт присоединения липидного якоря белка.

Пример 4

Описание липидированного 6/4 OspA (lipB sOspA 6/4)

Целью исследований было конструирование нового антигена OspA, липидированного sOspA 6/4 OspA (lipB sOspA 6/4), содержащего серотипы 4 и 6. LipB sOspA 6/4 содержит проксимальный участок последовательности OspA серотипа 6 (штамм K48, номер доступа GenBank I40098), слитый с дистальным участком последовательности серотипа 4 (штамм pTroB; номер доступа GenBank I40089). Начало последовательности, уникальное для серотипа типа 4, представляет собой остаток аспарагина (N) в положении 217. Вторичные признаки показаны на аннотированной аминокислотной последовательности lipB sOspA 6/4 на Фигуре 4 и включают:

• стабилизацию мутаций, описанных в международной патентной заявке № WO 02/16421A2 (Luft и Dunn): метионин (M) вместо аргинина (R) в положении аминокислоты 136, тирозин (Y) вместо глутаминовой кислоты (E) в положении аминокислоты 157 и метионин (M) вместо лизина (K) в положении аминокислоты 187; и

• аналогично lipB sOspA 1/2251, описанному выше, используют лидерную последовательность OspB (аминокислоты 1-15 на Фигуре 4) и аминокислоты 16-25 являются идентичными последовательности OspB (номер доступа GenBank X74810).

Хотя пептидная последовательность KEKNKD (SEQ ID NO: 27) отсутствует в последовательности родительского типа OspA 6 (KEKDKD) (SEQ ID NO: 28), остаток аспарагиновой кислоты (D) в положении 46 замещают на остаток аспарагина (N) согласно эквивалентной замене, выполненной в конструкте lipB sOspA 1/2251 для получения последовательности KEKDKN (SEQ ID NO:25).

Хотя пептидная последовательность KADKSK (SEQ ID NO:29) отсутствует в последовательности родительского типа OspA 6 (KTDKSK) (SEQ ID NO: 30), остаток аспарагиновой кислоты (D) в положении 79 замещают на остаток аспарагина (N) согласно эквивалентной замене, выполненной в конструкте lipB sOspA 1/2251 для получения последовательности KTNKSK (SEQ ID NO:26).

Аминокислоту 37 меняют с глутаминовой кислоты (E), присутствующей в родительской последовательности (штамм K48; номер доступа GenBank I40098), на валин (V), потому что почти все последовательности типа 6 содержат валин в этом положении.

Нуклеотид и расшифрованные аминокислотные последовательности lipB sOspA 6/4 приведены на Фигуре 5. Лидерная последовательность (зеленая) отщепляется во время секреции белка. Последовательность зрелого белка OspA начинается с цистеинового остатка (подчеркнут, см. Фигуру 5), который образует сайт присоединения липидного якоря белка.

Пример 5

Описание липидированного 5/3 OspA (lipB sOspA 5/3)

Целью исследований было конструирование нового антигена OspA, липидированного sOspA 5/3 OspA (lipB sOspA 5/3), содержащего серотипы 3 и 5. LipB sOspA 5/3 содержит проксимальный участок последовательности OspA серотипа 5 [№ доступа в базе данных emb|X85441|BGWABOspA, ген OspA B. garinii (субштамм WABSou)], слитый с дистальным участком последовательности серотипа 3 (штамм PBr; № доступа Genbank X80256, ген OspA B. garinii) с модификациями, указанными в SEQ ID NOS: 5 и 6. Начало последовательности, уникальное для серотипа типа 3, представляет собой остаток аспарагиновой кислоты (D) в положении 216. Вторичные признаки показаны на аннотированной аминокислотной последовательности lipB sOspA 5/3 на Фигуре 6 и включают:

• стабилизацию мутаций, описанных в международной патентной заявке № WO 02/16421A2 (Luft and Dunn): метионин (M) вместо аргинина (R) в положении аминокислоты 136; тирозин (Y) вместо глутаминовой кислоты (E) в положении аминокислоты 157; и метионин (M) вместо лизина (K) в положении аминокислоты 187; и

• аналогично lipB sOspA 1/2251 и lipB sOspA 6/4, описанным выше, используют лидерную последовательность OspB (аминокислоты 1-15 на Фигуре 6) и аминокислоты 16-25 являются идентичными последовательности OspB (номер доступа GenBank X74810).

Хотя пептид последовательность KEKNKD (SEQ ID NO:27) отсутствует в последовательности родительского типа OspA 5 (KEKDKD) (SEQ ID NO: 28), остаток аспарагиновой кислоты (D) в положении 46 замещают на остаток аспарагина (N) согласно эквивалентной замене, выполненной в конструкте lipB sOspA 1/2251, с образованием последовательности KEKDKN (SEQ ID NO:25).

Хотя пептидная последовательность KADKSK (SEQ ID NO:29) отсутствует в последовательности родительского типа OspA 5 (KTDKSK) (SEQ ID NO: 30), остаток аспарагиновой кислоты (D) в положении 79 замещают на остаток аспарагина (N) согласно эквивалентной замене, выполненной в конструкте lipB sOspA 1/2251 с образованием последовательности KTNKSK (SEQ ID NO: 26).

Нуклеотид и расшифрованные аминокислотные последовательности lipB sOspA 5/3 приведены на Фигуре 7. Лидерная последовательность (зеленая) отщепляется во время секреции белка. Последовательность зрелого белка OspA начинается с кодона цистеина (подчеркнут, см. Фигуру 7), который образует сайт присоединения липидного якоря белка.

Пример 6

Оптимизация использования кодонов для высокого уровня экспрессии в E. coli

Поскольку известно, что присутствие кодонов, редко используемых в E. coli, является потенциальным препятствием для высокого уровня экспрессии чужеродных генов, малоиспользуемые кодоны были замещены на кодоны, используемые в генах E. coli с высокой экспрессией. Нуклеотидные последовательности новых генов OspA были сконструированы с использованием кодонов, наиболее часто встречающихся (предпочтительных кодонов) в гены E. coli класса II с высокой экспрессией (Guerdoux-Jamet et. al., DNA Research 4:257-65,1997). Данные по использованию кодонов в новых генах OspA и в генах класса II E. coli с высокой экспрессией приведены в Таблицах 7 и 8. Данные для реже используемых аминокислот, для которых молекулы тРНК с меньшей вероятностью являются ограничивающим скорость фактором, представлены отдельно (Таблица 7) от данных для аминокислот, встречающихся наиболее часто (Таблица 8).

Таблица 7
Использование кодонов в новых генах OspA (реже встречающиеся аминокислоты*)
Амино-кислоты Кодон Количество аминокислот OspA 1/2 Количество аминокислот OspA 5/3 Количество аминокислот OspA 6/4 Количество класса II (%)
Всего Кодон % Всего Кодон % Всего Кодон %
Gln CAA 5 1 20,0 4 0 0,0 4 0 0,0 18,7
CAG 4 80,0 4 100,0 4 100,0 81,4
Phe TTT 5 1 20,0 6 3 50,0 6 1 16,7 29,1
TTC 4 80,0 3 50,0 5 83,3 70,9
Met ATG 4 4 100,0 5 5 100,0 4 4 100,0 100,0
Tyr TAT 4 1 25,0 4 1 25,0 4 0 0,0 35,2
TAC 3 75,0 3 75,0 4 100,0 64,8
Arg CGT 2 2 100,0 3 3 100,0 2 2 100,0 64,3
CGC 0 0,0 0 0,0 0 0,0 33,0
CGA 0 0,0 0 0,0 0 0,0 1,1
CGG 0 0,0 0 0,0 0 0,0 0,8
AGA 0 0,0 0 0,0 0 0,0 0,6
AGG 0 0,0 0 0,0 0 0,0 0,3
Cys TGT 1 0 0,0 1 1 100,0 1 0 0,0 38,9
TGC 1 100,0 0 0,0 1 100,0 61,2
Pro CCT 1 0 0,0 2 0 0,0 1 0 0,0 11,2
CCC 1 100,0 1 50,0 1 100,0 1,6
CCA 0 0,0 0 0,0 0 0,0 15,3
CCG 0 0,0 1 50,0 0 0,0 71,9
Trp TGG 1 1 100,0 1 1 100,0 1 1 100,0 100,0

* т.е. аминокислоты, которые, индивидуально, составляют <2,5% от общего числа аминокислот.

Таблица 8
Использование кодонов в новых генах OspA (более распространенные аминокислоты)
Амино-кислоты Кодон Количество аминокислот OspA 1/2 Количество аминокислот OspA 5/3 Количество аминокислот OspA 6/4 Количество класса II (%)
Всего Кодон % Всего Кодон % Всего Кодон %
Lys AAA 40 30 75,0 40 36 90,0 40 37 92,5 78,6
AAG 10 25,0 4 10,0 3 7,5 21,5
Thr ACT 32 13 40,6 31 15 48,4 34 7 20,6 29,1
ACC 14 43,8 16 51,6 27 79,4 53,6
ACA 0 0,0 0 0,0 0 0,0 4,7
ACG 5 15,6 0 0,0 0 0,0 12,7
Leu CTT 27 3 11,1 28 2 7,1 28 1 3,6 5,6
CTC 3 11,1 0 0,0 4 14,3 8,0
CTA 0 0,0 0 0,0 0 0,0 0,8
CTG 17 63,0 21 75,0 18 64,3 76,7
TTA 2 7,4 2 7,1 3 10,7 3,4
TTG 2 7,4 3 10,7 2 7,1 5,5
Ser TCT 25 9 36,0 25 12 48,0 23 8 34,8 32,4
TCC 8 32,0 3 12,0 8 34,8 26,6
TCA 0 0,0 0 0,0 0 0,0 4,8
TCG 0 0,0 0 0,0 0 0,0 7,4
AGT 0 0,0 0 0,0 0 0,0 4,5
AGC 8 32,0 10 40,0 7 30,4 24,3
Gly GGT 22 11 50,0 23 8 34,8 22 9 40,9 50,8
GGC 11 50,0 14 60,9 13 59,1 42,8
GGA 0 0,0 0 0,0 0 0,0 2,0
GGG 0 0,0 1 4,3 0 0,0 4,4
Val GTT 22 8 36,4 15 6 40,0 18 7 38,9 39,8
GTC 4 18,2 0 0,0 4 22,2 13,5
GTA 3 13,6 9 60,0 3 16,7 20,0
GTG 7 31,8 0 0,0 4 22,2 26,8
Glu GAA 21 16 72,7 22 18 81,8 21 18 85,7 75,4
GAG 5 23,8 4 18,2 3 14,3 24,7
Asp GAT 17 8 47,1 16 9 56,3 19 8 42,1 46,1
GAC 9 52,9 7 43,8 11 57,9 54,0
Ala GCT 16 6 37,5 18 9 50,0 17 6 35,3 27,5
GCC 0 0,0 1 5,6 4 23,5 16,1
GCA 5 31,3 6 33,3 3 17,6 24,0
GCG 5 31,3 2 11,1 4 23,5 32,3
Asn AAT 13 3 23,1 13 3 23,1 13 2 15,4 17,3
AAC 10 76,9 10 76,9 11 84,6 82,8
Ile ATT 12 4 33,3 13 5 38,5 13 3 23,1 33,5
ATC 8 66,7 8 61,5 10 76,9 65,9
ATA 0 0,0 0 0,0 0 0,0 0,6

Высокая степень согласия между использованием кодонов, выбранных для новых генов OspA (только обычные аминокислоты) и генов E. coli класса II является очевидной (т.е. график зависимости значений процентного содержания из Таблицы 8 для генов класса II по сравнению с индивидуальными новыми генами OspA; см. Фигуру 8). Для трех липидированных конструктов, исходные последовательности имеют содержание GC в интервале значений от 32,8% до 33,8%, в то время как оптимизированные по кодонам последовательности имеют содержание GC в интервале значений от 43,8% до 46,8%, что близко к 50% содержания GC для E. coli.

Пример 7

Конструирование синтетических нелипидированных генов OspA

Были также получены конструкты, не содержащие лидерной последовательности lipB. Два набора конструктов (липидированных и нелипидированных) необходимы для оценки простоты их продуцирования в ферментере (биомасса, стабильность, выход продукта и т.п.), для оценки легкости очистки разных типов антигена и для сравнения их биологических характеристик (профиль безопасности и эффективность защиты).

Конструкты (SEQ ID NOS: 7, 9 и 11) были получены способом ПЦР-амплификации из каждого из трех конструктов lipB OspA (SEQ ID NOS: 1, 3 и 5) с использованием ПЦР-праймеров с включенными сайтами рестрикции. Продукты ПЦР очищают, гидролизуют Nde I и BamH I и лигируют с гидролизованной векторной ДНК pET30a. Смеси лигирования используют для трансформации E. coli DH5α и проверяют последовательности OspA. Готовят Miniprep-ДНК, выделяют и используют для трансформации клеток-хозяев HMS 174(DE3). Последовательности нелипидированных производных идентичны липидированным вариантам, за исключением того, что в них отсутствуют первые 45 пар оснований, кодирующих лидерную последовательность, и содержат сайт Nde I, который содержит кодон метионина замещающий цистеиновый кодон в липидированных вариантах (см. Фигуру 9).

Пример 8

Экспрессия новых рекомбинантных антигенов OspA

Для экспрессии/продуцирования новых рекомбинантных генов OspA для использования в качестве антигенов, используют систему экспрессии E. coli, контролируемую РНК-полимеразой бактериофага T7 (Studier et al., J. Mol. Biol. 189:113-30, 1986). В этой системе экспрессии, новые гены OspA клонируют в сайт множественного клонирования одной из плазмид серии pET (напр., pET30a). Поскольку экспрессия чужеродного гена находится под контролем промотора бактериофага T7, который не распознается РНК-полимеразой E. coli, экспрессия является зависимой от источника РНК-полимеразы T7. Этот фермент обеспечивается, когда рекомбинантные плазмиды перемещают в пригодного хозяина экспрессии, такого как E. coli HMS174(DE3), который содержит хромосомную копию гена T7 РНК-полимеразы. Экспрессия хромосомно интегрированного гена РНК-полимеразы T7 находится под контролем промотора lacUV5, который может быть включен (т.е. индуцирован) путем прибавления изопропил β-D-1-тиогалактопиранозида (IPTG) или лактозы (см. Фигуру 10). Следовательно, экспрессия чужеродного гена также регулируется путем добавления молекулы индуктора.

Клетки индуцируют на поздней лог-фазе и собирают через 3-4 часа после индукции. В индуцированных клетках, химерный антиген OspA был наиболее высокоэкспрессируемым белком, по результатам определения способом ДСН-ПААГ клеточных лизатов. Большая часть химер OspA была обнаружена в супернатанте. Загрязняющие белки E. coli удаляют анионообменной хроматографией и химерные белки OspA, элюируемые в объем пустот, концентрируют ультрафильтрацией.

Экспрессию новых рекомбинантных белков OspA из каждого из конструктов испытывают и образцы из индуцированных и неиндуцированных культур разделяют на полиакриламидном геле с добавкой ДСН (Фигура 11). Для липидированных (SEQ ID NOS: 2, 4 и 6) и нелипидированных (SEQ ID NOS: 8, 10 и 12) антигенов, в каждом случае наблюдалась полоса размером приблизительно 31 кДа (см. Фигуру 11). Белки охарактеризовывают и определенные молекулярные веса коррелируют (±0,5 дальтон) с теоретическими молекулярными весами, предполагая отщепление терминального метионина. Фигура 11 показывает, что экспрессируемые рекомбинантные липидированные белки OspA составляют по меньшей мере 10% от общего выхода белка, подтверждая пригодность конструктов для их предполагаемого назначения.

Пример 9

Отдельно взятый рекомбинантный антиген OspA (rOspA 1/2) защищает против инфекции B. burgdorferi s.s. и B. afzelii

Целью данных исследований было определение того, будет ли способен отдельно взятый рекомбинантный антиген (rOspA 1/2; полипептид, содержащий SEQ ID NO: 2 (lipB sOspA 1/2251)), сконструированный для сохранения защитных свойств серотипов OspA 1 и 2, индуцировать гуморальные реакции, защищающие мышей против инфекции B.burgdorferi s.s. (серотип OspA 1) или B. afzelii (серотип OspA 2). Приводятся данные, демонстрирующие, что включение дополнительных антигенов rOspA не оказывает антагонистического эффекта на защитный иммунитет, создаваемый антигеном rOspA 1/2.

Проектирование и конструкция rOspA 1/2. Для устранения риска внесения случайных агентов, используют комплементарные перекрывающиеся синтетические олигонуклеотиды для получения фрагментов ДНК, которые лигируют вместе и клонируют в вектор pET30a, и последовательность верифицируют. Этот подход также позволяет оптимизировать использование кодонов для хозяина E. coli HMS174 (DE3), используемого для экспрессии гена OspA. Новый ген основан на проксимальном участке последовательности OspA серотипа 1 (аминокислоты 29-218, штамм B31; номер доступа GenBank X14407), слитым с дистальным участком последовательности серотипа 2 (аминокислоты 219-273, штамм PKo; номер доступа S48322). Фрагмент размером 25 аминокислот из штамма B31 B. burgdorferi (аминокислоты 164-188) замещают на последовательность из штамма PKo B. afzelii (аминокислоты 164-188), потому что этот участок B31 OspA (аминокислоты 165-173) имеет высокую степень родства с областью, окружающей эпитоп hLFA-1 (аминокислоты 332-340). N-Концевая последовательность, включая лидерную последовательность и первые 11 аминокислот, была получена из OspB (штамм B31; номер доступа GenBank X74810) для оптимизации экспрессии липидированного белка. Другие специфические изменения аминокислот были проведены для повышения иммуногенности и конформационной стабильности молекулы rOspA 1/2, и последовательность rOspA 1/2 (lipB sOspA 1/2251) приведена в SEQ ID NO: 2.

Испытания на животных. Способность отдельно взятого рекомбинантного антигена OspA (rOspA 1/2) предотвращать инфекцию двумя видами Borrelia, которые экспрессируют разные антигены OspA, оценивают на мышах C3H/HeJ, иммунизированных подкожно (дни 0 и 28) очищенным антигеном OspA (дозы 0,1 мкг или 0,03 мкг), приготовленным с 0,2% (мас/об) гидроксида алюминия в качестве адъюванта. Проводят контрольное заражение мышей через 2 недели после бустер-иммунизации, путем интрадермальной инъекции (заражение иглой; 7×104 клеток) или природным путем передачи инфекции (заражение от клещей). Для последних экспериментов, сажают 8 нимфальных клещей на мышь и позволяют им питаться в течение до 5 дней. Нимф собирают в окрестностях Ческе-Будеёвице (Budweis) (Республика Чехия), регион эндемической лаймской болезни. Большинство этих клещей были инфицированы B. afzelii по результатам определения способом испытаний некормленых клещей способом ПЦР. Инфекционный статум мышей определяют через четыре недели. В экспериментах с заражением от клещей, присутствие Borrelia подтверждают культивацией (мочевой пузырь) и путем детектирования Borrelia ДНК способом ПЦР в реальном масштабе времени (сердце). Эксперименты на животных проводят в соответствии с законодательством Австрии о проведении экспериментов на животных и международными рекомендациями (AAALAC и OLAW) и контролировались Институциональным комитетом по уходу за животными и их использованию (Institutional Animal Care and Use Committee) и получали одобрение регуляторных органов Австрии. Иммуногенность. Гуморальный ответ (мкг IgG/мл) на антиген rOspA 1/2 определяют способом ELISA с использованием rOspA 1/2 в качестве покрывающего антигена и специфических моноклональных антител OspA (собственного производства) с определенным содержанием IgG в качестве стандарта.

Диагностические процедуры. Для экспериментов с заражением иглой, присутствие антител к консервативному эпитопу в поверхностно-экспонированном белке липопротеина VlsE (C6 ELISA; планшеты с покрытием фирмы Immunetics® C6 Lyme ELISA™) или к антигенам Borrelia, отличным от иммуногена OspA (вестерн-блоттинг) используют для диагностирования инфекции. Для вестерн-блоттинга используют клеточный лизат, приготовленный из штамма B. burgdorferi s.s. ZS7, поскольку он использовался в качестве организма контрольного заражения. Животные считаются инфицированными, если они были позитивными по результатам обоих анализов.

Для экспериментов с заражением от клещей проводились также анализы способами C6 ELISA и вестерн-блоттинга. Однако для вестерн-блоттинга используют лизаты B. burgdorferi s.s. ZS7, B. afzelii ACA1 и B. garinii KL11, потому что идентичность инфицирующего организма была неизвестной. Считалось, что животные подверглись сероконверсии, только если результаты обоих анализов были позитивными. Кроме того, инфекцию Borrelia оценивают по культуре из мочевого пузыря и путем детектирования нуклеиновых кислот B.burgdorferi s.l. в геномной ДНК, экстрагированной из ткани сердца, способом анализа ПЦР в реальном масштабе времени, нацеленного на 5'-участок OspA, и генетического анализа рРНК 16S. Животных определяют как ПЦР-позитивных, только если продукт ПЦР был детектирован обоими способами анализа. В общем, для определения животного как инфицированного, мыши должны были быть позитивными по результатам определения в культуре, способом ПЦР или серологии.

Характеризация инфицирующих Borrelia. В тех случаях, когда это возможно, инфицирующий организм культивируют и последовательность OspA и расшифрованную аминокислотную последовательность определяют для остатков 38-262 OspA (B. afzelii VS461, номер доступа GenBank Z29087). Эту информацию сравнивают с эталонными последовательностями OspA, чтобы можно было определить тип OspA и вид Borrelia. Для видов, экспрессирующих единственный серотип OspA, последовательность OspA для типичного штамма данного вида выбирают в качестве эталона, напр., B. afzelii VS461 или B. valaisiana VS116 (номер доступа GenBank Z29087; AF095940). Поскольку B. garinii имеет множество типов OspA, используют последовательности OspA для генотипов OspA 3-7 (т.е. штаммы PBr, PTrob, WABSou, TlsI и T25; номера доступа GenBank X80256, X80186, X85441, X85440 и X80254, соответственно). Для типирования способом ПЦР в реальном масштабе времени, последовательность выравнивания гена OspA для 124 разновидностей B. burgdorferi s.l., депонированных в GenBank, проверяют на серотип-специфические последовательности и пригодные комбинации праймер-зонд конструируют с помощью Primer Express 3.0 (Applied Biosystems). Все анализы проводят на приборе для детектирования последовательностей ABI Prism® 7900HT с использованием универсальных условий циклирования.

Профилактика инфекции B.burgdorferi s.s (серотип OspA-1) путем иммунизации rOspA 1/2. Все мыши, иммунизированные низкими дозами двух разных партий антигена rOspA 1/2, вырабатывают IgG-антитела, специфические по отношению к иммуногену, по результатам определения способом ELISA. Никаких антител не обнаружен у контрольных мышей, получавших буфер композиции вакцины, содержащий гидроксид алюминия. Для оценки способности этого иммунного ответа предотвращать инфекцию B. burgdorferi s.s., вида, кодирующего OspA серотипа 1, мышам вводили интрадермальными инъекциями 7×104 клеток штамма ZS7 B. burgdorferi s.s. Все контрольные мыши, получавшие буфер, содержащий адъювант, продемонстрировали серологическое подтверждение инфекции, определенное способами C6 ELISA и вестерн-блоттинга. Ни одна из мышей, иммунизированных антигеном rOspA 1/2, не была инфицирована, и сыворотки этих мышей были негативными по результатам обоих анализов. Всего 0,03 мкг антигена rOspA 1/2, в виде композиции с гидроксидом алюминия в качестве адъюванта, при введении по схеме иммунизации двумя дозами, обеспечивает 100% защиты (P < 0,0001, двусторонний точный критерий Фишера) от заражения иглой вирулентным штаммом ZS7 B. burgdorferi s.s.

Профилактика инфекции B. afzelii (серотип OspA-2) путем иммунизации rOspA 1/2. Для оценки способности иммунизации антигеном rOspA 1/2 для предотвращения инфекции B. afzelii, видом, кодирующим OspA серотипа 2, мышей иммунизируют, в двух отдельных экспериментах, с использованием тех же партий антигена и схемы исследований, что и в эксперименте с заражением иглой, описанном выше. Однако, в этом случае, проводят контрольное заражение иммунизированных мышей природными клещами (нимфы), определенными как инфицированные преимущественно B. afzelii. Способность этих природных клещей переносить мышам B. burgdorferi s.l. подтверждают путем контрольного заражения неиммунизированных контрольных животных.

Большинство контрольных мышей (в общей сложности 11/14, 79%) были инфицированы. Все инфицированные контрольные животные были позитивными по ДНК Borrelia по результатам двух независимых анализов способом ПЦР в реальном масштабе времени (16S-рРНК и гены OspA). В 10/11 случаев, удалось выделить Borrelia способом культуры мочевого пузыря. Остальные мыши были позитивными по результатам серологии и ПЦР. Для 9 из 10 культур изолятов, были выделены последовательности OspA, которые все были типированы как B. afzelii (>99% идентичности последовательностей OspA). Кроме того, все инфицирующие организмы были типированы как B. afzelii способом ПЦР-анализа ДНК, экстрагированной из сердца, способом ПЦР в реальном масштабе времени, специфически направленного на гены OspA серотипа 2. Эти данные подтверждают, что B. afzelii был основным видом Borrelia, переносимым инфицированными природными клещами мышам-хозяевам.

Несколько мышей, иммунизированных rOspA 1/2 (в общей сложности 3/32, 9%) были инфицированы. Из этих трех мышей, одна была инфицирована по результатам определения всех трех диагностических критериев (серология, ПЦР и культура), и анализ последовательности показал, что инфицирующим организмом был B. garinii серотип 6 (>99% идентичности последовательности OspA). Остальные два животных, считавшиеся инфицированными, были позитивными только по двум из трех критериев. Одна мышь была позитивной по серологии и ПЦР. Однако инфицирующий организм не удалось выделить в культуре. Тем не менее, этот организм удалось типировать как B. garinii серотип 7 способом ПЦР-анализа ДНК, экстрагированной из сердца с использованием ПЦР, специфической по отношению к гену OspA серотипа 7. Третья мышь была позитивной по ПЦР и культуре, но серологически негативной. Культура изолята этой мыши принадлежала B. valaisiana по результатам определения способом секвенирования (идентичность последовательности OspA со штаммом VS116 B. valaisiana). Важно, что ни одна из иммунизированных мышей (0/32) не была инфицирована B. afzelii. Всего лишь 0,03 мкг антигена rOspA 1/2, в виде композиции с гидроксидом алюминия в качестве адъюванта, и при введении по схеме иммунизации двумя дозами, обеспечивают полную защиту против B. afzelii, переносимых природными клещами.

Заключение. Антиген отдельно взятого рекомбинантного внешнего поверхностного белка A (OspA), сконструированного таким образом, чтобы он содержал защитные элементы от двух разных серотипов OspA (1 и 2), был способен индуцировать гуморальные ответы, защищающие мышей от инфекции B. burgdorferi sensu stricto (OspA серотипа 1) или B. afzelii (OspA серотипа 2). Защита против инфекции B. burgdorferi s.s., штамм ZS7, была продемонстрирована в модели заражения иглой. Защита против вида B. afzelii была продемонстрирована на модели заражения от клещей с использованием природных клещей. В обеих моделях всего лишь 0,03 мкг антигена, при введении по графику иммунизации двумя дозами с гидроксидом алюминия в качестве адъюванта, было достаточно для обеспечения полной защиты против видов-мишеней. Как и предполагалось, защита, создаваемая этим новым антигеном, не распространяется на другие виды Borrelia, что было продемонстрировано неспособностью антигена обеспечивать защиту против инфекции штаммами B. garinii и B. valaisiana. Такое подтверждение основного положения исследований показывает, что знание защитных эпитопов может быть использовано для рационального конструирования эффективных генетически-модифицированных вакцин, требующих использования меньшего количества антигенов OspA, и позволяет предположить, что этот подход может облегчить разработку вакцины OspA, пригодной для использования в глобальном масштабе.

Пример 10

Эффективность связывания мышиных анти-OspA антител с поверхностью живых Borrelia или ингибирования их роста коррелирует с защитой против заражения иглой штаммом B. burgdorferi s.s. типа 1

Целью данных исследований было установление соотношений корреляции при защите мышей, иммунизированных антигеном rOspA 1/2 в модели заражения иглой использованием штамма Borrelia burgdorferi sensu stricto типа OspA 1. Анализируемыми параметрами была способность анти-OspA антител связываться с поверхностью живых Borreliae или ингибировать рост Borreliae.

98 мышей были преднамеренно иммунизированы субоптимальной дозой 3 нг антигена rOspA 1/2 с адъювантом 0,2% Al(OH)3), которая была в 10 раз меньше низшей дозы, использованной в Примере 9, по схеме первичной бустерной дозы, так чтобы, при контрольном заражении, можно было наблюдать как защищенных, так и инфицированных животных. Вакцинация проводилась подкожно с использованием объема дозы 100 мкл в дни 0, 14 и 28. В день 38, у 96 мышей брали образцы сыворотки перед контрольным заражением и через 10 дней проводили контрольное заражение животных с использованием 19,4× ID50, выращенного в культуре B.burgdorferi s.s. ZS7, и инфекционный статус определяли через четыре недели. 71 из 96 мышей (72%) были определены как защищенные после иммунизации такой низкой дозой антигена.

Через четыре недели после контрольного заражения берут кровь для идентификации инфицированных мышей способом вестерн-блоттинга их сыворотки против мембранной фракции штамма ZS7 B.burgdorferi s.s. При использованных для контрольного заражения дозах, только инфицированные мыши имели гуморальный ответ на мембранные антигены штамма ZS7, отличные от OspA (ответ на OspA, индуцированные вакциной, не оценивался).

Количественное определение связывания антитела OspA с поверхностью живых Borreliae. В этом анализе, штамм B31 B. burgdorferi s.s., экспрессирующий OspA типа 1, инкубируют при постоянном разбавлении (1:100) со взятой перед контрольным заражением мышиной сывороткой при комнатной температуре в присутствии ЭДТА для предотвращения активации комплемента. После промывки для удаления несвязанного антитела, специфически связанные с поверхностью клеток антитела метят путем инкубации обработанных клеток с r-фикоэритрин-конъюгированным анти-мышиным Ig поликлональным антителом. После этого используют способ ДНК-окрашивания (LDS-751), дающий красную флуоресценцию, что облегчает детектирование, и бактерии затем анализируют способом проточной цитометрии (FACSCalibur, Beckton-Dickinson). Интенсивность флуоресценции, которая коррелирует с числом молекул антитела, связанных с поверхностью клеток, регистрируют для по меньшей мере 2000 индивидуальных Borreliae и рассчитывают среднюю интенсивность флуоресценции (MFI). Нормальная мышиная сыворотка служит негативным контролем для оценки величины неспецифического поверхностного связывания антител, в то время OspA серотип 1-специфическое mAb служит позитивным контролем для подтверждения идентичности типа OspA и для верификации уровня экспрессии OspA клетками в бактериальной культуре.

Анализ ингибирования роста бактерий. Для измерения способности взятой перед контрольным заражением сыворотки ингибировать рост Borreliae, штамм B31 B. burgdorferi s.s., экспрессирующий OspA типа 1, культивируют при 33°C в присутствии серийных разбавлений термоинактивированной взятой перед контрольным заражением или неиммунной мышиной сыворотки (негативный контроль) в присутствии комплемента (нормальная сыворотка морской свинки). Когда бактерии в контрольных культурах, инкубируемых с неиммунными сыворотками, в достаточной степени вырастут, при определении микроскопическим способом, проводят точный подсчет клеток с помощью анализа способом проточной цитометрии. Клеточные культуры смешивают с раствором, содержащим определенное число флуоресцентно-меченых бусин, и ДНК-краситель прибавляют для флуоресцентного мечения клеток Borrelia. Образцы обрабатывают с помощью проточного цитометра FACSCalibur до подсчета 100 бусин и рассчитывают абсолютные концентрации клеток (клеток/мл) путем сравнения числа событий в гейте бусин и в гейте Borreliae. Разбавление сыворотки, при котором рост бактерий ингибируется на 50%, рассчитывают по сравнению с NMS-контролем и приводят как титр GI-50. Стандартный препарат сыворотки используют для нормирования титров для разных анализов. Распределение измеренных параметров сыворотки сравнивают для инфицированных и защищенных животных с помощью непараметрического U-критерия Манна-Уитни (Graphpad Prism Vers. 5.0).

Результаты этих исследований (см. Фигуру 19) четко демонстрируют существование высокозначимой корреляции между содержанием функционального антитела в иммунной сыворотке во время контрольного заражения и защитой против инфекции высокой дозой (19,4× ID50) B. burgdorferi s.s. (ZS7) при заражении иглой. Измерения интенсивности флуоресценции способом FACS (возбужденная флуоресценция сортированных клеток) живых Borreliae, экспрессирующих OspA типа 1, которая отражает число молекул анти-OspA антител, связанных с поверхностью клеток, проводимые после инкубации бактерий со взятой перед контрольным заражением сывороткой при постоянном разбавлении, наилучшим образом коррелируют с защитой (p<0,0001, U-критерий Манна-Уитни). Однако титры ингибирования роста также высокозначимо коррелируют с защитой (p=0,0002, U-критерий Манна-Уитни, Фигура 19).

Пример 11

Эффективность связывания мышиных анти-OspA антител с поверхностью живых borrelia или ингибирования роста коррелирует с защитой против заражения от клещей с помощью штамма B. afzelii типа 2

Целью данных исследований было установление корреляций при защите мышей, иммунизированных химерным антигеном OspA 1/2 в модели заражения от клещей, использующей для инфицирования мышей природный путь передачи инфекции с помощью природных клещей, собранных в районе г. Ческе-Будеёвице (Budweis) в Республике Чехии. Поскольку нимфальные клещи из данного эндемического региона инфицированы преимущественно B. afzelii, считается, что они обеспечивают контрольное заражение штаммом B. afzelii, OspA типа 2. Как указано в Примере 10, анализируемыми параметрами была способность анти-OspA антител связываться с поверхностью живых Borreliae или ингибировать рост Borreliae, которые обе, как было показано, демонстрируют хорошую корреляцию с противодействием заражению иглой Borrelia bugdorferi s.s. Таким образом, данные исследования направлены на расширение применимости этих двух параметров как коррелирующих с защитой против природной инфекции B. afzelii, наиболее важным геновидом, ассоциированным с болезнями человека в Европе.

Сорок мышей иммунизируют субоптимальной 3 нг дозой антигена rOspA 1/2 с адъювантом 0,2% Al(OH)3, что в 10 раз меньше низшей дозы, использованной в Примере 9, по схеме первичной бустерной дозы. Как и в Примере 10, эту субоптимальную дозу выбирают для того, чтобы обеспечить наблюдение после контрольного заражения как защищенных, так и инфицированных животных. Вакцинация проводилась подкожно с использованием объема инъекции 100 мкл в дни 0, 14 и 28. В день 40 индивидуальные образцы крови брали у мышей для получения сыворотки перед контрольным заражением. Поскольку ограниченное число доступных клещей не позволяло провести контрольное заражение всех 40 мышей, выбрали 20 мышей на основании данных по поверхностному связыванию и концентраций анти-тип 2 IgG, чтобы охватить широкий спектр защитных реакций. На каждую мышь посадили восемь клещей и позволили кормиться на этих мышах в течение 5 дней. Через четыре недели после контрольного заражения, мышей умертвили и инфекционный статус иммунизированных и контрольных мышей определили способом вестерн-блоттинга сыворотки против мембранных антигенов B. burgdorferi s.s., B. afzelii и B. garinii; культуры организмов Borrelia из мочевого пузыря; и путем детектирования Borrelia способом ПЦР в реальном масштабе времени в ДНК, экстрагированной из мочевого пузыря.

Количественное определение связывания антитела OspA с поверхностью живых Borreliae. В этом анализе, штамм Arcon B. afzelii, экспрессирующий OspA типа 2, инкубируют при постоянном разбавлении (1:100) со взятой перед контрольным заражением мышиной сывороткой при комнатной температуре в присутствии ЭДТА для предотвращения активации комплемента. После промывки для удаления несвязанного антитела, специфически связанные с поверхностью клеток антитела метят путем инкубации обработанных клеток с r-фикоэритрин-конъюгированным анти-мышиным Ig поликлональным антителом. Все последующие стадии анализа аналогичны описанным в Примере 10. Нормальная мышиная сыворотка служит негативным контролем для неспецифического связывания антитела. Высокий титр мышиной сыворотки против композиции трехкомпонентной рецептуры rOspA вакцины, вместе с OspA серотип 2-специфическими mAbs, служат позитивными контролями для подтверждения серотип-специфичности OspA и уровня экспрессии OspA клетками в бактериальной культуре.

Анализ ингибирования роста бактерий. Для измерения способности взятой перед контрольным заражением сыворотки ингибировать рост Borreliae, штамм Arcon B. afzelii, экспрессирующий OspA типа 2, культивируют при 33°C в присутствии серийных разбавлений термоинактивированной взятой перед контрольным заражением или неиммунной мышиной сыворотки (негативный контроль) без комплемента. В тех случаях, когда бактерии в контрольных культурах, инкубируемых с неиммунными сыворотками, в достаточной степени вырастут, при определении микроскопическим способом, проводят точный подсчет клеток путем анализа способом проточной цитометрии. Процедура, используемая для подсчета бактерий, аналогична описанной ранее для анализа ингибирования роста в Примере 10. Разбавление сыворотки, ингибирующее бактериальный рост на 50%, рассчитывают по сравнению с NMS-контролем и обозначают как титр GI-50. Стандартный препарат сыворотки используют для нормирования титров для разных анализов.

Статистический анализ. Сравнивают распределение измеренных параметров сыворотки у инфицированных и защищенных животных с помощью непараметрического U-критерия Манна-Уитни (Graphpad Prism Version 5.0).

Результаты. Из 20 животных, иммунизированных три раза по 0,003 пг rOspA 1/2 и контрольно зараженных 8 природными клещами, 7/20 (35%) были инфицированы. Из-за ограниченного количества клещей было невозможно определить точные показатели инфицирования при контрольном заражении контрольной группы неиммунизированных мышей. Однако такое контрольное заражение не было необходимым для данных исследований, и типично в экспериментах с контрольным заражением природными клещами из Ческе-Будеёвице (Budweis) достигался показатель инфицирования 70-80%.

Были обнаружены существенные различия между защищенными и инфицированными группами по результатам анализов поверхностного связывания (p = 0,007) и ингибирования роста (p = 0,03) (Фигура 20).

Заключение. В данных исследованиях было показано, что существует статистически значимая корреляция между содержанием функционального антитела в мышиной сыворотке во время контрольного заражения и защитой против природной инфекции при заражении 8 клещами на мышь. Измерения интенсивности флуоресценции способом FACS (возбужденная флуоресценция сортированных клеток) живых Borreliae, экспрессирующих OspA типа 2, которая отражает число молекул анти-OspA антител, связанных с поверхностью клеток, проведенные после инкубации бактерий со взятой перед контрольным заражением сывороткой при постоянном разбавлении, наилучшим образом коррелируют с защитой. Титры ингибирования роста также хорошо коррелируют с защитой. В отличие от штаммов Borrelia burgdorferi s.s., для эффективного уничтожения которых необходим комплемент, антиген rOspA1/2 индуцирует антитела, эффективно ингибирующие рост Borrelia даже в отсутствие комплемента.

Результаты исследований, представленных в Примерах 10 и 11, при их совместном рассмотрении, устанавливают in vitro параметры средней интенсивности флуоресценции (MFI) антител, поверхностно-связанных живыми Borreliae и титр GI-50 иммунных мышиных сывороток как “коррелирующие с защитой” в обоих примерах, для которых в настоящее время доступны модели активной защиты мышей (напр., конкретнее, модель заражения иглой для штаммов B. burgdorferi s.s. OspA типа 1 и модель заражения от клещей для штаммов B. afzelii OspA типа 2). Более того, в отсутствие надежных моделей активной защиты для оценки защиты против гомологичных штаммов B. garinii, экспрессирующих OspA типов 3-6, путем умозаключений, вышеуказанные модели могут быть использованы как in vitro “суррогатные маркеры защиты” для оценки защитного потенциала и перекрестного покрытия штаммов различными композициями вакцин к штаммам, экспрессирующим все гомологичные типы OspA вакцины, и даже экспрессирующим гетерологичные типы OspA. Действительно, при проведении исследований с использованием этих анализов функционального иммунного ответа на иммунных сыворотках мышей, иммунизированных 3-компонентной химерной композицией вакцины rOspA, были получены сравнимые величины MFI и титров GI-50 для B. garinii (OspA типов 3, 4, 5, 6) (см. Пример 13), что указывает, при использовании этих суррогатных маркеров защиты, что защитные ответы были также получены против штаммов, для которых в настоящее время не существует модели активной защиты для мышей. Кроме того, путем сравнения иммунных ответов у мышей, иммунизированных (а) индивидуальными химерными антигенами rOspA; или (б) любой одной из возможных комбинаций 2-компонентных композиций вакцин химерных антигенов rOspA; или (в) 3-компонентной композицией химерных антигенов rOspA, удалось показать, что последняя 3-компонентная вакцина была необходима для оптимального охвата штаммов, экспрессирующих OspA типов 1-6 (Пример 14). Более того, путем использования этих in vitro анализов суррогатных маркеров, удалось показать, что иммунные ответы, возникающие после иммунизации мышей композициями 3-компонентных вакцин химерных rOspA (rOspA 1/2, rOspA 6/4 и rOspA 5/3), действительно индуцируют функциональные иммунные ответы на все внутритиповые варианты (или субтипы) типов 1, 2, 3, 5 и 6, испытанных до настоящего времени (см. Пример 15) и даже на гетерологичные типы OspA, отличные от гомологичных OspA типов 1-6, присутствующих в вакцине (см. Пример 16).

Пример 12

Мультивалентная рекомбинантная композиция OspA, содержащая 3 антигена (1/2, 6/4 и 5/3), проявляет высокую иммуногенность на мышах

Оценивают мультивалентную вакцину OspA (rOspA 1/2, rOspA 5/3 и rOspA 6/4) в модели заражения от клещей. Вакцина содержит комбинацию трех рекомбинантных антигенов OspA, содержащих защитные эпитопы из OspA серотипов 1 и 2 (SEQ ID NO: 2), OspA серотипов 6 и 4 (SEQ ID NO: 4) и OspA серотипов 5 и 3 (SEQ ID NO: 6).

Группы по десять самок мышей C3H/HeJ (возраст на момент иммунизации: 11 недель) иммунизируют подкожно в дни 0 и 28 фиксированной дозой 0,3 мкг мультивалентной вакцины (0,1 мкг каждого из rOspA 1/2, rOspA 5/3 и rOspA 6/4). Заражение от клещей выполняют, как описано выше, с использованием клещей из Ческе-Будеёвице (Республика Чехия). Способность природных клещей переносить B.burgdorferi s.l. мышам подтверждают путем контрольного заражения неиммунизированных контрольных животных. Инфекционный статус контрольно-зараженных мышей определяют способами вестерн-блоттинга, ПЦР в реальном масштабе времени и культивацией.

Промежуточные образцы крови берут в день 41 путем орбитальной пункции. Конечные образцы крови (день 70/71) берут пункцией сердца. Индивидуальные сыворотки получают из цельной крови центрифугированием (10 минут; 1000-2000×G; комнатная температура (RT)). Сыворотки хранят при ≤ -20°C до использования.

В этом эксперименте некормленых клещей, взятых из той же партии, которая используется для контрольного заражения мышей, охарактеризовывают для определения общего показателя инфекционности и для подтверждения видов инфицирующих организмов. В случае тестирования 80 нимфальных клещей на присутствие ДНК B.burgdorferi s.l. способом ПЦР в реальном масштабе времени 16S-рРНК, 32,5% (26/80) были инфицированными. Серотип OspA мог быть определен способом ПЦР-ELISA для 22 из 26 инфицированных нимф; 86% (19/22) были типированы как B. afzelii и 14% (3/22) - как B.burgdorferi s.s.

Все неиммунизированные контрольные мыши (100%; 10/10) были инфицированы, в то время как только одна из мышей, иммунизированных мультивалентной вакциной rOspA, была инфицирована (10%; 1/10). Наблюдалось 100% согласие для разных способов, используемых для идентификации инфицированных мышей. Мультивалентная вакцина rOspA обеспечивает статистически высокозначимую защиту (p=0,00012; двусторонний точный критерий Фишера) по сравнению с контрольной группой.

Эти данные показывают, что иммунизация мультивалентной вакциной rOspA, содержащей антиген rOspA 1/2, способна предотвращать инфекцию B. afzelii, видом Borrelia, экспрессирующим OspA серотипа 2. Кроме этого, нет данных, указывающих на то, что включение дополнительных антигенов rOspA имеет антагонистический эффект на защитный иммунитет, создаваемый антигеном rOspA 1/2.

Эта вакцина обеспечивает защиту против переносимой клещами инфекции B. afzelii, эквивалентную наблюдающейся для антиген OspA 1/2; 0,3 мкг вакцины (0,1 мкг каждого антигена) в композиции с 0,2% Al(OH)3 при введении по графику двух доз обеспечивают 90% защиты по результатам определения способами вестерн-блоттинга, культивации Borrelia и детектирования ДНК Borrelia способом ПЦР.

Пример 13

Вакцина, представляющая собой трехкомпонентную вакцину (OspA 1/2, OspA 6/4 и OspA 5/3), индуцирует высокие уровни функциональных анти-OspA антител, которые связываются с и ингибируют рост штаммов Borrelia, экспрессирующих OspA типов 1-6

Поскольку было показано, что как поверхностное связывание (MFI), так и ингибирование роста (титры GI-50) хорошо коррелируют с защитой в модели заражения иглой (B. burgdorferi s.s.) (Пример 10) и в модели заражения мыши от клещей (B. afzelii) (Пример 11), данные исследования были предприняты для определения того, будут ли эквивалентные функциональные иммунные ответы индуцироваться 3-компонентной композицией вакцины химерных антигенов rOspA против B. garinii OspA серотипов 3-6, для которых отсутствует in vivo модель защиты для исследования эффективности вакцины.

Иммунизация мышей. Группы по 10 самок мышей C3H/HeJ иммунизируют подкожно три раза (день 0, день 14, день 28) 1:1:1 смесью rOspA-1/2, rOspA-6/4 и rOspA-5/3) в трех разных дозах (1, 0,1, 0,03 мкг белка на дозу) в сочетании с 0,2% Al(OH)3 в качестве адъюванта. Получают сыворотку из образцов крови, взятых в день 40.

Количественное определение связывания антитела OspA с поверхностью живых Borreliae. В этом анализе выращенные in vitro культуры шести репрезентативных штаммов Borrelia, экспрессирующих OspA типов 1-6 (B. burgdorferi sensu stricto B31/OspA-1; B. afzelii Arcon/OspA-2; B. garinii PBr/OspA-3; B. garinii DK6/OspA-4; B. garinii W/OspA-5; и B. garinii KL11/0spA-6) инкубируют при постоянном разбавлении (1:100) пулами мышиной сыворотки с пиковыми значениями титров при комнатной температуре в присутствии ЭДТА для предотвращения активации комплемента. Последующие процедуры промывки, мечения, детектирования и анализа были аналогичны описанным в Примере 10. Нормальная мышиная сыворотка служит негативным контролем для неспецифического связывания антител.

Анализ ингибирования роста бактерий. Для измерения способности взятой перед контрольным заражением сыворотки ингибировать рост Borreliae, шесть репрезентативных штаммов, экспрессирующих OspA типов 1-6 (B31, Arcon, PBr, DK6, W и KL11) культивируют при 33°C в присутствии серийных разбавлений пулов термоинактивированной сыворотки с пиковыми титрами или неиммунной мышиной сыворотки (негативный контроль). B31 культивируют в присутствии комплемента (сыворотка морской свинки), тогда как остальные пять штаммов тестируют в отсутствие комплемента. Затем снова, анализы ингибирования роста проводят, как описано в Примере 10. Стандартный препарат сыворотки используют для нормирования титров для разных анализов.

Поверхностное связывание и эффективность ингибирования роста анти-OspA гуморального иммунного ответа. Интенсивное флуоресцентное окрашивание со значениями MFI в интервале от 50 до 200 наблюдалось для всех шести штаммов Borrelia при тестировании с тремя пулами сыворотки, полученной от групп с разными дозами иммунизации (1,0, 0,1 и 0,03 мкг белка на дозу) 3-компонентной вакциной при разбавлении 1:100 (Фигура 21). При тестировании пулов сыворотки от групп с 3 разными дозами на их способность ингибировать бактериальный рост, было обнаружено, что 3-компонентная вакцина также индуцирует высокие титры GI-50 ко всем шести типам штаммов OspA, в интервале значений от 1000 (штамм типа 4, доза 0,03 мкг) до 20000 (штамм типа 6).

Заключение. Взятые вместе, эти результаты демонстрируют, что антигены rOspA являются высокоиммуногенными и индуцируют большие количества функциональных антител, которые могут связываться с поверхностью живых Borreliae и ингибировать рост Borreliae. Степень покрытия для шести испытанных штаммов была полной, поскольку наблюдались высокие интенсивности флуоресценции и высокие титры ингибирования роста, сравнимые с уровнями, наблюдаемыми для OspA типов 1 и 2. В итоге, результаты, представленные в данных исследованиях, показывают, что гуморальные ответы, индуцированные трехкомпонентной вакциной rOspA (1/2 + 5/3 + 6/4), приготовленной в виде композиции с Al(OH)3, предотвращают инфекцию штаммами, экспрессирующими OspA типов 1-6, которые, как показали эпидемиологические исследования, теоретически охватывают более 99% изолятов, вызывающих болезни человека в Европе и Северной Америке и, таким образом, являются высокоэффективными для профилактики лайм-боррелиоза.

Пример 14

Вакцина, представляющая собой трехкомпонентную вакцину (OspA 1/2, OspA 6/4 и OspA 5/3), необходима для оптимального охвата Borrelia, экспрессирующих OspA типов 1-6

Целью данных исследований было изучение и сравнение иммуногенности и перекрестного покрытия штаммов по показателям функционального поверхностного связывания и/или ингибирования роста антителами, индуцированными одно- и мультикомпонентными композициями вакцин rOspA лайм-боррелиоза, также с использованием эффективности связывания анти-OspA антител с поверхностью живых Borreliae и ингибирования роста Borreliae in vitro в качестве параметров, коррелирующих с защитой.

Иммунизация мышей. Иммунизируют по десять самок мышей (C3H) на группу 0,1 мкг однокомпонентной вакцины, содержащей антиген rOspA 1/2, rOspA 6/4 антиген или rOspA 5/3 антиген; двухкомпонентной вакцины, содержащей 0,1 мкг обоих антигенов 1/2 + 5/3, антигенов 1/2 + 6/4 или антигенов 5/3 + 6/4; или трехкомпонентной вакцины, содержащей комбинацию 0,1 мкг всех трех 1/2 + 5/3 + 6/4 антигенов с адъювантом 0,2% AI(OH)3, по схеме первичной бустерной дозы. Вакцинация проводилась подкожно с использованием объема дозы 200 мкл в дни 0, 14 и 28. В день 42, индивидуальные образцы крови были взяты у мышей для получения сыворотки.

Анализы поверхностного связывания антител и ингибирования роста. Используют слегка модифицированный вариант анализа поверхностного связывания для определения эффективности связывания анти-OspA IgG с поверхностью живых Borreliae. Серийные разбавления пула сыворотки с определенными титрами MFI включают в анализы для построения калибровочной кривой, по которой определяют относительные титры тестируемых сывороток после интерполяции кривой нелинейной регрессии. Титр MFI стандартной сыворотки индивидуальных штаммов, экспрессирующих OspA типов 1-6, определяют как наибольшее разбавление, при котором определяемая интенсивность флуоресценции Borreliae по меньшей мере в 3 раза превышает интенсивность флуоресценции, наблюдаемую для нормальной мышиной сыворотки. Все определения проводят с двумя параллельными измерениями.

Диаграммы рассеяния, представленные на Фигуре 22, сравнивают титры MFI для шести штаммов, экспрессирующих гомологичные OspA типов, наблюдаемых для иммунных сывороток индивидуальных C3H мышей после иммунизации отдельно взятыми антигенами rOspA или комбинациями антигенов rOspA. Результаты показали, что композиция, содержащая все три антигена rOspA (1/2, 5/3 и 6/4), была необходима для индуцирования высоких титров MFI против всех шести штаммов Borrelia, экспрессирующих OspA типов 1-6, и что композиции, состоящие из двух антигенов rOspA (т.е. охватывающие четыре штамма), не обеспечивали полное покрытие для штаммов, экспрессирующих два типа OspA, не присутствующие в композиции.

Для определения эффективности различных комбинаций вакцин по индуцированию антитела, ингибирующего рост, шесть репрезентативных штаммов Borreliae (B31, Arcon, PBr, DK6, W, KL11), экспрессирующих OspA типов 1-6, соответственно, культивируют при 33°C в присутствии пулов термоинактивированной иммунной или неиммунной мышиной сыворотки. Все сыворотки испытывают при единственном разбавлении. Использовали следующие разбавления: B31, PBr и KL11 1:200, Arcon, DK6 и W 1:100. PBr культивируют в отсутствие 20% комплемента, в то время как другие 5 штаммов испытывают в присутствии комплемента. Комплемент детенышей кролика используют для DK6, W и KL11, и сыворотку морской свинки используют для B31 и Arcon. Когда бактерии в контрольных культурах, инкубируемые с неиммунными сыворотками, вырастут в достаточной степени, при определении микроскопическим способом, проводят точный подсчет клеток, как описано ранее (см. Пример 10). Процент ингибирования роста бактерий рассчитывают по результатам подсчета клеток, полученным для тестируемой сыворотки, по сравнению с контролем нормальной мышиной сыворотки. Общее ингибирование роста, наблюдаемое для разных испытываемых композиций, затем представляют (Фигура 23) как число животных в разных группах по десять мышей C3H, которые продемонстрировали более чем 50% ингибирования роста. Результаты продемонстрировали, что 3-компонентная композиция была единственной композицией, способной индуцировать высокие титры ингибирующих рост антител против всех шести репрезентативных штаммов, экспрессирующих OspA типов 1-6 (Фигура 23). Во всех случаях, 3-компонентная композиция вакцины обеспечивала >50% ингибирования роста у >90% иммунизированных животных. 2-Компонентные композиции вакцин не обеспечивали полного покрытия для двух штаммов, экспрессирующих OspA типов, не присутствующих в вакцине. Композиция, содержащая rOspA 1/2 + 6/4, не покрывает штамм типа 3; композиция, содержащая комбинацию rOspA 1/2 + 5/3, не покрывает типы 4 или 6; и композиция, содержащая rOspA 5/3 + 6/4, не покрывает тип 1.

Пример 15

Мультивалентные композиции вакцины OspA охватывают Borrelia, экспрессирующие внутритиповые варианты или субтипы OspA типов 1-6

Хотя в качестве основы для разработки и конструирования мультивалентной вакцины rOspA были выбраны OspA Borrelia типов 1-6, были также выделены Borreliae, экспрессирующие варианты белка OspA типов 1, 2, 3, 5 и 6. Такие варианты, хотя и классифицированные как принадлежащие к одному и тому же типу, имеют слегка измененные генные последовательности нуклеотидов и аминокислотные последовательности белков. Таким образом, существуют внутритиповые варианты или субтипы OspA типов 1, 2, 3, 5 и 6 (см. Фигуру 24). До настоящего времени не было обнаружено внутритиповых вариантов или субтипов для OspA типа 4.

Целью данных исследований было подтверждение того, что иммунная сыворотка, полученная при иммунизации мышей 3-компонентной мультивалентной вакциной rOspA, содержит функциональные антитела, которые могут связываться с поверхностью живых Borreliae, экспрессирующих такие внутритиповые варианты или субтипы.

Для данных исследований получают пул мышиной иммунной сыворотки путем иммунизации 70 самок C3H мышей три раза по 0,3 мкг 3-компонентной мультивалентной вакцины rOspA в дни 0, 14 и 28. В день 42, мышей обескровливают и сыворотку получают и объединяют в пул. Пул иммунной сыворотки затем используют для тестирования связывания антител с поверхностью живых Borreliae. Культуры Borrelia инкубируют с пулом иммунной сыворотки или контрольной нормальной мышиной сывороткой в разбавлении 1:100 с двумя параллельными измерениями и интенсивности флуоресценции измеренного для Borreliae связывания анти-OspA антител с бактериями контролируют с помощью анализов способом FACS, как описано выше.

Высокие уровни поверхностного связывания антитела (определяемые как интенсивность флуоресценции, более чем в 10 раз превышающая наблюдаемую для контрольной сыворотки неиммунизированных мышей) при разбавлении сыворотки 1:100 наблюдались для большинства штаммов, экспрессирующих OspA субтипов 1-6. В частности, высокие уровни связывания антител наблюдались для штаммов Borreliae, экспрессирующих субтипы OspA 1a, 1b, 1c, 1d, 1f, 1h, 1J, 1k и 1l; 2a, 2b, 2e, 2g, 2k, 2l и 2n; 3a, 3c, 3d и 3e; 5a и 5c; и 6a, 6e, 6f, 6g и 6k (Фигура 24). Более слабое связывание (определяемое как интенсивность флуоресценции, в 2-10 раз превышающая наблюдаемую для контрольной сыворотки неиммунизированных мышей) наблюдалось для штаммов Borreliae, экспрессирующих субтипы OspA 1g, 2j, 2m, 3b, 5d и 6l (Фигура 24), но такое слабое связывание было вызвано преимущественно низкой экспрессией белка OspA в используемых условиях роста.

Заключение. 3-компонентная химерная вакцина rOspA индуцирует функциональные связывающиеся с поверхностью антитела против всех внутритиповых вариантов или субтипов OspA типов 1, 2, 3, 5 и 6 у C3H мышей.

Пример 16

Мультивалентная композиция вакцины OspA обеспечивает защиту против других типов Borrelia, в дополнение к экспрессирующим OspA типов 1-6

Целью данных исследований было определение того, будет ли 3-компонентная композиция вакцины химерных антигенов rOspA (содержащая все 3 химерных антигена - 1/2, 6/4 и 3/5) также обеспечивать защиту против Borrelia, экспрессирующих OspA типов, отличных от гомологичных OspA типов 1-6. 40 C3H мышей иммунизируют три раза по 0,3 мкг 3-компонентной вакцины в дни 0, 14 и 28. В день 42, мышей обескровливают и готовят пул сыворотки, который используют для оценки эффективности поверхностного связывания и ингибирования роста против штаммов, экспрессирующих гетерологичные типы OspA.

Результаты этих исследований показали, что 3-компонентная химерная вакцина rOspA действительно индуцирует антитела, которые связываются с поверхностью Borreliae и ингибируют рост других типов Borreliae, включая штаммы B. spielmanii, B. valaisiania, B. lusitaniae и B. japonica (см. Таблицу 9). В случае B. garinii, экспрессирующего OspA типа 7 наблюдалось только слабое поверхностное связывание и незначительное ингибирование роста или его отсутствие; однако это слабое связывание и маленькая величина ингибирования роста могут быть вызваны низкими уровнями экспрессии OspA в используемых условиях культуры in vitro, а не отсутствием связывания антител иммунной сыворотки.

Таблица 9
Поверхностное связывание и ингибирование роста других типов Borreliae
Генотип B.g. OspA-7 B. spielmanii B. valaisiana B. lusitaniae B. japonica
Поверхностное связывание (+) + + + +
Ингибирование роста - + + + +
+: значительное поверхностное связывание и/или ингибирование роста
-: отсутствие значительное связывания/ингибирования роста
(+-): низкая интенсивность поверхностного связывания

Пример 17

Мультивалентные композиции вакцины OspA индуцируют антитела к общему эпитопу на N-конце молекулы OspA, которые могут способствовать защите против любого штамма Borrelia, экспрессирующего OspA

В ходе исследований защитной эффективности композиций мультивалентных химерных rOspA, было получено моноклональное антитело (F237/BK2) против 2-компонентной вакцины rOspA, содержащей rOspA-1/2 и rOspA-6/4. Способом анти-OspA ELISA было показано, что F237/BK2 связывается со всеми исследованными на сегодня типами OspA (OspA типов 1-7), а также с 3 химерными антигенами rOspA (rOspA-1/2, rOspA-5/3 и rOspA-6/4) Такие результаты показывают, что F237/BK2 распознает общий эпитоп, присутствующий во всех молекулах OspA. Более того, предварительные исследования по картированию эпитопа показывают, что этот общий эпитоп расположен в менее вариабельной N-концевой половине молекулы (т.е. в сторону N-конца от аминокислоты 130), где обычно наблюдается гомологичность последовательностей OspA.

Интересно, что было также продемонстрировано связывание F237/BK2 с поверхностью Borreliae, экспрессирующих гомологичные OspA типов 1-6 и гетерологичные типы OspA, включая экспрессируемые B. spielmanii, B. valaisiania и B. japonica, хотя и менее эффективное, чем для моноклональных антител, направленных против специфических эпитопов C-концевого типа. Было также обнаружено, с использованием способов, аналогичных описанным в предыдущих примерах, что F237/BK2 ингибирует рост репрезентативных штаммов, экспрессирующих OspA типов 1, 2, 4, 5 и 6.

При испытаниях F237/BK2 в in vivo модели пассивной защиты на мышах наблюдали, что F237/BK2 создает защиту против заражения природными клещами, соответствующего контрольному заражению B. afzelii типа 2. Собирают в Вундшу (Wundschuh) (Штирия, Австрия) клещей, о которых известно, что они инфицированы преимущественно B. afzelii. Десяти самкам C3H мышей делают интраперитонеально инъекции 500 мкг аффинно-очищенного mAb F237/BK2. Через два часа сажают 10 пассивно иммунизированным мышам по 8 клещей на животное, а также 10 псевдо-иммунизированным животным. Через четыре дня накормленных клещей удаляют. В день 90 мышей умерщвляют и анализируют на инфекцию с помощью серологического тестирования, ПЦР-анализа и культуры Borrelia, как описано выше. В группе, получавшей F237/BK2, ни одно животное не было инфицировано, в то время как в контрольной группе 5 животных (50%) были инфицированы B. afzelii. Таким образом, моноклональное антитело F237/BK2 обеспечивает статистически значимую (p = 0,0325) пассивную защиту против заражения от клещей по сравнению с псевдо-иммунизированными контрольными мышами. Это первое сообщение о том, что моноклональное антитело, которое связывается с общим эпитопом в N-концевой половине молекулы, принимает участие в защите. Более того, если вакцина может индуцировать антитела, распознающие такой общий эпитоп, то такое антитело будет несомненно усиливать перекрестную эффективность защиты вакцины.

Для проверки того, действительно ли такие антитела индуцируются 3-компонентными композициями вакцин химерных rOspA, проводили анализ ингибирования моноклональным антителом способом ELISA с использованием пероксидаза-меченного F237/BK2. В этих экспериментах белок GST-OspA типа 3 используют в качестве покрывающего антигена и нормальную мышиную сыворотку или пул сыворотки C3H мышей, иммунизированных три раза 3-компонентной химерной вакциной rOspA, добавляют в лунки при разбавлении 1:100. Через шестьдесят минут прибавляют пероксидаза-меченный F237/BK2 в предварительно оптимизированной концентрации для получения в конечном счете величины оптической плотности (OD), равной приблизительно 1 для контрольной неингибирующей нормальной мышиной сыворотки, и инкубацию продолжают в течение еще 60 мин. Наконец, планшеты для ELISA промывают и проявляют субстратом TMB.

С помощью такого анализа ингибирования моноклонального антитела способом ELISA можно продемонстрировать, что 3-компонентная композиция химерного rOspA действительно индуцирует антитела, которые связываются с эпитопом, идентичным с или очень близким к эпитопу, распознаваемому mAb F237/BK2. Значения OD были значительно сниженными (напр., типично, на 20-30%) анти-OspA иммунными сыворотками по сравнению с контрольной неингибирующей нормальной мышиной сывороткой.

Заключение. Данные исследования показывают, что 3-компонентная химерная вакцина rOspA способна индуцировать как типоспецифический, так и широкий перекрестный защитный иммунный ответ.

Пример 18

Дополнительные синтетические молекулы нуклеиновой кислоты и полипептида OspA

Целью исследований было конструирование дополнительных новых антигенов OspA, включающих серотипы 1 и 2, 6 и 4 и 5 и 3, соответственно. Были сконструированы три синтетических гена OspA (SEQ ID NOS: 168 (orig sOspA 1/2), 170 (orig sOspA 6/4) и 172 (orig sOspA 5/3)), кодирующие полипептидные молекулы OspA с защитными эпитопами OspA серотипов 1 и 2 (orig sOspA 1/2), OspA серотипов 6 и 4 (orig sOspA 6/4) и OspA серотипов 5 и 3 (orig sOspA 5/3) Borrelia. Первичные аминокислотные последовательности этих молекул (SEQ ID NOS: 169, 171 и 173, соответственно) приведены в Таблице 1. Эти последовательности представляют собой исходные химерные конструкты, т.е. без мутаций и без оптимизации кодонов.

Пример 19

Мультивалентная композиция рекомбинантных OspA, содержащая 3 антигена (1/2, 6/4 и 5/3), является иммуногенной на мышах

Мультивалентную вакцину OspA, содержащую композиции исходных конструктов без оптимизации кодонов и без мутаций (orig OspA 1/2, orig OspA 5/3 и orig OspA 6/4), оценивают в модели заражения от клещей. Вакцина содержит комбинацию трех рекомбинантных антигенов OspA, содержащих защитные эпитопы OspA серотипов 1 и 2 (SEQ ID NO: 169), OspA серотипов 6 и 4 (SEQ ID NO: 171) и OspA серотипов 5 и 3 (SEQ ID NO: 173).

Группы по десять самок мышей C3H/HeJ (возраст на момент иммунизации: 11 недель) иммунизируют подкожно в дни 0 и 28 фиксированной дозой 0,3 мкг мультивалентной вакцины (по 0,1 мкг каждого из orig OspA 1/2, orig OspA 5/3 и orig OspA 6/4). Заражение от клещей проводят, как описано выше, с использованием клещей из Ческе-Будеёвице (Республика Чехия). Способность природных клещей переносить B.burgdorferi s.l. мышам подтверждают путем контрольного заражения неиммунизированных контрольных животных. Инфекционный статус контрольно-зараженных мышей определяется способами вестерн-блоттинга, ПЦР в реальном масштабе времени и культивации.

Промежуточные образцы крови берут в день 41 путем орбитальной пункции. Конечные образцы крови (день 70/71) собирают пункцией сердца. Индивидуальные сыворотки получают из цельной крови центрифугированием (10 минут; 1000-2000×G; комнатная температура). Сыворотки хранят при ≤ -20°C до использования.

В этом эксперименте некормленых клещей, взятых из той же партии, что и используемые для контрольного заражения мышей, охарактеризовывают для определения общего показателя инфекционности и для подтверждения вида инфицирующих организмов.

Пример 20

Вакцина, содержащая трехкомпонентную вакцину (orig OspA 1/2, orig OspA 6/4 и orig OspA 5/3), индуцирует высокие уровни функциональных анти-OspA антител, которые связываются с и ингибируют рост штаммов Borrelia, экспрессирующих OspA типов 1-6

Результаты, представленные в Примере 13, показывают, что гуморальные ответы, индуцированные трехкомпонентной вакциной rOspA (lipB sOspA1/2 + lipB sOspA 5/3 + lipB sOspA 6/4), приготовленной в виде композиции с Al(OH)3, предотвращают инфекцию штаммами, экспрессирующими OspA типов 1-6 и, таким образом, являются эффективными при профилактике лайм-боррелиоза. Таким образом, данные исследования проводятся для определения того, будут ли индуцироваться эквивалентные функциональные иммунные ответы трехкомпонентной вакциной OspA, содержащей химерные исходные (orig) антигены OspA (orig sOspA1/2 + orig sOspA 5/3 + orig sOspA 6/4).

Иммунизация мышей. Группы по 10 самок мышей C3H/HeJ иммунизируют подкожно три раза (день 0, день 14, день 28) 1:1:1 смесью orig sOspA1/2 + orig sOspA 5/3 + orig sOspA 6/4) в трех разных дозах (1, 0,1, 0,03 мкг белка на дозу), в сочетании с 0,2% Al(OH)3 в качестве адъюванта. Сыворотку получают из образцов крови, взятых в день 40.

Количественное определение связывания антитела OspA с поверхностью живых Borreliae. В этом анализе выращенные in vitro культуры шести репрезентативных штаммов Borrelia, экспрессирующих OspA типов 1-6 (B. burgdorferi sensu stricto B31/OspA-1; B. afzelii Arcon/OspA-2; B. garinii PBr/OspA-3; B. garinii DK6/OspA-4; B. garinii W/OspA-5; и B. garinii KL11/0spA-6) инкубируют при постоянном разбавлении (1:100) пулами мышиной сыворотки с пиковыми значениями титров при комнатной температуре в присутствии ЭДТА для предотвращения активации комплемента. Последующие процедуры промывки, мечения, детектирования и анализа аналогичны описанным в Примерах 10 и 13. Нормальная мышиная сыворотка служит негативным контролем для неспецифического связывания антител.

Анализ ингибирования роста бактерий. Для измерения способности взятой перед контрольным заражением сыворотки ингибировать рост Borreliae, шесть репрезентативных штаммов, экспрессирующих OspA типов 1-6 (B31, Arcon, PBr, DK6, W и KL11) культивируют при 33°C в присутствии серийных разбавлений пулов термоинактивированной сыворотки с пиковыми титрами или неиммунной мышиной сыворотки (негативный контроль). B31 культивируют в присутствии комплемента (сыворотка морской свинки), тогда как остальные пять штаммов тестируют в отсутствие комплемента. Анализы ингибирования роста проводят, как описано в Примерах 10 и 13. Стандартный препарат сыворотки используется для нормирования титров для разных анализов.

Поверхностное связывание и эффективность ингибирования роста анти-OspA гуморального иммунного ответа. Флуоресцентное окрашивание измеряют для всех шести штаммов Borrelia при тестировании с тремя пулами сыворотки, полученной от групп с разными дозами иммунизации (1,0, 0,1 и 0,03 мкг белка на дозу) 3-компонентной вакцины при разбавлении 1:100.

Пример 21

Вакцина, содержащая трехкомпонентную вакцину (OspA 1/2, OspA 6/4 и OspA 5/3), необходима для оптимального покрытия Borrelia, экспрессирующих OspA типов 1-6

Целью данных исследований является исследование и сравнение иммуногенности и перекрестного покрытия штаммов для способных к функциональному поверхностному связыванию и/или ингибированию роста антител, индуцированных одно- и мультикомпонентными композициями вакцины лайм-боррелиоза orig sOspA, с использованием эффективности связывания анти-OspA антител с поверхностью живых Borreliae и ингибирования роста Borreliae in vitro в качестве параметров, коррелирующих с защитой.

Иммунизация мышей. Десять самок мышей (C3H) на группу иммунизируют 0,1 мкг однокомпонентной вакцины, содержащей антиген orig sOspA1/2, антиген orig sOspA 5/3 или антиген orig sOspA 6/4; двухкомпонентной вакцины, содержащей 0,1 мкг обоих из антигенов 1/2 + 5/3, антигенов 1/2 + 6/4 или антигенов 5/3 + 6/4; или трехкомпонентной вакцины, содержащей комбинацию 0,1 мкг всех трех антигенов 1/2 + 5/3 + 6/4 с адъювантом 0,2% AI(OH)3 по схеме первичной бустерной дозы. Вакцинацию проводят подкожно с использованием объема дозы 200 мкл в дни 0, 14 и 28. В день 42 у мышей берут индивидуальные образцы крови для получения сыворотки.

Поверхностное связывание антител и анализы ингибирования роста. Слегка модифицированный вариант анализа поверхностного связывания, описанного выше, используется для определения эффективности связывания анти-OspA IgG с поверхностью живых Borreliae. Серийные разбавления пула сыворотки с определенными титрами MFI включают в анализы для построения калибровочной кривой, по которой определяют относительные титры тестируемых сывороток после интерполяции кривой нелинейной регрессии. Титр MFI стандартной сыворотки для индивидуальных штаммов, экспрессирующих OspA типов 1-6, определяется как наибольшее разбавление, при котором определяемая интенсивность флуоресценции Borreliae по меньшей мере в 3 раза превышает интенсивность флуоресценции, наблюдаемую для нормальной мышиной сыворотки. Все определения проводятся с двумя параллельными измерениями.

Для определения активности различных комбинаций вакцин при индуцировании ингибирующих рост антител, шесть репрезентативных штаммов Borreliae (B31, Arcon, PBr, DK6, W, KL11), экспрессирующих OspA типов 1-6, соответственно, культивируют при 33°C в присутствии пулов термоинактивированной иммунной или неиммунной мышиной сыворотки. Все сыворотки анализируют при единственном разбавлении. Используются следующие разбавления: B31, PBr и KL11 - 1:200, Arcon, DK6 и W - 1:100. PBr культивируют в отсутствие 20% комплемента, в то время как другие 5 штаммов тестируют в присутствии комплемента. Для DK6, W и KL11 используют комплемент детенышей кролика, а для B31 и Arcon используют сыворотку морской свинки. Когда бактерии в контрольных культурах, инкубируемые с неиммунными сыворотками, вырастут в достаточной степени, при определении микроскопическим способом, проводят точные подсчеты клеток, как описано ранее (см. Пример 10). Процент ингибирования роста бактерий рассчитывают по результатам подсчета клеток, полученным для исследуемой сыворотки, по сравнению с контрольной нормальной мышиной сывороткой. Общее ингибирование роста, наблюдаемое для разных испытываемых композиций, представляют затем как число животных в разных группах по десять C3H-мышей, продемонстрировавших более 50% ингибирования роста.

Пример 22

Мультивалентная композиция вакцины OspA обеспечивает покрытие Borrelia, экспрессирующих внутритиповые варианты или субтипы OspA типов 1-6

Целью данных исследований было подтверждение того, что иммунная сыворотка, полученная в результате иммунизации мышей 3-компонентной мультивалентной вакциной orig OspA (orig sOspA 1/2, orig sOspA 6/4 и orig sOspA 5/3), содержит функциональные антитела, которые могут связываться с поверхностью живых Borreliae, экспрессирующих такие внутритиповые варианты или субтипы.

Для данных исследований готовят пул мышиной иммунной сыворотки путем иммунизации 70 самок C3H мышей три раза по 0,3 мкг 3-компонентной мультивалентной вакцины orig OspA в дни 0, 14 и 28. В день 42 мышей обескровливают, получают сыворотку и объединяют. Пул иммунной сыворотки затем используют для тестирования связывания антител с поверхностью живых Borreliae. Культуры Borrelia инкубируют с пулом иммунной сыворотки или контрольной нормальной мышиной сывороткой в разбавлении 1:100 с двумя параллельными измерениями и интенсивности флуоресценции Borreliae при измерениях связывания анти-OspA антител с бактериями контролируют с помощью анализов способом FACS, как описано выше.

Изобретение было описано на примере конкретных вариантов воплощения, подтвержденно или предположительно включающих конкретные способы реализации данного изобретения. Различные модификации и варианты описанного изобретения будут очевидны квалифицированным специалистам в данной области техники без выхода за пределы объема и сущности изобретения. Хотя изобретение было описано в связи с конкретными вариантами воплощения, следует понимать, что заявляемое изобретение не должно ненадлежащим образом ограничиваться такими конкретными вариантами воплощения. Вместо этого, различные модификации описанных способов осуществления изобретения, очевидные для квалифицированных специалистов в соответствующих областях техники, должны рассматриваться как входящие в объем приложенной формулы изобретения.

1. Молекула нуклеиновой кислоты, выбранная из группы, состоящей из:
(a) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью с по меньшей мере 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности к полноразмерной нуклеотидной последовательности, приведенной в SEQ ID NO: 1, SEQ ID NO: 3 или SEQ ID NO: 5;
(b) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью, выбранной из группы, состоящей из последовательностей, приведенных в SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9 или SEQ ID NO: 11;
(c) молекулы нуклеиновой кислоты, состоящей из нуклеотидной последовательности, выбранной из группы, состоящей из последовательностей, приведенных в SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9 или SEQ ID NO: 11;
(d) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью, кодирующей полипептид с по меньшей мере 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности к полноразмерному полипептиду, содержащему аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6;
(e) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит замещение от одной до 10 аминокислот;
(f) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит инсерцию от одной до 10 аминокислот;
(g) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит делецию от одной до 10 аминокислот;
(h) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит С- и/или N-концевое усечение от одной до 10 аминокислот; и
(i) молекулы нуклеиновой кислоты, характеризующейся нуклеотидной последовательностью, кодирующей полипептид, содержащий аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6, причем полипептид содержит модификацию от одной до 10 аминокислот, выбранную из аминокислотных замещений, аминокислотных инсерций, аминокислотных делеций, С-концевого усечения или N-концевого усечения; и
(j) молекулы нуклеиновой кислоты, состоящей из нуклеотидной последовательности, кодирующей полипептид, который содержит аминокислотную последовательность, приведенную в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6;
где молекула нуклеиновой кислоты кодирует иммуногенный полипептид, способный вызвать специфичный иммунный ответ против бактерий рода Borrelia.

2. Экспрессионный вектор, содержащий молекулу нуклеиновой кислоты по п. 1.

3. Клетка-хозяин, содержащая вектор по п. 2 для экспрессии полипептида, способного вызвать специфичный иммунный ответ против бактерий рода Borrelia.

4. Способ получения полипептида, включающий культивирование клетки-хозяина по п. 3 в условиях, пригодных для экспрессии полипептида.

5. Композиция, содержащая молекулу нуклеиновой кислоты по п. 1 и фармацевтически приемлемый носитель, способная вызвать специфичный иммунный ответ против бактерий рода Borrelia.

6. Композиция, содержащая по меньшей мере две молекулы нуклеиновой кислоты по п. 1 и фармацевтически приемлемый носитель, где молекулы нуклеиновой кислоты с разными нуклеотидными последовательностями, способная вызвать специфичный иммунный ответ против бактерий рода Borrelia.

7. Композиция по п. 6, где композиция содержит комбинацию нуклеотидных последовательностей, приведенных в SEQ ID NO: 1, 3 и 5.

8. Полипептид, выбранный из группы, состоящей из:
(a) полипептида, характеризующегося аминокислотной последовательностью, с по меньшей мере 91, 92, 93, 94, 95, 96, 97, 98 или 99 процентами идентичности последовательности к полноразмерной аминокислотной последовательности, приведенной в SEQ ID NO: 2, SEQ ID NO: 4 или SEQ ID NO: 6;
(b) полипептида, характеризующегося аминокислотной последовательностью, приведенной в SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12; или
(c) полипептида, состоящего из аминокислотной последовательности, приведенной в SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12,
где полипептид способен вызвать специфичный иммунный ответ против бактерий рода Borrelia.

9. Композиция, содержащая полипептид по п. 8 и фармацевтически приемлемый носитель, где композиция способна вызвать специфичный иммунный ответ против бактерий рода Borrelia.

10. Композиция, содержащая по меньшей мере два из полипептидов по п. 8 и фармацевтически приемлемый носитель, где полипептиды с разными последовательностями, где композиция способна вызвать специфичный иммунный ответ против бактерий рода Borrelia.

11. Композиция по п. 10, где композиция содержит комбинацию полипептидов, содержащих аминокислотные последовательности, приведенные в SEQ ID NO: 2, 4 и 6.

12. Иммуногенная композиция, способная вызвать специфичный иммунный ответ против бактерий рода Borrelia, содержащая композицию по любому из пп. 5-7 и 9-11 и фармацевтически приемлемый носитель.

13. Иммуногенная композиция по п. 12, где композиция выбрана из группы, состоящей из:
(a) композиции, способной индуцировать продуцирование антитела, которое специфически связывается с внешним поверхностным белком A (OspA);
(b) композиции, способной индуцировать продуцирование антитела, которое специфически связывается с Borrelia;
(c) композиции, способной индуцировать продуцирование антитела, которое нейтрализует Borrelia;
(d) композиции, в которой Borrelia является Borrelia burgdorferi sensu lato;
(e) композиции, в которой Borrelia является Borrelia afzelii, Borrelia garinii или Borrelia burgdorferi sensu stricto;
(f) композиции, в которой Borrelia является Borrelia japonica, Borrelia andersonii, Borrelia bissettii, Borrelia sinica, Borrelia turdi, Borrelia tanukii, Borrelia valaisiana, Borrelia lusitaniae, Borrelia spielmanii, Borrelia miyamotoi или Borrelia lonestar.

14. Вакцинная композиция, способная вызвать специфичный иммунный ответ против бактерий рода Borrelia, содержащая иммуногенную композицию по п. 12 или 13 и фармацевтически приемлемый носитель.

15. Комбинированная вакцина, способная вызвать специфичный иммунный ответ против бактерий рода Borrelia, содержащая вакцинную композицию по п. 14 в сочетании с по меньшей мере второй вакцинной композицией.

16. Комбинированная вакцина по п. 15, где вторая вакцинная композиция защищает от переносимой клещами болезни.

17. Комбинированная вакцина по п. 16, где переносимой клещами болезнью является пятнистая лихорадка Скалистых гор, бабезиоз, возвратная лихорадка, колорадская клещевая лихорадка, моноцитарный эрлихиоз человека (НМЕ), гранулоцитарный эрлихиоз человека (HGE), клещевая сыпная лихорадка STARI, туляремия, клещевой паралич, энцефалит Повассан, ку-лихорадка, конго-крымская геморрагическая лихорадка, цитауксзооноз, марсельская лихорадка или клещевой энцефалит.

18. Комбинированная вакцина по п. 16, где вторая вакцинная композиция является вакциной, выбранной из группы, состоящей из: вакцины клещевого энцефалита, вакцины японского энцефалита и вакцины пятнистой лихорадки Скалистых гор.

19. Комбинированная вакцина по п. 15, где вторая вакцинная композиция имеет сезонный график иммунизации, совместимый с иммунизацией против инфекции Borrelia или лаймской болезни.

20. Иммуногенная композиция по п. 12 или 13 для индуцирования иммунологического ответа.

21. Композиция по п. 20, где иммунологический ответ включает продуцирование антитела к OspA.

22. Вакцинная композиция по п. 14 или комбинированная вакцина по любому из пп. 15-19 для профилактики или лечения инфекции Borrelia или лаймской болезни.

23. Композиция по любому из пп. 12-14 или комбинированная вакцина по любому из пп. 15-19 для применения в качестве лекарственного средства.

24. Способ по п. 4, дополнительно включающий стадию выделения полипептида из культуры.



 

Похожие патенты:

Представленная группа изобретений касается слитых белков, нуклеиновых кислот, кодирующих такие белки, экспрессирующей кассеты, обеспечивающей экспрессию нуклеиновой кислоты, вектора, включающего такую кассету, способа диагностики in vitro-боррелиоза, набора для такой диагностики, в которых используют упомянутые белки, а также вакцинной композиции для профилактики боррелиоза, включающей такие белки.

Изобретения относятся к химерным белкам, нуклеиновой кислоте, кодирующей такой белок, экспрессирующей кассете, обеспечивающей экспрессию нуклеиновой кислоты, вектора, включающего экспрессирующую кассету, способу диагностики и набора для диагностики.

Изобретение относится к области клинической лабораторной диагностики, биотехнологии и медицины и касается диагностической тест-системы в формате иммуночипа (биологического чипа) и способа диагностики сифилиса с использованием данного иммуночипа, позволяющего одновременно и дифференциально выявлять реагиновые и трепонемоспецифические антитела (антитела к Treponema pallidum) разных классов.

Изобретение относится к области медицины, конкретно, настоящее изобретение относится к новым неинвазивным способам определения присутствия или отсутствия в биологическом образце антигена Helicobacter pylori или метаболита, продуцируемого бактерией, посредством измерения на основе биосенсора.

Изобретение относится к биотехнологии и касается рекомбинантного полипептида, представляющего собой поверхностно-проявляющийся антиген Helicobacter pylori с приблизительной молекулярной массой 29 кДа, и фрагментов нуклеиновых кислот, кодирующих указанный антиген.
Изобретение относится к медицине, в частности к неврологии и стоматологии, и может быть использовано для лечения патологического гипертонуса жевательных мышц. В коже правой и левой лицевой части головы пациента определяют область планируемой инъекции с помощью тепловизора либо при электромиографии, после этого осуществляют пальпацию мягких тканей в глубине всей избранной области, выявляют наличие и количество в ней участков повышенной и болезненной твердости, конкретизируют их локализацию, форму, размеры, объем.

Изобретение относится к медицине, в частности косметологии, дерматологии, пластической хирургии, и предназначено для улучшения состояния кожных покровов, а также для устранения морщин на лице.

Изобретение касается вакцины для предупреждения инфекции, вызванной по меньшей мере одним из Leptospira, герпес-вируса коров, вируса парагриппа и коровьего респираторного синцитиального вируса.

Изобретения относятся к области биотехнологии и касаются штамма Francisella tularensis 15/23-1ΔrecA и способа его получения. Охарактеризованный штамм является генетически маркированным: имеет только одну копию гена iglC и делетированный ген recA.

Изобретение относится к медицине, а именно для использования в области иммунологии, и касается индуктора гамма интерферона. Для этого применяют экзополисахарид бактерий P.nigrifaciens штамма КММ 156 в качестве индуктора IFN-γ.

Настоящее изобретение относится к области молекулярной иммунологии, биотехнологии и медицины. Создана рекомбинантная псевдоаденовирусная частица, на основе генома аденовируса человека 5 серотипа, содержащая экспрессирующую кассету со вставкой гена модифицированного химерного наноантитела, связывающегося с микоплазмой M.

Изобретение относится к области биотехнологии, микробиологии и иммунологии. Описан полисахарид клеточной стенки энтерококков.

Настоящее изобретение относится к биотехнологии и представляет собой α1,6-глюкан-содержащее соединение Helicobacter pylori. Настоящее изобретение также раскрывает конъюгат для индукции иммунного ответа против H.pylori, содержащий указанное соединение, конъюгированное с белком-носителем.
Изобретение относится к медицине, а именно к диагностике риккетсиозов, и может быть использовано для выявления антител к риккетсиям Провачека и коксиеллам Бернета в сыворотке крови людей, а также при изучении иммунологической структуры населения и проверке эффективности вакцинации.

Изобретения относятся к области биотехнологии и касаются cпособа предотвращения или лечения заболевания у субъекта, вызванного патогенным организмом, путем введения вакцинной композиции, вакцинной композиции и ее применения.
Наверх