Рекомбинантный белок rec-mp, содержащий в своем составе последовательности миелопептидов для лечения вторичных иммунодефицитных состояний

Изобретение относится к области биотехнологии, в частности к получению рекомбинантного белка, содержащего в своем составе последовательности миелопептидов, и может быть использовано для лечения вторичных иммунодефицитов. Рекомбинантный белок (REC-MP) конструируют чередованием коротких активных миелопептидов МП-1 (FLGFPT), МП-2 (LVVYPW), МП-3 (LVCYPQ) и МП-4 (FRPRMTP), перемежающихся сайтами распознавания тромбином и урокиназой. Изобретение позволяет повысить эффективность лечения вторичных иммунодефицитов путем более выраженной стимуляции антителообразования, увеличения количества В-лимфоцитов, экспрессирующих на своей поверхности CD25 и CD69. 4 з.п. ф-лы, 4 ил., 2 табл., 6 пр.

 

Изобретение относится к области биотехнологии, в частности к получению рекомбинантного белка, содержащего в своем составе последовательности миелопептидов (rec-МР) с целью использования для лечения вторичных иммунодефицитов.

Одной из важных медицинских проблем нашего времени является распространение вторичных иммунодефицитных состояний (ВИДС), обусловленных воздействием неблагоприятных факторов внешней среды. Вторичные ИДС могут провоцировать: травмы физической, химической и биологической природы, плохая экология, эндокринопатии (сахарный диабет, гипотиреоз и др.), оперативное вмешательство (наркоз + стресс + травма), лекарства (глюкокортикоиды, антибиотики, цитостатики и другие иммунодепрессанты), дефекты питания, стресс-синдром и т.д. Для лечения вторичных ИДС в настоящее время используется более 30 различных препаратов [Стандарты диагностики и лечения «Иммунология и аллергология», 2001]. Однако, с каждым годом расширяющийся спектр различных поражений иммунной системы быстро изменяющимися неблагоприятными факторами внешней среды требует разработки новых лекарственных средств для ее восстановления.

В основе методов медикаментозного лечения вторичных иммунодефицитов лежит представление о том, что изменения абсолютного или относительного количества клеток, участвующих в иммунных реакциях, или их функциональной активности, могут быть восстановлены с помощью соответствующих иммунотропных лекарственных средств. Одним из источников для разработки лекарственных препаратов, восстанавливающих нормальное функционирование иммунной системы, являются иммунологически активные пептиды, выделенные из лимфоидных тканей или их синтетические аналоги.

На основании миелопептидов, продуцируемых клетками костного мозга, был разработан препарат миелопид [Petrov RV. Immunomodulating activity of myelopeptides: clinical trials, Ann N Y Acad Sci. 1993 Jun 23;685:351-61. Review], представляющий комплекс биорегуляторных медиаторов. Это группа низкомолекулярных пептидов с молекулярной массой 500-3000 дальтон. Данные миелопептиды получают экстракцией предварительно культивируемых in vitro клеток костного мозга свиньи или теленка. Очевидно, что получение коротких пептидов из тканей и клеток животных является очень затратным и плохо воспроизводимым. Современные требования к составу и чистоте лекарственных препаратов ограничивают такой способ производства.

В патенте РФ 2507212 предлагается способ получения рекомбинантных пептидов с использованием штаммов-продуцентов E. coli. Недостатком предложенного метода является экспрессия каждого пептида отдельно. Во-первых, короткие пептиды можно экспрессировать только в составе слитного белка общей массой не менее 10 кД. При среднем весе целевого пептида менее 1 кД это резко понижает выход продукта и увеличивает его стоимость. Во-вторых, как уже отмечалось, препараты содержат несколько пептидов. Следовательно, необходимо получение нескольких отдельных штаммов-продуцентов, производящих нужное число пептидов. Это еще значительно удорожает производство. В итоге, в случае реализации предложенного изобретения, цена продукта будет значительно выше смеси пептидов, получаемых традиционным методом из тканей животных.

Прототипом заявленного изобретения является патентный документ РФ 2198178. Данный документ раскрывает четыре миелопептида, входящих в состав заявленного REC-MP, однако показана их индивидуальная биологическая активность. Показано, что эти пептиды отдельно не обладают одинаковыми характеристиками (описание стр. 2), что определят их пригодность для какого-либо конкретного применения. Так миелопептид (МР-3) защищает от бактериальной инфекции, стимулируя макрофагальный фагоцитоз, в то время как МР-4 индуцирует терминальную дифференцировку в лейкозных клетках. Кроме того, повышение сывороточного интерферона, индуцированного с помощью разных MP, также отличалось. Так при однократной инъекции 0,1 мкг МР-4 в сыворотке через 48 часов уровень интерферона достигал 80 ед/мл, в то время как однократная инъекция 0,01 мкг МР-5 приводила к очень сильному повышению позднего (48 ч) сывороточного интерферона - 320 ед/мл. При этом МР-3 и МР-6 слабо индуцировали поздний интерферон при различных концентрациях. Таким образом, различная активность MP в отношении продукции интерферона будет проявляться различной эффективностью в отношении лечения вторичных иммунодефицитов.

Поэтому задачей изобретения является получение рекомбинантного слитого полипептида с более высокой иммунологической активностью для лечения ВИДС.

Согласно данному изобретению сконструирован рекомбинантный белок rec-МР путем чередованием коротких активных миелопептидов, перемежающихся сайтами узнавания специфических протеаз, имеющий аминокислотную последовательность SEQ ID NO: 1. В состав рекомбинантного белка входят четыре миелопептида: FLGFPT, LVVYPW, LVCYPQ и FRPRMTP. В качестве сайтов распознавания протеазами использовались последовательности для гидролиза тромбином и урокиназой.

Рекомбинантный белок rec-МР получен путем экспрессии в клетках E.coli, разработаны методики очистки и рефолдинга данного продукта. Для получения рекомбинантного белка была создана генетическая конструкция на основе плазмиды рЕТ30а, которая содержит ген, кодирующий данный рекомбинантный белок. Последовательность гена представлена SEQ ID NO: 2. Первичная структура и гомогенность подтверждена методами масс-спектрометрии и ВЭЖХ. Рекомбинантный белок rec-МР после введения в организм способен гидролизоваться с высвобождением входящих в него миелопептидов.

Техническим результатом, достигаемым при реализации данного изобретения, является повышение эффективности профилактики и лечения вторичных ИДС при применении REC-MP, содержащего комплекс миелопептидов и представленного последовательностью SEQ ID NO: 1, путем более выраженной стимуляции антителообразования, увеличения количества В-лимфоцитов, экспрессирующих на своей поверхности CD25 (рецептор для интерлейкина 2) и CD69 (маркер активации лимфоцитов).

Краткое описание чертежей.

Фиг. 1. Хроматографический профиль прохождения рекомбинантного белка rec-МР через SP-Sepharose. Мажорный пик соответствует выходу рекомбинантного белка.

Фиг. 2. Хроматографический профиль элюции рекомбинантного белка rec-МР с аналитической колонки Kromasil 300-5С18.

Фиг. 3. Влияние рекомбинантного белка rec-МР на содержание в лимфатических узлах экспериментальных животных клеток, несущих рецепторы CD25 и CD69.

Фиг. 4 Анализ клеток лимфатических узлов животных, иммунизированных рекомбинантным белком rec-МР.

ИЗОБРЕТЕНИЕ ИЛЛЮСТРИРУЮТ ПРИМЕРЫ.

Пример 1. Получение штамма-продуцента рекомбинантного белка REC-MP.

Для получения рекомбинантного белка была создана генетическая конструкция на основе плазмиды рЕТ30а, которая содержит ген, кодирующий данный рекомбинантный белок. Последовательность гена представлена SEQ ID NO: 2.

Плазмидой трансфецировали клетки E.coli штамма BL21(DE3). Трансформированные клетки рассевали на чашку Петри с LB-агаром, содержащим 25 мг/мл канамицина, и инкубировали 16 часов при 37°С. 24 единичные колонии инкубировали 10 часов в 1 мл LB, содержащим 25 мг/мл канамицина. По 50 мкл культур клеток вносили в 0,5 мл LB, содержащим 25 мг/мл канамицина, инкубировали 2 часа и индуцировали экспрессию белка rec-МР, добавлением IPTG до 1 мкМ. Матричные культуры хранили на -80С до окончания анализа клонов. Наличие белка rec-МР анализировали электрофорезом в ПААГ. Один клон, продуцирующий наибольшее количество белка rec-МР, использовали в качестве штамма-продуцента рекомбинантного белка rec-МР.

Пример 2. Получение и хроматографическая очистка рекомбинантного белка REC-MP.

Клетки штамма-продуцента пересевали в культуральную колбу с 200 мл LB, содержащим 25 мг/мл канамицина. Культура выращивалась на шейкере при 280 об/мин при температуре 37С до достижения оптической плотности значения OD585=0,8E. Индукция экспрессии белка проводилась добавлением IPTG до концентрации 1 мM. Культура дополнительно культивировалась 4 часа, далее клетки осаждались центрифугированием при 5000g. Осадок клеток лизировали в 8М мочевине и обрабатывали на ультразвуковом дезинтеграторе. Лизат клеток центрифугировали при 20000g 2 часа. Супернатант фильтровали через колонку с Q-Sepharose. Фракцию, не связавшуюся с данным сорбентом, хроматографировали на SP-Sepharose в градиенте NaCl (стартовый буфер: 20 mM TrisHCl рН6.8, 20 mM NaCl, итоговый буфер 20 mM TrisHCl рН6.8, 400 mM NaCl). Хроматографический профиль представлен на Фиг. 1. Фракции, содержащие целевой продукт, объединяли и диализовали в 0,9% NaCl. Чистоту продукта анализировали методом ВЭЖХ (Фиг. 2). Аминокислотная последовательность рекомбинантного белка rec-МР:

. Подчеркнуты сайты узнавания протеаз: GlyArgGly - сайт распознавания тромбином, ThrGlyArg - сайт распознавания урокиназой

Пример 3. Влияние рекомбинантного белка на количество клеток, продуцирующих антитела, в лимфатических узлах иммунизированных животных.

15 мышей-самок, гибридов первого поколения (CBAЧC57BL), весом 20-22 г иммунизировали 5% взвесью эритроцитов барана в физиологическом растворе, подкожно по 0,1 мл в подушечки задних конечностей. Через 14 дней после первой иммунизации была проведена повторная иммунизация той же дозой и тем же способом. На 4-е сутки после второй иммунизации мышей разделили на 3 группы по 5 особей в группе. Первой группе (контрольной) вводили подкожно в подушечки задних лап по 0,1 мл физиологического раствора; второй группе вводили по 0,1 мл физиологического раствора, содержащего 1,5 мкг коммерческого препарата миелопид и третьей группе - по 0,1 мл физиологического раствора, содержащего 1,5 мкг рекомбинантного белка. Через сутки все мыши были забиты и у них были удалены подколенные лимфоузлы. Лимфоузлы гомогенизировали и в полученной клеточной суспензии определяли методом Ерне количество клеток, продуцирующих антитело класса IgG к эритроцитам барана. Коэффициент стимуляции (К) антителообразования рассчитывали как отношение количества зон гемолиза в опытных чашках к количеству зон гемолиза в контрольных. Достоверность разницы между экспериментальными группами оценивали по t-критерию Стьюдента. Полученные результаты представлены в Таблице 1. Из полученных данных видно, что коэффициент стимуляции - миелопид/контроль составляет (36,4/25,2)=1,44, а коэффициент стимуляции - рекомбинантный белок/контроль составил (92,4/25,2)=3,67.

Таким образом, введение экспериментальным животным рекомбинантного белка rec-МР приводит к значительно более выраженной стимуляции антителообразования (К=3,3), т.е. обеспечивая синергетический эффект действия входящих в него миелопептидов, чем после введения миелопептида (К=1,45), что подтверждает повышение эффективности применения rec-МР для профилактики и лечения вторичных ИД путем активации гуморального иммунного ответа.

Пример 4. Влияния рекомбинантного белка rec-МР на содержание в лимфатических узлах экспериментальных животных клеток, несущих рецепторы к интерлейкину 2.

15 мышей - гибридов первого поколения (CBA×C57BL) иммунизировали 10% взвесью ЭБ в физиологическом растворе подкожно по 0,05 мл в подушечки задних лап. Через 14 дней после первой иммунизации была проведена повторная иммунизация той же дозой и тем же способом. На 3 сутки после второй иммунизации одной группе мышей (5 особей) вводили 0,15 мкг rec-МР в 0,1 мл физиологического раствора в подушечки задних лап. Другим 5 иммунизированным мышам вводили rec-МР в дозе 1,5 мкг, Контрольным животным в подушечки задних лап вводили 0,1 мл физиологического раствора. На 4 сутки после иммунизации животных забивали, брали у них подколенные лимфатические узлы, гомогенизировали их, получали клеточные суспензии, которую окрашивали меченными флуросцеиновыми красителями антителами фирмы BD Bioscience (Anti-Mouse CD4 FITC, кат. 11-0042-82 и Anti-Mouse CD25 АРС кат. 17-0251-82) согласно инструкции фирмы-изготовителя. Окрашенные клетки анализировали на проточном цитометре Gallios (Beckman Coulter). Обработку результатов проводили с помощью программы FlowJo v.7.6. Анализировали клетки лимфоцитарного гейта, построенного по параметрам прямого и бокового светорассеяния. Полученные результаты представлены на фиг.4.

На фиг. 4 отображено, что введение rec-МР в продуктивную фазу гуморального иммунного ответа приводит к увеличению клеток, несущих на своей поверхности рецепторы к Интерлейкину 2 (CD 25). Данный эффект имеет доза-зависимый характер (контроль - 1,47%, rec-МР в дозе 0,15 мкг - 4,09% и rec-МР в дозе 1,5 мкг - 7,33%). Данные клетки не относятся к субпопуляции Т-лимфоцитов, экспрессирующих маркер CD4.

Пример 5. Влияния рекомбинантного белка rec-МР на содержание в лимфатических узлах экспериментальных животных клеток, несущих маркер активации лимфоцитов (CD69).

10 мышей - гибридов первого поколения (CBA×C57BL) иммунизировали 10% взвесью ЭБ в физиологическом растворе подкожно по 0,05 мл в подушечки задних лап и в основание хвоста. Через 14 дней после первой иммунизации была проведена повторная иммунизация той же дозой и тем же способом. На следующие сутки после второй иммунизации мышам вводили РБ в дозе 1 мкг или физиологический раствор в подушечки лап и основание хвоста. На 3 сутки после второй иммунизации животных забивали, брали у них подколенные и паховые лимфатические узлы, гомогенизировали их, получали клеточные суспензии, которую окрашивали Lymphocyte Activation Antibody Cocktail, with Isotype Control (PE-CY™7 CD25, PE CD69, & APC CD 19) (BD Biosciences), согласно инструкции фирмы-изготовителя. Окрашенные клетки анализировали на проточном цитометре Gallios (Beckman Coulter). Обработку результатов проводили с помощью программы FlowJo v.7.6. Анализировали клетки лимфоцитарного гейта, построенного по параметрам прямого и бокового светорассеяния. Полученные результаты представлены на фиг. 3.

Из представленных результатов на фиг. 3 следует, что в лимфатических узлах мышей, дренирующих место введения антигена (ЭБ), под влиянием rec-МР в 2,5 увеличивается относительное количество клеток cd25+cd19+, т.е. В-лимфоцитов, несущих рецептор к IL2, и, приблизительно, в 2 раза клеток cd69+cd19+, т.е. клеток, несущих маркер активации В-лимфоцитов. Следует также отметить, что наряду с увеличением В лимфоцитов, несущих маркер cd25, также увеличилось в 1,6 количество других лимфоцитов, несущих рецептор к IL2, что указывает на возможное участие различных типов клеток иммунной системы в реализации антителостимулирующей активности заявленного rec-МР.

Таким образом, REC-MP, содержащий комплекс миелопептидов и представленный последовательностью SEQ ID NO: 1, увеличивает количество В-лимфоцитов, экспрессирующих на своей поверхности CD25 (рецептор для интерлейкина 2) и CD69 (маркер активации лимфоцитов).

Пример 6. Изучение способности рекомбинантного белка восстанавливать гуморальный иммунный ответ при вторичном иммунодефицитном состоянии.

10 мышам-самкам, гибридам первого поколения (CBA4C57BL), весом 18-20 г вводили внутрибрюшинно циклофосфамид в дозе 200 мг/кг в физиологическом растворе. 5 мышам вводили физиологический раствор. На следующие сутки всех 15 животных иммунизировали 5% взвесью эритроцитов барана в физиологическом растворе подкожно по 0,1 мл в подушечки задних конечностей. На 2-е и 3-и сутки после иммунизации 5 животным из группы, которая получала циклофосфамид, внутримышечно вводили по 1,5 мкг рекомбинантного белка в 0,1 мл физиологического раствора. На 4 сутки после иммунизации эритроцитами барана все мыши были забиты и у них были удалены подколенные лимфоузлы. Лимфоузлы гомогенизировали и в полученной клеточной суспензии определяли методом Ерне количество клеток, продуцирующих антитело класса IgM к эритроцитам барана. Достоверность разницы между экспериментальными группами оценивали по t-критерию Стьюдента. Полученные результаты представлены в Таблице 2.

Из представленных данных видно, что введение экспериментальным животным с вторичными иммунодефицитами заявленного рекомбинантнного белка rec-МР приводит к восстановлению гуморального иммунного ответа.

Таким образом, создание REC-MP, содержащего комплекс миелопептидов и представленного последовательностью SEQ ID NO 1, позволяет не только сохранить функциональную активность входящих в его миелопептидов, но повысить эффективность лечения вторичных иммунодефицитов. Поскольку после введения в организм REC-MP способен гидролизоваться по сайтам узнавания специфических протеаз с высвобождением входящих в него коротких миелопептидов, обеспечивая синергетический эффект при иммунизации (как отмечено в вышеуказанных примерах).

Перечень последовательностей

<110> ФГБУ "ГНЦ Институт иммунологии" ФМБА России

<120> Рекомбинантный белок rec-MP, содержащий в своем составе последовательности миелопептидов для лечения вторичных иммунодефицитных состояний.

<160> NUMBER OF SEQ ID NOS: 6

<210> SEQ ID NO 1

<211> 73

<212> AA (amino acid)

<213> artificial

<400> SEQUENCE 1:

MFLGFPTGRGLVVYPWGRGLVCYPQGRGFRPRIMTPGRGFLGFPTTGRLVVYPWTGRLVCYPQTGRFRPRIMT

<210> SEQ ID NO 2

<211> 228

<212> DNA

<213> artificial

<400> SEQUENCE 2:

ATGTTCTTAGGCTTTCCAACTGGCCGTGGTCTGGTGGTGTATCCATGGGGTCGTGGTCTGGTGTGCTATCCGCAAGGTCGTGGCTTCCGTCCACGCATCATGACTCCAGGCCGCGGCTTTCTGGGCTTCCCGACCACTGGTCGTCTCGTTGTGTACCCGTGGACCGGCCGCCTGGTTTGTTACCCACAGACGGGTCGCTTTCGCCCGCGTATTATGACGCCGTAATGA

<210> SEQ ID NO 3

<211> 6

<212> AA (amino acid)

<213> artificial

<400> SEQUENCE 3:

FLGFPT

<210> SEQ ID NO 4

<211> 6

<212> AA (amino acid)

<213> artificial

<400> SEQUENCE 4:

LVVYPW

<210> SEQ ID NO 5

<211> 6

<212> AA (amino acid)

<213> artificial

<400> SEQUENCE 5:

LVCYPQ

<210> SEQ ID NO 6

<211> 7

<212> AA (amino acid)

<213> artificial

<400> SEQUENCE 6:

FRPRMTP

1. Рекомбинантный полипептид для лечения вторичных иммунодефицитных состояний, содержащий в своем составе миелопептиды, перемежающиеся сайтами распознавания протеаз, имеющий аминокислотную последовательность SEQ ID NO: 1.

2. Рекомбинантный полипептид по п. 1, отличающийся тем, что в его состав входят миелопептиды: FLGFPT, LVVYPW, LVCYPQ и FRPRMTP.

3. Рекомбинантный полипептид по п. 1, отличающийся тем, что в его состав включен сайт распознавания урокиназы.

4. Рекомбинантный полипептид по п. 1, отличающийся тем, что в его состав включен сайт распознавания тромбина.

5. Рекомбинантный полипептид по п. 1, отличающийся тем, что в его состав включены сайты распознавания тромбином и урокиназой.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к иммуногенным эпитопам MELK, и может быть использовано в медицине для лечения пациента, страдающего раком или эндометриозом.

Изобретение относится к новым молекулам-ингибиторам JNK, способам получения антител к указанным молекулам-ингибиторам JNK, а также к соответствующим антителам и клеткам, продуцирующим указанные антитела.

Изобретение относится к пептидам, включающим фикоцианобилин (PCB), и медицинскому применению указанных пептидов и PCB, благодаря идентифицированному у них нейропротекторному и/или нейрорегенеративному действию.

Настоящее изобретение относится к области иммунологии. Предложен выделенный пептид, представляющий собой фрагмент белка CDC45L и обладающий способностью индуцировать цитотоксические Т-лимфоциты в форме комплекса с молекулой HLA-A*2402 или HLA-A*0201.

Настоящее изобретение относится к области иммунологии. Предложен выделенный пептид, обладающий способностью индуцировать цитотоксические Т-лимфоциты (ЦТЛ) в присутствии антигенпредставляющих клеток (АПК), несущих HLA-A*2402, и представляющий собой фрагмент белка FOXM1.

Изобретение относится к соединениям, обладающим активностью, снижающей уровни паратиреоидного гормона. Соединение содержит пептид и конъюгирующую группу, где пептид имеет аминокислотную последовательность формулы: Х1-Х2-Х3-Х4-Х5-X6 _Х7, в которой X1 представляет собой D-цистеин; Х2 представляет собой аминокислоту, выбранную из группы, состоящей из D-аргинина и некатионной аминокислоты; Х3 представляет собой D-аргинин; Х4 представляет собой аминокислоту, выбранную из группы, состоящей из D-аргинина и некатионной аминокислоты; Х5 представляет собой D-аргинин; Х6 представляет собой некатионную аминокислоту; Х7 представляет собой D-аргинин; и где пептид связан с конъюгирующей группой посредством дисульфидной связи.

Изобретение относится к биотехнологии, а именно к пептиду для стимуляции синтеза Hsp70 (белок теплового шока 70) или для защиты кожи от ультрафиолетового излучения. Пептид может быть представлен пептидом с общей формулой R1-AA1-AA2-AA3-AA4-R2, его стереоизомерами, их смесью и/или их косметически или фармацевтически приемлемой солью.

Изобретение относится к новым пептидам, их фармацевтическим композициям и применению в способе снижения внутриглазного давления и способе лечения или профилактики офтальмологических заболеваний, опосредованных натрийуретическими пептидами или белками.

Изобретение относится к гексапептиду формулы Thr-Gly-Glu-Asn-His-Arg-NH2, обладающему нейропротекторной и ноотропной активностью. Предложен новый состав фармацевтической композиции на основе пептида, который высокоэффективен в низких дозах и используется в виде капель в нос.

Изобретение относится к олигопептидам, содержащим последовательность NLSSAEVVV (SEQ ID NO:6), в которой одна или две аминокислоты могут быть замещены, имеющим индуцибельность цитотоксических Т-клеток, их фармацевтическим композициям и применению для изготовления противораковых вакцин.

Представленная группа изобретений касается слитого белка, ДНК, кодирующей такой белок, рекомбинантного вектора и клетки-хозяина. Охарактеризованный слитый белок содержит фактор VII (FVII) и трансферрин, где указанный трансферрин соединен с С-концом указанного FVII, необязательно через линкер.

Изобретение относится к области биотехнологии, конкретно к получению антиапоптозных фрагментов белка DAXX, и может быть использовано в медицине для лечения острого инфаркта миокарда (AMI), церебрального инфаркта, при трансплантации органов, операциях на сердце, острых нарушениях кровообращения, реперфузионных повреждениях и ишемии.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению модифицированного vWF, и может быть использовано в медицине для лечения гемофилии.

Настоящее изобретение относится к области биотехнологии, конкретно к сконструированным полипептидам со связывающей сывороточный альбумин аффинностью, и может быть использовано в медицине.

Изобретение касается способа получения рекомбинантного белка SAV-RGD, где SAV - мономер стрептавидина, RGD - меланома-адресующий олигопептид, имеющий аминокислотную последовательность Ser-Arg-Ala-Gly-Ala-Asp-Gly-Phe-Pro-Gly-Cys-Arg-Gly-Asp-Cys-Ser-Gln-Glu.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Изобретение относится к области биотехнологии, конкретно к химерным полипептидам фактора роста фибробластов (FGF), и может быть использовано в медицине для лечения ожирения, диабета, высокого содержания глюкозы в крови, метаболического синдрома и гиперхолестеринемии.

Изобретение относится к области медицины и касается противогриппозной вакцины широкого спектра действия против птичьего гриппа А человека. Охарактеризованная вакцина содержит эктодомен белка М2, молекулярный адъювант и буферный раствор, взятые в эффективных количествах.

Представленная группа изобретений касается вирусоподобной частицы и способов ее использования и получения. Предложенная вирусоподобная частица, по существу, не содержащая нуклеиновую кислоту вируса, сформирована из слитого белка, включающего белок оболочки растительного вируса и белок-мишень.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антигенсвязывающий фрагмент, способные связываться с дельта-подобным лигандом 4 (DLL4) человека, в том числе в форме меченого антитела или его антигенсвязывающего фрагмента, конструкции с константным доменом иммуноглобулина, конъюгата с терапевтическим или цитотоксическим средством и в кристаллизованной форме.

Изобретение относится к медицине, а именно к гинекологии, и может быть использовано для лечения цервикальных неоплазий II-III степени, ассоциированных с папилломавирусной инфекцией.

Изобретение относится к области биотехнологии, в частности к получению рекомбинантного белка, содержащего в своем составе последовательности миелопептидов, и может быть использовано для лечения вторичных иммунодефицитов. Рекомбинантный белок конструируют чередованием коротких активных миелопептидов МП-1, МП-2, МП-3 и МП-4, перемежающихся сайтами распознавания тромбином и урокиназой. Изобретение позволяет повысить эффективность лечения вторичных иммунодефицитов путем более выраженной стимуляции антителообразования, увеличения количества В-лимфоцитов, экспрессирующих на своей поверхности CD25 и CD69. 4 з.п. ф-лы, 4 ил., 2 табл., 6 пр.

Наверх