Sdf-1-связывающие нуклеиновые кислоты



Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты
Sdf-1-связывающие нуклеиновые кислоты

 

C12N15/115 - Получение мутаций или генная инженерия; ДНК или РНК, связанные с генной инженерией, векторы, например плазмиды или их выделение, получение или очистка; использование их хозяев (мутанты или микроорганизмы, полученные генной инженерией C12N 1/00,C12N 5/00,C12N 7/00; новые виды растений A01H; разведение растений из тканевых культур A01H 4/00; новые виды животных A01K 67/00; использование лекарственных препаратов, содержащих генетический материал, который включен в клетки живого организма, для лечения генетических заболеваний, для генной терапии A61K 48/00 пептиды вообще C07K)

Владельцы патента RU 2590709:

НОКСОН ФАРМА АГ (DE)

Изобретение относится к области биохимии. Представлены варианты молекулы нуклеиновой кислоты, связывающейся с SDF-1. Молекула нуклеиновой кислоты содержит первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов, где указанный первый и указанный второй фрагмент нуклеотидов имеют достаточную для гибридизации друг с другом степень обратной комплементарности, и при гибридизации образуется двунитевая структура. Также изобретение относится к применению указанных молекул нуклеиновой кислоты для лечения и профилактики, а также диагностики заболеваний или нарушений, обусловленных повышенным количеством и/или активностью SDF-1. Изобретение позволяет ингибировать хемотаксис, индуцируемый SDF-1. 6 н. и 32 з.п. ф-лы, 40 ил., 16 табл., 15 пр.

 

Настоящее изобретение относится к нуклеиновым кислотам, связывающимся со стромальным фактором-1 (SDF-1) СХС-хемокина, и к их применению для приготовления лекарственного средства и диагностического средства.

Хемокины представляют собой семейство структурно родственных, гепарин-связывающих основных мелких белков с молекулярной массой 8-14 кДа. В функциональном отношении хемокины можно классифицировать как провоспалительные, гомеостатические или двойственные (Moser, Wolf et al., 2004). Воспалительные хемокины индуцируются патогенными микроорганизмами, цитокинами или факторами роста и направляют эффекторные лейкоциты в места локализации инфекции, воспаления, повреждения ткани и опухоли. Такие хемокины регулируют рекрутинг, активацию и пролиферацию лейкоцитов (Schall and Bacon, 1994; Springer, 1995; Baggiolini, 1998). Хемокины избирательно индуцируют хемотаксис нейтрофилов, эозинофилов, базофилов, моноцитов, макрофагов, мастоцитов, Т- и В-клеток. Помимо хемотаксического действия хемокины могут избирательно оказывать другие воздействия на соответствующие клетки, такие как изменение формы клетки, временное увеличение концентрации свободных ионов кальция внутри клетки, дегрануляция, увеличение числа интегринов, образование биоактивных липидов (лейкотриенов, простагландинов, тромбоксанов) или респираторный “взрыв” (высвобождение реакционно-способных форм кислорода для уничтожения патогенных микроорганизмов или опухолевых клеток). Таким образом, вызывая высвобождение медиаторов воспаления, хемотаксис и транссудацию лейкоцитов в местах локализации инфекции или воспаления, хемокины усиливают воспалительную реакцию. Гомеостатические хемокины, с другой стороны, экспрессированы главным образом в костном мозге и лимфоидных тканях, участвуют в гемопоэзе, осуществляют иммунный контроль и регулируют иммунные реакции (Godessart, 2005).

С учетом расположения первых двух из четырех консервативных остатков цистеина хемокины делятся на четыре класса: СС или β-хемокины, в которых остатки цистеина последовательно связаны друг с другом, СХС или α-хемокины, в которых остатки цистеина разделены одним дополнительным аминокислотным остатком, ХС или γ-хемокины (единственным обнаруженным до сих пор представителем данного класса является лимфотактин/XCL1), которые имеют только один дисульфидный мостик, и СХ3С-хемокины, которые содержат три аминокислотных остатка между остатками цистеина (единственным членом данного класса является мембраносвязанный фракталкин (Bazan, Bacon et al., 1997)).

СХС-хемокины воздействуют главным образом на нейтрофилы, в частности, СХС-хемокины, содержащие аминокислотную последовательность ELR у аминоконца. Примерами СХС-хемокинов, активно воздействующих на нейтрофилы, являются IL-8/CXCL8, GROα/CXCL1, GROβ/CXCL2 и GROγ/CXCL3, NAP-2/CXCL7, ENA-78/CXCL5, SDF-1/CXCL12 и GCP-2/CXCL6. СС-хемокины воздействуют на целый ряд лейкоцитов, таких как моноциты, макрофаги, эозинофилы, базофилы, а также на Т- и В-лимфоциты (Oppenheim, Zachariae et al., 1991; Miller and Krangel, 1992; Baggiolini, Dewald et al., 1994; Jose, Griffiths-Johnson et al., 1994; Ponath, Qin et al., 1996). Примерами таких хемокинов являются I-309/CCL1; MCP-1/CCL2, MCP-2/CCL8, MCP-3/CCL7, MCP-4/CCL13, MIP-1α/CCL3 и MIP-1β/CCL4, RANTES/CCL5 и эотаксин/CCL11.

Хемокины воздействуют с помощью рецепторов, относящихся к надсемейству, состоящему из семи трансмембранных рецепторов, связанных с G-белком (GPCR; (Murphy, Baggiolini et al., 2000)). Вообще говоря, взаимодействие хемокина и рецептора хемокина является беспорядочным и выражается в том, что один хемокин может связываться с несколькими рецепторами хемокина и наоборот один рецептор хемокина может взаимодействовать с несколькими хемокинами. Несколько известных рецепторов СХС-хемокинов включают CXCR1, связывающий GROα, GCP-2 и IL-8; CXCR2, связывающий хемокины, включающие GROα, GROβ, GROγ, ENA-78 и IL-8; CXCR3, связывающий хемокины, включающие PF4, MIG, IP-10 и I-TAC; CXCR4, который, как установлено в настоящее время, только передает сигнал под воздействием SDF-1, и CXCR5, который, как установлено, передает сигнал под воздействием ВСА-1 (Godessart, 2005).

SDF-1 (стромальный фактор-1; синонимы: CXCL12; PBSF [фактор стимуляции роста пре-В-клеток]; TPAR-1 [ТРА-подавляемый ген 1]; SCYB12; TLSF [фактор стимуляции клеток лимфомы тимуса]; hIRH [интеркрин человека с пониженным содержанием в гепатоме]) является СХС-хемокином, вызывающим ангиогенез, который не содержит фрагмент ELR, типичный для IL-8-подобных хемокинов (Salcedo, Wasserman et al., 1999; Salcedo and Oppenheim, 2003), связывается с рецептором CXCR4, связанным с G-белком, и активирует данный рецептор. Указанный хемокин был обнаружен тремя независимыми группами ученых в результате клонирования кДНК, имеющих N-концевые сигнальные последовательности (Tashiro, Tada et al., 1993), благодаря способности данного хемокина стимулировать образование ранних В-клеток-предшественников при экспрессии линией стромальных клеток РА6 (Nagasawa, Kikutani et al., 1994), или выделения из библиотеки кДНК, созданной из фибробластов эмбрионов мышей, обработанных ацетатом тетрадодеканоилфорбола С-активатора протеинкиназы (ТРА) (Jianf, Zhou et al., 1994).

В результате альтернативного сплайсинга образуются две формы SDF-1: SDF-1α (68 аминокислот) и SDF-1β, содержащие четыре дополнительных остатка у С-конца (Shirozu, Nakano et al., 1995). Биологическая значимость двух указанных сплайсированных вариантов полностью не изучена.

Весьма примечательна консервативность последовательностей в SDF-1 у животных разных видов: SDF-1α человека (SEQ ID NO:1) и SDF-1α мыши (SEQ ID NO:2) являются фактически идентичными. Существует лишь одна консервативная замена V на I в положении 18 (Shirozu, Nakano et al., 1995). Другой необычной особенностью, отличающей SDF-1 от большинства других хемокинов, является его избирательность. Действительно, SDF-1 и рецептор CXCR4, по-видимому, образуют моногамную пару рецептор-лиганд.

Существует модель структуры SDF-1, полученная методом ЯМР (доступ к PDB, ISDF) [8-68]. Было установлено, что SDF-1 является мономером с неупорядоченной N-концевой областью. Отличие от других хемокинов состоит главным образом в строении гидрофобного ядра и распределении поверхностного заряда (Crump, Gong et al., 1997).

Физиологическая активность SDF-1: так как рецептор CXCR4 для SDF-1 широко экспрессирован в лейкоцитах, зрелых дендритных клетках, эндотелиальных клетках, клетках головного мозга и мегакариоцитах, активность SDF-1 является разнообразной. Указанный хемокин обладает самым широким спектром биологических функций по сравнению с любым другим обнаруженным до сих пор хемокином, особенно за пределами иммунной системы. Наиболее значимыми функциями SDF-1 являются:

Хоминг и прикрепление эпителиальных клеток к местам образования новых сосудов в сосудистой оболочке сетчатки глаза. Установлено, что SDF-1 участвует в хоминге эпителиальных клеток в сосудистой оболочке глаза в процессе образования новых сосудов в ткани глаза. В настоящее время все еще исследуется роль таких клеток, но опубликованная гипотеза гласит, что указанные эпителиальные клетки участвуют в образовании аберрантных кровеносных сосудов (Sengupta, Caballero et al., 2005).

Гемопоэз. SDF-1 необходим для сохранения гемопоэтических (CD34+) клеток-предшественников в костном мозге взрослого человека. AMD3100, избирательный антагонист CXCR4, может быть использован для мобилизации CD34+ клеток в случае трансплантации гемопоэтических стволовых клеток. CD34+ клетки мигрируют in vitro и in vivo в направлении градиента SDF-1, создаваемого стромальными клетками (Aiuti, Webb et al., 1997).

Рост и хемотаксис В-клеток. SDF-1 опосредует пролиферацию пре-В-клеток и усиливает рост В-клеток-предшественников костного мозга (Nagasawa, Kikutani et al., 1994); вызывает специфическую миграцию пре- и про-В-клеток, не являясь при этом сильным хемоаттрактантом для зрелых В-клеток (D'Apuzzo, Rolink et al., 1997; Bleul, Schultze et al., 1998). SDF-1 имеет в основном важное значение для расположения В-клеток во вторичной лимфоидной ткани.

Хемотаксис Т-клеток. SDF-1 является одним из наиболее эффективных хемоаттрактантов Т-клеток; CXCR4 присутствует во многих субпопуляциях Т-клеток (Bleul, Farzan et al., 1996).

Развитие эмбриона. SDF-1 и его рецептор CXCR4 имеют важное значение для развития эмбриона. Мыши с отсутствием SDF-1 и CXCR4 погибают в перинатальный период; у мышей возникают дефекты межжелудочковой перегородки сердца или аномальное развитие мозжечка помимо уменьшения числа В-клеток и миелоидных клеток-предшественников (Nagasawa, Hirota et al., 1996; Ma, Jones et al., 1998; Zou, Kottmann et al., 1998). SDF-1 необходим также для нормального онтогенеза образования крови во время эмбриогенеза (Juarez and Bendall, 2004).

ВИЧ-инфицирование. SDF-1 может ингибировать проникновение Т-тропного ВИЧ-1 в CXCR4-несущие линии клеток, и экспрессия SDF-1 может оказывать сильное влияние на патогенез СПИДа, так как полиморфизм гена SDF-1 человека воздействует на возникновение СПИДа (Bleul, Farzan et al., 1996).

Изменение уровней экспрессии SDF-1 или его рецептора CXCR4 либо изменение реакций на указанные молекулы ассоциированы со многими болезнями человека, такими как ретинопатия (Brooks, Caballero et al., 2004; Butler, Guthrie et al., 2005; Meleth, Agron et al., 2005); рак молочной железы (Muller, Homey et al., 2001; Cabioglu, Sahin et al., 2005), рак яичника (Scotton, Wilson et al., 2002), рак поджелудочной железы (Koshiba, Hosotani et al., 2000), рак щитовидной железы (Hwang, Chung et al., 2003), рак носоглотки (Wang, Wu et al., 2005); глиома (Zhou, Larsen et al., 2002); нейробластома (Geminder, Sagi-Assif et al., 2001); В-клеточный хронический лимфолейкоз (Burger, Tsukada et al., 2000); синдром WHIM (бородавки, гипогаммаглобулинемия, инфекции, миелокатексис) (Gulino, Moratto et al., 2004; Balabanian, Lagane et al., 2005; Kawai, Choi et al., 2005); синдромы иммунологической недостаточности (Arya, Ginsburg et al., 1999; Marechal, Arenzana-Seisdedos et al., 1999; Soriano, Martinez et al., 2002); патологическое образование новых сосудов (Salvucci, Yao et al., 2002; Yamaguchi, Kusano et al., 2003; Grunewald, Avraham et al., 2006); воспаление (Murdoch, 2000; Fedyk, Jones et al., 2001; Wang, Guan et al., 2001); рассеянный склероз (Krumbholz, Theil et al., 2006); ревматоидный артрит/остеоартрит (Buckley, Amft et al., 2000; Kanbe, Takagishi et al., 2002; Grassi, Cristino et al., 2004).

В экспериментах на животных антагонисты SDF-1 или его рецептора эффективно блокировали рост и/или метастазирование раковых клеток человека разного происхождения, таких как рак поджелудочной железы (Guleng, Tateishi et al., 2005; Saur, Seidler et al., 2005), рак ободочной кишки (Zeelenberg, Ruuls-Van Stalle et al., 2003; Guleng, Tateishi et al., 2005), рак молочной железы (Muller, Homey et al., 2001; Lapteva, Yang et al., 2005), рак легкого (Phillips, Burdick et al., 2003), глиобластома/медуллобластома (Rubin, Kung et al., 2003), рак предстательной железы (Sun, Schneider et al., 2005), остеосаркома (Perissinotto, Cavalloni et al., 2005), меланома (Takenaga, Tamamura et al., 2004), рак желудка (Yasumoto, Koizumi et al., 2006), множественная миелома (Menu, Asosingh et al., 2006).

Кроме того, терапия, направленная против SDF-1, позволяла эффективно предотвращать образование новых сосудов в сетчатке глаза животных моделей (Butler, Guthrie et al., 2005), нефрит (Balabanian, Couderc et al., 2003) и артрит (Matthys, Hatse et al., 2001; Tamamura, Fujisawa et al., 2004; De Klerck, Geboes et al., 2005).

SDF-1 опосредует патогенез заболеваний глазного дна, таких как диабетическая ретинопатия (DR) (Fong, Aiello et al., 2004) и возрастная дегенерация желтого пятна (AMD) (Ambati, Anand et al. 2003). Оба вышеуказанных заболевания вызывают поражение глаза и ведут к постепенной потере зрения, заканчивающейся слепотой. Данное поражение обусловлено патологическим ростом кровеносных сосудов в глазном дне, известным как образование новых сосудов в сосудистой оболочке глаза (CNV). В процессе CNV новые кровеносные сосуды, образующиеся в сосудистой оболочке глаза, проникают через разрыв в оболочке Бруха в пигментный эпителий под сетчаткой (sub-RPE) и пространство под сетчаткой. Аномальные сосуды могут кровоточить (кровоизлияние в сетчатку) или вызывать истечение жидкости под сетчатку. В результате этого могут возникать рубцы, и может происходить ослабление желтого пятна, что ухудшает зрение.

Считается, что SDF-1 играет определенную роль в CNV вследствие рекрутинга в глаз эндотелиальных клеток-предшественников (ЕРС). Указанные клетки-предшественники затем становятся основными структурными компонентами аберрантных кровеносных сосудов.

Диабетическая ретинопатия является основным осложнением диабета, часто возникающим у субъектов, страдающих диабетом 1-го и 2-го типа. В США примерно 16 миллионов человек больны диабетом, из которых почти 8 миллионов страдают разными формами диабетической ретинопатии. Примерно 60% субъектов, не лечивших пролиферативную диабетическую ретинопатию (PDR), слепнут на один или оба глаза в течение 5 лет. Наряду с вызывающим тревогу распространением диабета в Северной Америке, Европе и многих развивающихся странах быстро увеличивается число больных диабетической ретинопатией. Например, слепота в 25 раз чаще возникает у больных диабетом, чем у остальной части населения. Кроме того, диабетическая ретинопатия (DR) является наиболее распространенной причиной слепоты у людей среднего возраста, составляя по меньшей мере 12% всех новых случаев возникновения слепоты в США каждый год. В настоящее время действуют программы массового обследования населения, поэтому зрение больных диабетом можно контролировать, и необходимое лечение может быть произведено вовремя.

Непосредственные причины диабетической ретинопатии плохо изучены, но считается, что данное заболевание возникает вследствие целого ряда причин: ухудшение ауторегуляции кровотока в сетчатке, накопление сорбита в клетках сетчатки и накопление конечных продуктов сильного гликозилирования во внеклеточной жидкости. Все указанные факторы имеют прямое или косвенное отношение к гипергликемии, повышенному содержанию сахара в кровотоке.

Симптомы диабетической ретинопатии подобны симптомам AMD. У субъектов утрачиваются клетки в сетчатке и возникают микроаневризмы (ток крови) в базальной мембране сетчатки. Кроме того, VEGF, IGF-1 и другие переносимые кровью факторы, включая, вероятно, и SDF-1, привлекают новые сосудистые клетки и стимулируют образование вызывающих поражение кровеносных сосудов.

Возрастная дегенерация желтого пятна (AMD) разрушает центральное зрение субъекта. Данное заболевание на ранних стадиях может оставаться незамеченным, так как его симптомы являются различными у разных субъектов. Иногда у субъекта поражается только один глаз. Либо может иметь место ухудшение зрения в обоих глазах, но в незначительной степени. Данное заболевание вызывает искажение или неправильное восприятие цветов. Часто образуется темное пятно в центральной области поля зрения.

Этиология (причина) данного заболевания плохо изучена. Часто считается, что AMD возникает вследствие старения наружного слоя сетчатки. Физические изменения происходят в центральной области сетчатки, известной также как желтое пятно, которое является частью сетчатки, отвечающей за наиболее четкое зрение.

Влажная форма AMD возникает как последствие сухой формы заболевания. Примерно 90% субъектов страдают сухой формой AMD, которая вызывает истончение тканей желтого пятна и нарушение его пигментации. Остальные субъекты страдают влажной формой данного заболевания, которая характеризуется вышеописанным кровоизлиянием.

Влажная форма AMD является идеальным заболеванием для рынка сбыта нового лекарственного средства: являясь наиболее распространенной причиной слепоты людей старше 55 лет, AMD поражает 4%-5% населения США в возрасте 65-74 лет и почти 10% людей в возрасте 75 лет или старше. В США уже проживает 5 миллионов человек в возрасте старше 80 лет, страдающих данным заболеванием, и ожидается, что к 2020 г. число таких больных увеличится еще на 5 миллионов человек.

Опухоли состоят не только из массы раковых клеток: отличительным признаком рака является инфильтрация в опухоли иммунокомпетентных клеток. Многие типы рака человека имеют сложную сеть хемокинов, которая влияет на степень и фенотип указанного инфильтрата, а также на рост, выживание и миграцию опухоли и развитие кровеносных сосудов. Большинство солидных опухолей содержит много нераковых стромальных клеток. На самом деле стромальные клетки иногда превышают число раковых клеток. В раковых опухолях встречаются главным образом такие стромальные клетки, как макрофаги, лимфоциты, эндотелиальные клетки и фибробласты.

Раковые клетки других типов рака имеют другие профили экспрессии хемокинов-рецепторов, но рецептор CXCR4 для SDF-1 наиболее часто обнаруживают у мышей и человека: опухолевые клетки, по меньшей мере, 23 разных типов рака человека эпителиального, мезенхимного и гемопоэтического происхождения экспрессируют CXCR4 (Balkwill, 2004). SDF-1 является единственным известным лигандом для CXCR4. Помимо костного мозга и вторичной лимфоидной ткани, где в основном экспрессирован SDF-1, данный фактор обнаружен в местах первичной локализации лимфомы (Corcione, Ottonello et al., 2000) и опухолях головного мозга, относящихся как к линии нейронов, так и астроцитов. Кроме того, указанный фактор присутствует в больших количествах в раковых опухолях яичника (Scotton, Wilson et al., 2002) и поджелудочной железы (Koshiba, Hosotani et al., 2000), а также в местах метастазирования в молочной железе (Muller, Homey et al., 2001) и раковой опухоли щитовидной железы (Hwang, Chung et al., 2003), нейробластоме и гематологических злокачественных новообразованиях (Geminder, Sagi-Assif et al., 2001). В отличие от этого CXCR4 слабо экспрессирован или полностью отсутствует в нормальном эпителии молочной железы (Muller, Homey et al., 2001), яичника (Scotton, Wilson et al., 2002) и предстательной железы (Sun, Schneider et al., 2005). Таким образом, экспрессия CXCR4 является, по-видимому, общим признаком раковой эпителиальной клетки, отсутствующим в нормальной клетке.

Ингибирование передачи сигналов хемокина-рецептора в опухолевых клетках позволяет прекратить рост клеток или вызвать их апоптоз и предотвратить инвазию и метастазирование in vivo.

Удаление CXCR4 при помощи РНК обезьян подавляло рост опухоли молочной железы (Lapteva, Yang et al., 2005); Т-клетки гибридомы, в которые трансфецировали конструкцию, предотвращающую поверхностную экспрессию CXCR4, не могли метастазировать в другие органы при внутривенном введении мышам (Zeelenberg, Ruuls-Van Stalle et al., 2001); в аналогичных экспериментах с использованием клеток рака ободочной и прямой кишки было значительно сокращено число метастазов в легкое и печень (Zeelenberg, Ruuls-Van Stalle et al., 2003); антитела против CXCR4 ингибировали распространение ксенотрансплантатов рака молочной железы в лимфатические узлы (Muller, Homey et al., 2001); лечение лимфобластоидных клеток антителами против CXCR4 или SDF-1 задерживало рост опухоли у мышей (NOD)/SCID (Bertolini, Dell'Agnola et al., 2002); антитела против SDF-1 ингибировали образование метастазов в органах в случае немелкоклеточного рака легкого (NSCLC) (Phillips, Burdick et al., 2003); системное введение антагониста CXCR4 AMD3100 (AnorMED) подавляло рост ксенотрансплантатов внутричерепной глиобластомы и медуллобластомы и увеличивало апоптоз опухолевых клеток в течение 24 часов (Rubin, Kung et al., 2003); антитела против SDF-1 ингибировали рост клеток рака молочной железы MCF-7 в смеси с фибробластами, ассоциированными с карциномой (Orimo, Gupta et al., 2005); нейтрализация CXCR4 антителами блокировала метастазы рака предстательной железы и их рост в костях (Sun, Schneider et al., 2005); образование метастазов в легком после инъекции клеток остеосаркомы было предотвращено введением пептидного антагониста CXCR4 Т134 (Perissinotto, Cavalloni et al., 2005).

Разные авторы пришли к выводу, что направленное воздействие на систему SDF-1/CXCR4 позволит разработать новые методы лечения больных раком.

Опухоли яичника человека экспрессируют на высоком уровне SDF-1 и на более низком уровне VEGF. Оба белка активируются гипоксией в опухоли. Патологические концентрации любого из указанных белков были недостаточны для индукции ангиогенеза in vivo, но SDF-1 и VEGF вместе в патологических концентрациях эффективно и синергически вызывали неоваскуляризацию. Таким образом, подавляя такое синергическое действие, а не воздействуя только на VEGF, можно создать новый эффективный метод борьбы с ангиогенезом при лечении рака (Kryczek, Lange et al., 2005).

Линии клеток рака молочной железы, располагающие сигнальным путем SDF-1/CXCR4, действуют агрессивно. Подобное поведение характеризуется более высокой инвазией и миграцией наряду с ускоренным ростом. Таким образом, система SDF-1/CXCR4 может предоставить важную информацию, позволяющую прогнозировать агрессивный характер клеток, и создает важные терапевтические цели при лечении рака молочной железы человека (Kang, Watkins et al., 2005).

SDF-1 регулирует миграцию и метастазирование клеток мелкоклеточного рака легкого (SCLC), экспрессирующих CXCR4 на высоком уровне. Активация CXCR4 стимулирует адгезию с А-клетками (такими как стромальные клетки) и молекулами внеклеточного матрикса в микроокружении опухоли. В результате таких адгезивных взаимодействий возрастает устойчивость клеток SCLC к химиотерапии. Поэтому ингибиторы системы SDF-1/CXCR4 могут повышать чувствительность к химиотерапии клеток SCLC и открывают новые терапевтические возможности для субъектов, страдающих SCLC (Hartmann, Burger et al., 2004).

Система SDF-1/CXCR4 действует в качестве главного регулятора движения стволовых клеток разных типов в организме. Так как большинство, если не все злокачественные новообразования, возникает в компартменте стволовых клеток/клеток-предшественников, то раковые стволовые клетки также экспрессируют CXCR4 на своей поверхности и, таким образом, система SDF-1/CXCR4 участвует в направлении движения/метастазирования указанных клеток в органы, экспрессирующие SDF-1 (например, лимфатические узлы, легкие, печень, кости). Поэтому методы лечения, направленные на модуляцию системы SDF-1/CXCR4, могут найти важное клиническое применение как в регенеративной терапии для доставки нормальных стволовых клеток в ткани, так и в клинической онкологии для ингибирования метастазирования раковых стволовых клеток (Kucia, Reca et al., 2005).

Одной целью настоящего изобретения является создание специфического антагониста для SDF-1. Другой целью настоящего изобретения является создание соединения для лечения заболеваний и нарушений, ассоциированных соответственно с SDF-1 и рецептором CXCR4.

Еще одной целью настоящего изобретения является создание способов специфического обнаружения SDF-1.

Цели настоящего изобретения раскрываются в независимых пунктах формулы изобретения. Предпочтительные варианты осуществления изобретения рассмотрены в зависимых пунктах формулы изобретения.

Первым объектом настоящего изобретения является молекула нуклеиновой кислоты, предпочтительно связывающаяся с SDF-1 и выбираемая из группы, включающей молекулы нуклеиновых кислот типа А, молекулы нуклеиновых кислот типа В, молекулы нуклеиновых кислот типа С и молекулы нуклеиновых кислот, имеющие последовательность нуклеиновой кислоты, соответствующую любой из SEQ ID NO:142, SEQ ID NO:143 и SEQ ID NO:144.

В одном варианте осуществления изобретения молекулы нуклеиновых кислот типа А включают следующую центральную нуклеотидную последовательность:

5' AAAGYRACAHGUMAAXAUGAAAGGUARC 3' (SEQ ID NO:19),

где ХА или отсутствует, или означает А.

В предпочтительном варианте осуществления изобретения молекулы нуклеиновых кислот типа А содержат центральную нуклеотидную последовательность, выбираемую из группы, включающей:

5' AAAGYRACAHGUMAAUGAAAGGUARC 3' (SEQ ID NO:20),

5' AAAGYRACAHGUMAAAUGAAAGGUARC 3' (SEQ ID NO:21) и

5' AAAGYAACAHGUCAAUGAAAGGUARC 3' (SEQ ID NO:22),

при этом, предпочтительно, центральная нуклеотидная последовательность включает 5' AAAGYAACAHGUCAAUGAAAGGUARC 3' (SEQ ID NO:22).

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит в направлении 5'→3' первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит в направлении 5'→3' второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов.

В предпочтительном варианте осуществления изобретения молекула нуклеиновой кислоты содержит первый и второй фрагменты нуклеотидов, при этом указанные первый и второй фрагменты нуклеотидов необязательно гибридизируют друг с другом, образуя в результате гибридизации двунитевую структуру.

В другом предпочтительном варианте осуществления изобретения двунитевая структура состоит из четырех-шести пар оснований, предпочтительно из пяти пар оснований.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' X1X2NNBV 3' (SEQ ID NO:44), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' BNBNX3X4 3' (SEQ ID NO:45),

где Х1 или отсутствует, или означает R, Х2 означает S, Х3 означает S, и Х4 или отсутствует, или означает Y; либо

Х1 отсутствует, Х2 или отсутствует, или означает S, Х3 или отсутствует, или означает S, и Х4 отсутствует.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' RSHRYR 3' (SEQ ID NO:23), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' YRYDSY 3' (SEQ ID NO:24), при этом, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' GCUGUG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' CGCAGC 3'.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' X2BBBS 3' (SEQ ID NO:42), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' SBBVX3 3' (SEQ ID NO:43),

где Х2 или отсутствует, или означает S, и Х3 или отсутствует, или означает S;

при этом, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' CUGUG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' CGCAG 3'; или первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' GCGUG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' CGCGC 3'.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит последовательность нуклеиновой кислоты, соответствующую любой последовательности SEQ ID NO:5-18, 25-41, 133, 137, 139-141.

В одном варианте осуществления изобретения молекулы нуклеиновых кислот типа В содержат следующую центральную нуклеотидную последовательность:

5' GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG 3' (SEQ ID NO:57).

В предпочтительном варианте осуществления изобретения молекулы нуклеиновых кислот типа В содержат центральную нуклеотидную последовательность GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG (SEQ ID NO:58).

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит в направлении 5'→3' первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит в направлении 5'→3' второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов.

В предпочтительном варианте осуществления изобретения молекула нуклеиновой кислоты содержит первый и второй фрагменты нуклеотидов, при этом указанные первый и второй фрагменты нуклеотидов необязательно гибридизируют друг с другом, образуя в результате гибридизации двунитевую структуру.

В одном варианте осуществления изобретения двунитевая структура состоит из четырех-шести пар оснований, предпочтительно, из пяти пар оснований.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' X1X2SVNS 3' (SEQ ID NO:77), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' BVBSX3X4 3' (SEQ ID NO:78), где

Х1 или отсутствует, или означает А, Х2 означает G, Х3 означает С, и Х4 или отсутствует, или означает U; либо

Х1 отсутствует, Х2 или отсутствует, или означает G, Х3 или отсутствует, или означает С, и Х4 отсутствует.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' X1GCRWG 3' (SEQ ID NO:59), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' KRYSCX4 3' (SEQ ID NO:60),

где Х1 или отсутствует, или означает А, и Х4 или отсутствует, или означает U.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' X1GCGUG 3' (SEQ ID NO:75), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' UACGCX4 3' (SEQ ID NO:76),

где Х1 или отсутствует, или означает А, и Х4 или отсутствует, или означает U,

при этом, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' AGCGUG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' UACGCU 3'.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' X2SSBS 3' (SEQ ID NO:73), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' BVSSX3 3' (SEQ ID NO:74),

где Х2 или отсутствует, или означает G, и Х3 или отсутствует, или означает С,

при этом, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' GCGUG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' UACGC 3'.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит последовательность нуклеиновой кислоты, соответствующую любой последовательности SEQ ID NO:46-56, 61-72, 132.

В одном варианте осуществления изобретения молекулы нуклеиновых кислот типа С содержат центральную нуклеотидную последовательность GGUYAGGGCUHRXAAGUCGG (SEQ ID NO:90),

где Х1 или отсутствует, или означает А.

В предпочтительном варианте осуществления изобретения молекулы нуклеиновых кислот типа С содержат центральную нуклеотидную последовательность, выбираемую из группы, включающей:

5' GGUYAGGGCUHRAAGUCGG 3' (SEQ ID NO:91),

5' GGUYAGGGCUHRAGUCGG 3' (SEQ ID NO:92) и

5' GGUUAGGGCUHGAAGUCGG 3' (SEQ ID NO:93),

при этом, предпочтительно, центральная нуклеотидная последовательность включает 5'GGUUAGGGCUHGAAGUCGG 3' (SEQ ID NO:93).

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит в направлении 5'→3' первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит в направлении 5'→3' второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов.

В предпочтительном варианте осуществления изобретения молекула нуклеиновой кислоты содержит первый и второй фрагменты нуклеотидов, при этом, по меньшей меры, часть указанного первого фрагмента и, по меньшей мере, часть указанного второго фрагмента нуклеотида необязательно гибридизируют друг с другом, образуя в результате гибридизации двунитевую структуру.

В одном варианте осуществления изобретения длина первого фрагмента и длина второго фрагментов в отдельности и независимо равны 0-17 нуклеотидам, предпочтительно, 4-10 нуклеотидам и более предпочтительно, 4-6 нуклеотидам.

В одном варианте осуществления изобретения двунитевая структура включает 4-10 пар оснований, предпочтительно, 4-6 пар оснований, более предпочтительно, 5 пар оснований.

В предпочтительном варианте осуществления изобретения двунитевая структура включает 4-10 последовательных пар оснований, предпочтительно, 4-6 последовательных пар оснований, более предпочтительно, 5 последовательных пар оснований.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' RKSBUSNVGR 3' (SEQ ID NO:120), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' YYNRCASSMY 3' (SEQ ID NO:121), при этом, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' RKSBUGSVGR 3' (SEQ ID NO:122), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' YCNRCASSMY 3' (SEQ ID NO:123).

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' XSSSSV 3' (SEQ ID NO:124), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5'BSSSXS 3' (SEQ ID NO:125), где XS или отсутствует, или означает S.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' SSSSR 3' (SEQ ID NO:130), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' YSBSS 3' (SEQ ID NO:131), при этом, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' SGGSR 3' (SEQ ID NO:126), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' YSCCS 3' (SEQ ID NO:127).

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' GCSGG 3' (SEQ ID NO:128), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' CCKGC 3' (SEQ ID NO:129), при этом, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' GCCGG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' CCGGC 3'.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' CGUGCGCUUGAGAUAGG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5' CUGAUUCUCACG 3'.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5'UGAGAUAGG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5'CUGAUUCUCA 3'.

В одном варианте осуществления изобретения первый фрагмент нуклеотидов включает нуклеотидную последовательность 5' GAGAUAGG 3', и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5'CUGAUUCUC 3'.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит последовательность нуклеиновой кислоты, соответствующую любой последовательности SEQ ID NO:79-89, 94-119, 134-136.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты содержит последовательность нуклеиновой кислоты, соответствующую любой последовательности SEQ ID NO:142-144.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты является антагонистом SDF-1.

В одном варианте осуществления изобретения молекула нуклеиновой кислоты является антагонистом системы SDF-1/рецептор, при этом, предпочтительно, рецептор SDF-1 системы SDF-1/рецептор является рецептором CXCR4.

В одном варианте осуществления изобретения SDF-1 является SDF-1 человека, и/или рецептор SDF-1 является рецептором SDF-1 человека.

В одном варианте осуществления изобретения SDF-1 содержит аминокислотную последовательность, соответствующую SEQ ID NO:1.

В одном варианте осуществления изобретения нуклеиновая кислота включает модификацию.

В предпочтительном варианте осуществления изобретения модификацию выбирают из группы, включающей часть HES и часть PEG.

В другом предпочтительном варианте осуществления изобретения модификация является частью PEG, включающей PEG с прямой или разветвленной цепью, при этом молекулярная масса части PEG предпочтительно составляет от около 2 до 180 кДа, более предпочтительно, от около 60 до 140 кДа и, наиболее предпочтительно, около 40 кДа.

В одном варианте осуществления изобретения модификация является частью HES, при этом молекулярная масса части HES составляет от около 10 до 130 кДа, более предпочтительно, от около 30 до 130 кДа и, наиболее предпочтительно, около 100 кДа.

В одном варианте осуществления изобретения нуклеотиды нуклеиновой кислоты являются L-нуклеотидами, предпочтительно нуклеотидами последовательностей, соответствующих любой последовательности SEQ ID NO:19, 20, 21, 22, 57, 58, 90, 91, 92 и 93.

Вторым объектом настоящего изобретения является фармацевтическая композиция, содержащая нуклеиновую кислоту по первому объекту изобретению и необязательно дополнительный компонент, который выбирают из группы, включающей фармацевтически приемлемые эксципиенты и фармацевтически активные агенты.

Третьим объектом настоящего изобретения является применение нуклеиновой кислоты по первому объекту изобретения для приготовления лекарственного средства.

В варианте осуществления изобретения, относящемся к третьему объекту настоящего изобретения, лекарственное средство предназначено для лечения и/или профилактики заболевания или нарушения, опосредованного SDF-1, которое предпочтительно выбирают из группы, включающей заболевания глазного дна, такие как диабетическая ретинопатия и возрастная дегенерация желтого пятна; рак молочной железы, яичника, предстательной железы, поджелудочной железы, щитовидной железы, носоглотки, ободочной кишки, легкого и желудка; остеосаркому; меланому; глиому; медуллобластому и нейробластому; лейкоз; синдром WHIM; синдромы иммунологической недостаточности; патологическая неоваскуляризация; воспаление; рассеянный склероз; ревматоидный артрит/остеоартрит и нефрит.

В варианте осуществления изобретения, относящемся к третьему объекту настоящего изобретения, лекарственное средство предназначено для ингибирования ангиогенеза, неоваскуляризации, воспаления и метастазирования.

Четвертым объектом настоящего изобретения является применение нуклеиновой кислоты по первому объекту настоящего изобретения для приготовления диагностического средства.

В варианте осуществления изобретения, относящемся к четвертому объекту настоящего изобретения, диагностическое средство предназначено для диагностики заболевания, выбираемого из группы, включающей заболевания глазного дна, такие как диабетическая ретинопатия и возрастная дегенерация желтого пятна; рак молочной железы, яичника, предстательной железы, поджелудочной железы, щитовидной железы, носоглотки, ободочной кишки, легкого и желудка; остеосаркому; меланому; глиому; медуллобластому и нейробластому; лейкоз; синдром WHIM; синдромы иммунологической недостаточности; патологическую неоваскуляризацию; воспаление; рассеянный склероз; ревматоидный артрит/остеоартрит и нефрит.

В варианте осуществления изобретения, относящемся к четвертому объекту настоящего изобретения, диагностическое средство предназначено для диагностики ангиогенеза, неоваскуляризации, воспаления и/или метастазирования.

Пятым объектом настоящего изобретения является комплекс, включающий SDF-1 и нуклеиновую кислоту по первому объекту настоящего изобретения, при этом указанный комплекс предпочтительно является кристаллическим комплексом.

Шестым объектом настоящего изобретения является применение нуклеиновой кислоты по первому объекту настоящего изобретения для обнаружения SDF-1.

Седьмым объектом настоящего изобретения является способ скрининга антагониста SDF-1 или агониста SDF-1, включающий следующие стадии:

- обеспечение антагониста SDF-1-кандидата и/или агониста SDF-1-кандидата;

- обеспечение нуклеиновой кислоты по первому объекту настоящего изобретения;

- обеспечение тестовой системы, подающей сигнал в присутствии антагониста SDF-1 и/или агониста SDF-1; и

- определение того, является ли антагонист SDF-1-кандидат антагонистом SDF-1 и/или является ли агонист SDF-1-кандидат агонистом SDF-1.

Восьмым объектом настоящего изобретения является способ скрининга агониста SDF-1 и/или антагониста SDF-1, включающий следующие стадии:

- обеспечение SDF-1, иммобилизованного в определенной фазе, предпочтительной в твердой фазе;

- обеспечение нуклеиновой кислоты по первому объекту настоящего изобретения, предпочтительно меченой нуклеиновой кислоты по первому объекту настоящего изобретения;

- добавление агониста SDF-1-кандидата и/или антагониста SDF-1-кандидата; и

- определение того, является ли агонист SDF-1-кандидат агонистом SDF-1 и/или является ли антагонист SDF-1-кандидат антагонистом SDF-1.

В варианте осуществления изобретения, относящемся к восьмому объекту настоящего изобретения, определение выполняют, оценивая замену нуклеиновой кислоты агонистом SDF-1-кандидатом или антагонистом SDF-1-кандидатом.

Девятым объектом настоящего изобретения является набор для обнаружения SDF-1, включающий нуклеиновую кислоту по первому объекту настоящего изобретения.

Десятым объектом настоящего изобретения является антагонист SDF-1, получаемый способом по седьмому или восьмому объекту настоящего изобретения.

В основе настоящего изобретения лежит удивительное открытие, делающее возможным получение нуклеиновых кислот, связывающихся специфически и с высокой степенью сродства к SDF-1.

SDF-1 является основным пептидом, содержащим аминокислотную последовательность, соответствующую SEQ ID NO:1. Вычисленное значение pI SDF-1 равно 9,70. В используемом здесь значении термин “SDF-1” означает любой SDF-1, который включает, не ограничиваясь им, SDF-1 млекопитающего. Предпочтительно, SDF-1 млекопитающего выбирают из группы, включающей SDF-1 мыши, крысы, кролика, хомячка, обезьяны и человека. Наиболее предпочтительно, SDF-1 является SDF-1 человека (SEQ ID NO:1).

Открытие, позволяющее идентифицировать нуклеиновые кислоты с высоким сродством связывания с SDF-1, является весьма удивительным, поскольку Итон и др. (Eaton, Gold et al., 1997) отмечали, что очень трудно создать аптамеры, то есть D-нуклеиновые кислоты, связывающиеся с молекулой-мишенью, относящейся к основному белку, так как мишень подобного типа создает высокое, но неспецифическое отношение сигнал - шум. Высокое отношение сигнал - шум возникает вследствие сильного неспецифического сродства, присущего нуклеиновым кислотам в отношении основных мишеней, таких как SDF-1.

Отличительные признаки нуклеиновой кислоты по настоящему изобретению могут быть использованы в любом объекте настоящего изобретения, где указанная нуклеиновая кислота используется отдельно или в любой комбинации.

Не желая ограничивать себя какой-либо теорией, авторы настоящего изобретения считают, что наблюдаемая специфичность связывания нуклеиновых кислот по настоящему изобретения с SDF-1 определяется наличием общих структурных признаков, в частности, присутствием одной из нуклеотидных последовательностей, которые в настоящем описании изобретения именуются также центральными последовательностями и будут более подробно описаны ниже со ссылкой на фиг.1-8 и пример 1. Однако следует отметить, что на указанных фигурах и в примере 1 представлены лишь некоторые из указанных структурных признаков, которые не обязательно должны присутствовать во всех нуклеиновых кислотах по настоящему изобретению.

Как более подробно описано в формуле изобретения и примере 1, разные молекулы нуклеиновых кислот, связывающих SDF-1 человека, могут быть классифицированы на основании указанных блоков, а также некоторых структурных признаков и элементов. Установленные таким образом разные категории также определяются в настоящем описании изобретения как типы и более специфически как тип А, тип В и тип С.

В предпочтительном варианте осуществления изобретения нуклеиновая кислота по настоящему изобретению представляет собой отдельную молекулу нуклеиновой кислоты. В другом варианте осуществления изобретения отдельная молекула нуклеиновой кислоты присутствует в виде нескольких отдельных молекул нуклеиновых кислот. Предпочтительно, термины “нуклеиновая кислота” и “молекула нуклеиновой кислоты” имеют взаимозаменяемые значения в настоящем описании изобретения за исключением особо оговоренных случаев.

Специалистам в данной области должно быть известно, что молекула нуклеиновой кислоты по настоящему изобретению предпочтительно состоит из нуклеотидов, ковалентно связанных друг с другом, предпочтительно при помощи фосфодиэфирных звеньев или связей.

Нуклеиновые кислоты по настоящему изобретению включают также нуклеиновые кислоты, которые по существу гомологичны определенным последовательностям, рассмотренным в настоящем описании изобретения. Термин “по существу гомологичны” означает, что гомология равна, по меньшей мере, 75%, предпочтительно 85%, более предпочтительно 90% и наиболее предпочтительно превышает 95%, 96%, 97%, 98% или 99%.

Фактическое процентное значение гомологичных нуклеотидов, присутствующих в нуклеиновой кислоте по настоящему изобретению, зависит от общего числа нуклеотидов в нуклеиновой кислоте. Процентное значение модификации может быть определено с учетом общего числа нуклеотидов в нуклеиновой кислоте.

Гомология может быть определена методами, известными специалистам в данной области. В частности, сначала определяют алгоритм сравнения последовательностей, на основании которого затем вычисляют процентное значение идентичности одной или нескольких испытуемых последовательностей относительно эталонной последовательности с учетом заданных параметров программы. Испытуемая последовательность предпочтительно является последовательностью или молекулой нуклеиновой кислоты, в отношении которой определяют, является ли она гомологичной другой молекуле нуклеиновой кислоты, и, если да, то в какой степени, при этом указанная другая молекула нуклеиновой кислоты именуется также эталонной последовательностью. В одном варианте осуществления изобретения эталонная последовательность является молекулой нуклеиновой кислоты по настоящему изобретению, более предпочтительно молекулой нуклеиновой кислоты, имеющей последовательность, соответствующую любой последовательности SEQ ID NO:5-144. Оптимальный сравнительный анализ последовательностей может быть выполнен, например, при помощи алгоритма локальной гомологии Смита и Ватермана (Smith & Waterman, 1981), алгоритма сравнительного анализа гомологии Нидлмана и Вунша (Needleman & Wunsch, 1970), метода поиска сходства Пирсона и Липмана (Pearson & Lipman, 1988), компьютеризированного применения указанных алгоритмов (GAP, BESTFIT, FASTA и TFASTA в пакете программ Wisconsin Genetics Software, Genetics Computer Group, 575 Science Dr., Madison, Wis.) или визуального сравнения.

Одним примером алгоритма, пригодного для определения процентного значения идентичности последовательностей, является алгоритм, используемый в базовом инструментальном средстве поиска, служащем для выполнения локального сравнительного анализа (далее именуемом “BLAST”); см., например, публикации Altschul et al., 1990, и Altschul et al., 1997. Программное обеспечение для выполнения анализов BLAST является общедоступным в Национальном центре биотехнологической информации (далее именуемом “NCBI”). Параметры по умолчанию, используемые для определения идентичности последовательностей при помощи программного обеспечения, предоставляемого NCBI, например, BLASTN (для нуклеотидных последовательностей) и BLASTP (для аминокислотных последовательностей), описаны в публикации (McGinnis et al., 2004).

В определение термина “нуклеиновая кислота, обладающая признаками изобретения” или “нуклеиновая кислота по настоящему изобретению” входят также нуклеиновые кислоты, содержащие последовательности нуклеиновых кислот, рассмотренные в настоящем изобретении, или их части, предпочтительно в объеме, обеспечивающем связывание указанных нуклеиновых кислот или их частей с SDF-1. Такая нуклеиновая кислота может быть выделена из нуклеиновых кислот, рассмотренных в настоящем описании изобретения, например, путем усечения. Усечение может быть произведено у одного или обоих концов нуклеиновых кислот по настоящему изобретению. Кроме того, может быть произведено усечение внутренней последовательности нуклеотидов, то есть могут быть удалены нуклеотиды, расположенные соответственно между 5'- и 3'-концевым нуклеотидом. Усечение должно включать делецию, по меньшей мере, одного нуклеотида из последовательностей нуклеиновых кислот по настоящему изобретению. Может быть также произведено усечение нескольких фрагментов нуклеиновых кислот по настоящему изобретению, при этом фрагмент может иметь длину, равную одному нуклеотиду. Специалисты в данной области могут определить способность связывания нуклеиновой кислоты по настоящему изобретению при помощи обычных экспериментов или, адаптируя метод, рассмотренный в настоящем описании изобретения, предпочтительно в разделе “Примеры”.

Нуклеиновые кислоты по настоящему изобретению могут быть D-нуклеиновыми кислотами или L-нуклеиновыми кислотами. Нуклеиновые кислоты по настоящему изобретению предпочтительно являются L-нуклеиновыми кислотами. Кроме того, одна или несколько частей нуклеиновой кислоты могут быть D-нуклеиновыми кислотами или по меньшей мере одна или несколько частей нуклеиновых кислот могут быть L-нуклеиновыми кислотами. Термин “часть” нуклеиновой кислоты означает, по меньшей мере, один нуклеотид. Такие нуклеиновые кислоты обычно определяются в настоящем описании изобретения соответственно как D- и L-нуклеиновые кислоты. Поэтому в особенно предпочтительном варианте осуществления изобретения нуклеиновые кислоты по настоящему изобретению состоят из L-нуклеотидов и включают, по меньшей мере, один D-нуклеотид. Такой D-нуклеотид предпочтительно присоединен к части, отличной от фрагментов, определяющих нуклеиновые кислоты по настоящему изобретению, предпочтительно к части, взаимодействующей с другими частями нуклеиновой кислоты. Такой D-нуклеотид предпочтительно присоединен соответственно к концу любых фрагментов и любой нуклеиновой кислоты по настоящему изобретению. В другом предпочтительном варианте осуществления изобретения такие D-нуклеотиды могут служить в качестве спейсера или линкера, предпочтительно присоединяющего модифицирующие группы, такие как PEG и HES, к нуклеиновым кислотам по настоящему изобретению.

В соответствии с настоящим изобретением любые молекулы нуклеиновых кислот по настоящему изобретению, рассматриваемые как единое целое на основании их последовательностей нуклеиновых кислот, ограничены определенными нуклеотидными последовательностями. Другими словами, термины “включающий” или “включает” в таком варианте осуществления изобретения имеют значения “содержащий” или “состоящий из”.

В соответствии с настоящим изобретением нуклеиновые кислоты по настоящему изобретению являются частью более длинной нуклеиновой кислоты, при этом указанная более длинная нуклеиновая кислота включает несколько частей, из которых по крайней мере одна такая часть является нуклеиновой кислотой или ее частью по настоящему изобретению. Другие части указанных более длинных нуклеиновых кислот могут быть одной или несколькими D-нуклеиновыми кислотами или L-нуклеиновыми кислотами. В соответствии с настоящим изобретением может быть использована любая комбинация. Вышеуказанные другие части более длинной нуклеиновой кислоты могут выполнять функцию, отличную от связывания, предпочтительно от связывания с SDF-1. Одной возможной функцией является осуществление взаимодействия с другими молекулами, причем такие другие молекулы предпочтительно отличаются от SDF-1, например, для иммобилизации, перекрестного сшивания, обнаружения или амплификации. В другом варианте осуществления изобретения нуклеиновые кислоты по настоящему изобретению включают несколько нуклеиновых кислот по настоящему изобретению в виде отдельных или объединенных частей. Такая нуклеиновая кислота, включающая несколько нуклеиновых кислот по настоящему изобретению, также входит в определение более длинной нуклеиновой кислоты.

L-Нуклеиновые кислоты в используемом здесь значении являются нуклеиновыми кислотами, состоящими из L-нуклеотидов, предпочтительно полностью состоящими из L-нуклеотидов.

D-Нуклеиновые кислоты в используемом здесь значении являются нуклеиновыми кислотами, состоящими из D-нуклеотидов, предпочтительно полностью состоящими из D-нуклеотидов.

Термины “нуклеиновая кислота” и “молекула нуклеиновой кислоты” имеют в настоящем описании изобретения взаимозаменяемые значения за исключением особо оговоренных случаев.

Кроме того, за исключением особо оговоренных случаев любая нуклеотидная последовательность расположена в направлении 5'→3'.

Независимо от того, состоит ли нуклеиновая кислота по настоящему изобретению из D-нуклеотидов, L-нуклеотидов или их комбинации, которая является, например, произвольной комбинацией или строго определенной последовательностью фрагментов, включающей, по меньшей мере, один L-нуклеотид и, по меньшей мере, одну D-нуклеиновую кислоту, указанная нуклеиновая кислота может состоять из дезоксирибонуклеотида(ов), рибонуклеотида(ов) или их комбинаций.

Нуклеиновые кислоты по настоящему изобретению выгоднее получать в виде L-нуклеиновой кислоты по нескольким причинам. L-Нуклеиновые кислоты являются энантиомерами природных нуклеиновых кислот. D-Нуклеиновые кислоты являются не очень устойчивыми в водных растворах и, в частности, в биологических системах или биологических образцах из-за присутствия большого числа нуклеаз. Природные нуклеазы, в частности, нуклеазы из животных клеток, не способны разрушать L-нуклеиновые кислоты. Вследствие этого биологический период полувыведения L-нуклеиновой кислоты значительно больше в такой системе, включая организм животного и человека. Благодаря тому, что L-нуклеиновая кислота не разрушается под воздействием нуклеаз, не образуются продукты разрушения нуклеазами и, таким образом, не возникают вызываемые ими побочные эффекты. Данный признак выделяет L-нуклеиновую кислоту фактически из всех других соединений, используемых при лечении заболеваний и/или нарушений, обусловленных присутствием SDF-1. L-Нуклеиновые кислоты, которые специфически связываются с молекулой-мишенью при помощи механизма, отличного от спаривания оснований Ватсона-Крика, или аптамеры, которые частично или полностью состоят из L-нуклеотидов, присутствующих в частях аптамера, служащих для связывания аптамера с молекулой-мишенью, именуются также шпигельмерами.

В соответствии с настоящим изобретением первый и второй фрагменты нуклеотидов, фланкирующих центральную нуклеотидную последовательность, могут в принципе гибридизировать друг с другом. В результате такой гибридизации образуется двунитевая структура. Специалистам в данной области должно быть известно, что такая гибридизация может происходить или не происходить в условиях in vitro и/или in vivo. Кроме того, даже если такая гибридизация происходит, не обязательно, что два фрагмента будут гибридизированы на протяжении всей длины, но, по крайней мере, из правил спаривания оснований следует, что такая гибридизация и, следовательно, образование двунитевой структуры могут иметь место. Как указано в настоящем описании изобретения, двунитевая структура предпочтительно является частью молекулы или структуры, образованной двумя или большим числом отдельных нитей, которые включают, по меньшей мере, одну, предпочтительно две или более пар оснований, спаривание которых предпочтительно происходит в соответствии с правилами спаривания оснований Ватсона-Крика. Специалистам в данной области должно быть также известно, что спаривание оснований, в результате которого образуется такая двунитевая структура, может происходить в соответствии с другими принципами, например, по правилам спаривания оснований Хугстена.

В соответствии с настоящим изобретением нуклеиновые кислоты по настоящему изобретению независимо от того, являются они D-нуклеиновыми кислотами, L-нуклеиновыми кислотами или D,L-нуклеиновыми кислотами либо ДНК или РНК, могут присутствовать в виде однонитевых или двунитевых нуклеиновых кислот. Нуклеиновые кислоты по настоящему изобретению обычно являются однонитевыми нуклеиновыми кислотами, имеющими определенные вторичные структуры, соответствующие первичной последовательности, и, таким образом, могут также образовывать третичные структуры. Однако нуклеиновые кислоты по настоящему изобретению могут быть также двунитевыми с учетом того, что две нити, комплементарные или частично комплементарные друг другу, гибридизируют друг с другом. Такая структура сообщает устойчивость нуклеиновой кислоты, что, в частности, является благоприятным фактором, если данная нуклеиновая кислота присутствует в природной D-форме, а не в L-форме.

Нуклеиновые кислоты по настоящему изобретению могут быть модифицированы. Такие модификации могут относиться к одному нуклеотиду нуклеиновой кислоты и хорошо известны в данной области. Примеры такой модификации описаны наряду с другими публикациями в статьях Венкатесана и др. (Venkatesan, Kim et al., 2003) и Куссера (Kusser, 2000). Может быть модифицирован атом Н, атом F, группа О-СН3 или группа NH2 в положении 2' отдельного нуклеотида, входящего в состав нуклеиновой кислоты. Кроме того, нуклеиновая кислота по настоящему изобретению может включать, по меньшей мере, один нуклеотид LNA. В одном варианте осуществления изобретения нуклеиновая кислота по настоящему изобретению состоит из нуклеотидов LNA.

В одном варианте осуществления изобретения нуклеиновые кислоты по настоящему изобретению могут быть многораздельными нуклеиновыми кислотами. Многораздельная нуклеиновая кислота в используемом здесь значении является нуклеиновой кислотой, которая состоит, по меньшей мере, из двух нитей нуклеиновой кислоты. Указанные, по меньшей мере, две нити нуклеиновой кислоты образуют функциональную единицу, которая является лигандом молекулы-мишени. По меньшей мере, две нити нуклеиновой кислоты могут быть выделены из любых нуклеиновых кислот по настоящему изобретению путем расщепления нуклеиновой кислоты с образованием двух нитей или синтеза одной нуклеиновой кислоты, соответствующей первой части нуклеиновой кислоты по настоящему изобретению, то есть всей нуклеиновой кислоты, и другой нуклеиновой кислоты, соответствующей второй части всей нуклеиновой кислоты. Следует отметить, что как расщеплением, так и синтезом, рассмотренными выше, может быть получена многораздельная нуклеиновая кислота, состоящая более чем из двух нитей. Другими словами, по меньшей мере, две нити нуклеиновой кислоты обычно отличаются от двух нитей, являющихся комплементарными и гибридизирующими друг с другом, хотя некоторая степень комплементарности между разными частями нуклеиновой кислоты может иметь место.

И наконец, в соответствии с настоящим изобретением нуклеиновые кислоты по настоящему изобретению имеют полностью замкнутую, то есть кольцевую структуру, в частности, нуклеиновые кислоты по настоящему изобретению замкнуты предпочтительно при помощи ковалентной связи, причем более предпочтительно такая ковалентная связь образована между 5'-концом и 3'-концом последовательностей нуклеиновых кислот, рассмотренных в настоящем описании изобретения.

Авторы настоящего изобретения обнаружили, что нуклеиновые кислоты по настоящему изобретению характеризуются весьма благоприятным диапазоном значений Kd.

Константу связывания можно определить путем измерения резонанса поверхностного плазмона при помощи прибора Biacore (Biacore AB, Uppsala, Sweden), который также должен быть известен специалисту в данной области. Сродство связывания в значении, предпочтительно используемом в настоящем описании изобретения, измеряли при помощи “анализа ослабления связывания”, описанного в примерах. Интенсивность связывания между нуклеиновой кислотой и мишенью, которой в данном случае является SDF-1, можно измерить при помощи так называемого значения Kd, которое наряду с методом его определения должно быть известно специалисту в данной области.

Нуклеиновые кислоты по настоящему изобретению характеризуются определенным значением Kd. Значение Kd, присущее нуклеиновым кислотам по настоящему изобретению, предпочтительно меньше 1 мкМ. Считается, что значение Kd, равное примерно 1 мкМ, характерно для неспецифического связывания нуклеиновой кислоты с мишенью. Как должно быть известно специалистам в данной области, значение Kd группы соединений, таких как нуклеиновые кислоты по настоящему изобретению, находится в определенном диапазоне. Вышеуказанное значение Kd, равное примерно 1 мкМ, является предпочтительным верхним пределом значения Kd. Предпочтительный нижний предел значения Kd нуклеиновых кислот, связывающихся с мишенью, может быть равен примерно 10 пикомоль или больше. В соответствии с настоящим изобретением значения Kd отдельных нуклеиновых кислот, связывающихся с SDF-1, предпочтительно находятся в указанном диапазоне. Предпочтительные диапазоны можно определить путем выбора любого первого числа в данном диапазоне и любого второго числа в данном диапазоне. Предпочтительные верхние значения равны 250 нМ и 100 нМ, предпочтительные нижние значения равны 50 нМ, 10 нМ, 1 нМ, 100 пМ и 10 пМ.

Молекулы нуклеиновых кислот по настоящему изобретению могут иметь любую длину при условии, что они по-прежнему могут связываться с молекулой-мишенью. Специалистам в данной области должно быть известно, что существуют предпочтительные длины нуклеиновых кислот по настоящему изобретению. Длина нуклеиновой кислоты обычно равна 15-120 нуклеотидам. Специалистам в данной области должно быть известно, что любое целое число от 15 до 120 может означать возможную длину нуклеиновых кислот по настоящему изобретению. Более предпочтительные длины нуклеиновых кислот по настоящему изобретения находятся в пределах от около 20 до 100 нуклеотидов, от около 20 до 80 нуклеотидов, от около 20 до 60 нуклеотидов, от около 20 до 50 нуклеотидов и от около 20 до 40 нуклеотидов.

В соответствии с настоящим изобретением нуклеиновые кислоты по настоящему изобретению включают часть молекулы, которая предпочтительно является высокомолекулярной частью и/или предпочтительно позволяет модифицировать характеристики нуклеиновой кислоты, включающие, наряду с другими отличительными признаками, время пребывания в организме животного, предпочтительно в организме человека. Особенно предпочтительным вариантом такой модификации является модификация нуклеиновых кислот по настоящему изобретению PEG и HES. В значении, используемом в настоящем описании изобретения, PEG означает полиэтиленгликоль, и HES означает гидроксиэтиловый крахмал. Модификация нуклеиновой кислоты по настоящему изобретению с помощью PEG предполагает присоединение части PEG к нуклеиновой кислоте по настоящему изобретению. Модификация нуклеиновой кислоты по настоящему изобретению с помощью HES предполагает присоединение части HES к нуклеиновой кислоте по настоящему изобретению. Указанные модификации и способ такой модификации нуклеиновой кислоты описаны в заявке на европейский патент ЕР 1306382, которая полностью включена в настоящее описание изобретения в качестве ссылки.

Молекулярная масса модифицированной нуклеиновой кислоты, включающей высокомолекулярную часть, составляет около 2000-200000 Да, предпочтительно 40000-120000 Да, когда такой высокомолекулярной частью является PEG, и предпочтительно около 3000-180000 Да, более предпочтительно 60000-140000 Да, когда такой высокомолекулярной частью является HES. Способ модификации нуклеиновой кислоты с помощью HES описан, например, в заявке на патент Германии DE 12004006249.8, которая полностью включена в настоящее описание изобретения в качестве ссылки.

В соответствии с настоящим изобретением PEG и HES могут иметь линейную или разветвленную цепь, как описано в заявках на патент WO 2005074993 и РСТ/EP02/11950. Такая модификация может быть выполнена в молекулах нуклеиновых кислот по настоящему изобретению в любом положении. Такую модификацию предпочтительно выполняют в положении 5'-концевого нуклеотида, 3'-концевого нуклеотида и/или любого нуклеотида между 5'-концевым нуклеотидом и 3'-концевым нуклеотидом молекулы нуклеиновой кислоты.

Модификация и, предпочтительно, часть PEG и/или HES может быть присоединена непосредственно к молекуле нуклеиновой кислоты по настоящему изобретению или с помощью линкера. В соответствии с настоящим изобретением молекула нуклеиновой кислоты по настоящему изобретению включает одну или несколько модификаций, предпочтительно одну или несколько частей PEG и/или HES. В одном варианте осуществления изобретения один линкер присоединяет к молекуле нуклеиновой кислоты по настоящему изобретению несколько частей PEG или несколько частей HES. Линкер, используемый в настоящем изобретении, может иметь линейную или разветвленную цепь. Линкеры такого типа известны специалистам в данной области и описаны в заявках на патент WO 2005074993 и РСТ/EP02/11950.

Не ограничиваясь какой-либо теорией, можно предположить, что в результате модификации нуклеиновых кислот по настоящему изобретению высокомолекулярной частью, такой как полимер, и, в частности, полимеры по настоящему изобретению, которые предпочтительно являются физиологически приемлемыми, изменяется кинетика экскреции. По-видимому, благодаря более высокой молекулярной массе таких модифицированных нуклеиновых кислот по настоящему изобретению и вследствие того, что указанные нуклеиновые кислоты не подвергаются метаболизму, особенно при нахождении в L-форме, уменьшается экскреция из организма животного, предпочтительно из организма млекопитающего и более предпочтительно из организма человека. Так как экскреция обычно происходит через почки, авторы настоящего изобретения полагают, что уровень гломерулярной фильтрации модифицированной таким образом нуклеиновой кислоты значительно снижается по сравнению с нуклеиновыми кислотами, не подвергнутыми такой высокомолекулярной модификации, которая способствует увеличению времени пребывания в организме. В связи с вышеизложенным следует особенно отметить, что, несмотря на такую высокомолекулярную модификацию, специфичность нуклеиновой кислоты по настоящему изобретению не ухудшается. Нуклеиновые кислоты по настоящему изобретению обладают удивительными характеристиками, которые обычно отсутствуют у фармацевтически активных соединений, благодаря чему нет необходимости использовать фармацевтическую композицию с пролонгированным действием для обеспечения длительного высвобождения лекарственного средства. Модифицированные нуклеиновые кислоты по настоящему изобретению, содержащие высокомолекулярную часть, могут быть сами по себе использованы в качестве композиции с пролонгированным действием. Таким образом, модификации молекул нуклеиновых кислот, рассмотренные в настоящем описании изобретения, модифицированные молекулы нуклеиновых кислот и любые композиции, содержащие такие молекулы, могут быть использованы для достижения совершенно новой, предпочтительно контролируемой фармакокинетики и необходимого распределения в организме. Вышеуказанные показатели включают также время пребывания в кровотоке и распределение в тканях. Такие модификации далее описаны в заявке на патент РСТ/EP02/11950.

Однако в объем настоящего изобретения входят также нуклеиновые кислоты, рассмотренные в настоящем описании изобретения, которые не включают никаких модификаций и, в частности, высокомолекулярных модификаций, таких как присоединение PEG или HES. Такой вариант осуществления изобретения является особенно предпочтительным в тех случаях, когда желателен быстрый клиренс нуклеиновых кислот из организма после введения. Такой быстрый клиренс может быть желателен при получении изображений in vivo или в случае специальных требований, предъявляемых к дозированию лекарственного средства, при использовании нуклеиновых кислот по настоящему изобретению или лекарственных средств, содержащих указанные нуклеиновые кислоты.

Нуклеиновые кислоты, обладающие признаками новизны, которые также определяются в настоящем описании изобретения как нуклеиновые кислоты по настоящему изобретению, и/или антагонисты по настоящему изобретению могут быть использованы для получения или приготовления лекарственного средства. Такое лекарственное средство содержит, по меньшей мере, одну из нуклеиновых кислот по настоящему изобретению необязательно вместе с другими фармацевтически активными соединениями, при этом нуклеиновая кислота по настоящему изобретению предпочтительно сама действует в качестве фармацевтически активного соединения. В предпочтительных вариантах осуществления изобретения такие лекарственные средства содержат, по меньшей мере, один фармацевтически приемлемый носитель. Таким носителем может быть, например, вода, буфер, PBS, раствор глюкозы, раствор сахарозы, раствор маннозы, предпочтительно 5% сбалансированный раствор сахарозы, крахмал, сахар, желатин или любой другой приемлемый носитель. Такие носители известны специалистам в данной области. Специалисту в данной области должно быть известно, что любые варианты осуществления изобретения, его применения и объекты, относящиеся к лекарственному средству по настоящему изобретению, применимы также к фармацевтической композиции по настоящему изобретению и наоборот.

Показания, заболевания и нарушения, предназначенные для лечения и/или профилактики с помощью нуклеиновых кислот, фармацевтических композиций и лекарственных средств, полученных в соответствии с настоящим изобретением, являются следствием прямого или косвенного воздействия SDF-1 в соответствии с определенным патогенным механизмом.

Так как SDF-1-связывающие нуклеиновые кислоты по настоящему изобретению взаимодействуют или связываются с SDF-1 человека или мыши, специалисту в данной области должно быть понятно, что SDF-1-связывающие нуклеиновые кислоты по настоящему изобретению могут быть использованы для лечения, профилактики и/или диагностики любых заболеваний человека и животных, рассмотренных в настоящем описании изобретения.

Заболевания, нарушения и/или болезненные состояния, предназначенные для лечения и/или профилактики с использованием такого лекарственного средства, включают, не ограничиваясь ими, заболевания глазного дна, такие как ретинопатия, диабетическая ретинопатия и возрастная дегенерация желтого пятна, включающая сухую и влажную формы; рак; рак молочной железы, яичника, предстательной железы, поджелудочной железы, щитовидной железы, носоглотки, ободочной кишки, легкого и желудка; остеосаркому; меланому; глиому; медуллобластому и нейробластому; лейкоз; В-клеточный хронический лимфолейкоз; множественную миелому; лимфому; синдром WHIM; синдромы иммунологической недостаточности; патологическую неоваскуляризацию; воспаление; рассеянный склероз; артрит, ревматоидный артрит, остеоартрит и нефрит.

В другом варианте осуществления изобретения лекарственное средство содержит другой фармацевтически активный агент. Такими другими фармацевтически активными соединениями могут быть соединения, известные специалистам в данной области и предпочтительно выбираемые из группы, включающей антагонисты хемокина или цитокина, кортикостероиды и тому подобные. Специалисту в данной области должно быть понятно, что в случае других показаний к применению нуклеиновых кислот по настоящему изобретению может быть использован любой другой фармацевтически активный агент(ы), который(ые) пригоден(дны) для лечения и/или профилактики таких заболеваний. Молекулы нуклеиновых кислот по настоящему изобретению, особенно при использовании в виде лекарственного средства, предпочтительно объединяют с ингибиторами VEGF, такими как макуген (пегатаниб) компании Pfizer Ophthalmics, люцентис (ранитизумаб) компании Novartis Ophthalmics, авастин (бевацизумаб) компании Roche (применение без описательной этикетки); или с фотодинамическим лекарственным средством, таким как визудин (вертепорфинг) компании Novartis Ophthalmics и производное кортизона, вводимое в стекловидное тело глаза, такое как ретаан (ацетат анекортава) компании Alcon Inc.

Альтернативно или дополнительно вышеуказанный другой фармацевтически активный агент является другой нуклеиновой кислотой по настоящему изобретению. Альтернативно лекарственное средство содержит, по меньшей мере, еще одну нуклеиновую кислоту, которая связывается с молекулой-мишенью, отличной от SDF-1, или выполняет функцию, отличную от функции, выполняемой одной из нуклеиновых кислот по настоящему изобретению.

Как должно быть известно специалистам в данной области, нуклеиновые кислоты по настоящему изобретению фактически могут быть использованы для лечения любого заболевания, при котором антагонист SDF-1 может быть введен субъекту, нуждающемуся в таком антагонисте, и такой антагонист пригоден для устранения причины заболевания или нарушения или, по меньшей мере, способен ослабить симптомы такого заболевания или нарушения. Такие симптомы включают, не ограничиваясь ими, патологическое образование новых сосудов, воспаление и метастазирование. Возможность применения нуклеиновых кислот по настоящему изобретению для лечения указанных и других заболеваний или нарушений определяется наряду с прочим участием в патологическом процессе SDF-1, на что было указано в вводной части настоящего описания изобретения, которая включена в данный абзац в качестве ссылки во избежание ненужного повторения.

В соответствии с настоящим изобретением для профилактики любых заболеваний альтернативно или дополнительно может быть использовано лекарственное средство, применяемое для лечения указанных заболеваний. Специалистам в данной области известны соответствующие маркеры, сопутствующие определенным заболеваниям. Таким маркером предпочтительно является SDF-1. Альтернативно и/или дополнительно соответствующий маркер выбирают из группы маркеров окислительного стресса, включающих трансмембранную редуктазу феррицианида (TMR), повышенную активность сигнального пути сорбита, возникающую после накопления сорбита, повышенное отношение цитозольного NADH/NAD, снижение NADPH и накопление фруктозы с возникающим вследствие этого неферментативным продуцированием конечных продуктов повышенного гликозилирования (AGES) и последующую активацию протеинкиназы С, нитрозный и окислительный стресс, опосредуемый событиями в нижней области, такими, как активация МАР-киназы; воспалительных маркеров, включающих ICAM-1, VCAM-1, RANTES, гаптоглобин или С-реактивный белок; и маркеров развития кровеносных сосудов, таких как эритропоэтин или VEGF. С учетом вышеизложенного указанные маркеры могут быть использованы для определения возможности лечения субъекта любыми молекулами нуклеиновых кислот по настоящему изобретению. Поэтому еще одним объектом настоящего изобретения является способ определения присутствия или отсутствия и, в частности, концентрации соответствующего маркера(ов). Специалистам в данной области известны методы обнаружения указанных маркеров и необязательно методы их количественного определения, а также диапазон, в котором должен присутствовать или отсутствовать соответствующий маркер, которые позволяют определить у субъекта наличие любого из указанных заболеваний или вероятность возникновения таких заболеваний и, следовательно, возможность лечения данного субъекта способом по настоящему изобретению.

Один вариант осуществления настоящего изобретения относится к лекарственному средству, предназначенному для использования в комбинации с другими методами лечения любых заболеваний, рассмотренных в настоящем описании изобретения, в частности, заболеваний, для лечения которых должно быть использовано лекарственное средство по настоящему изобретению.

“Комбинированная терапия” включает введение лекарственного средства по настоящему изобретению и, по меньшей мере, одного второго лекарственного средства в качестве составной части конкретной схемы лечения, позволяющей получить благоприятный результат благодаря совместному действию указанных лекарственных средств, то есть лекарственного средства по настоящему изобретению и указанного второго лекарственного средства. Благоприятный результат применения указанной комбинации включает, не ограничиваясь им, фармакокинетическое или фармакодинамическое совместное действие, оказываемое комбинацией лекарственных средств. Указанные лекарственные средства обычно вводят в комбинации в течение определенного периода времени (обычно в течение нескольких минут, часов, дней или недель в зависимости от выбранной комбинации).

“Комбинированная терапия” предполагает, хотя и не всегда, введение двух или большего числа указанных лекарственных средств в виде составной части отдельных схем монотерапии, которые случайно и произвольно образуют комбинации по настоящему изобретению. “Комбинированная терапия” предполагает последовательное введение указанных лекарственных средств, когда каждое лекарственное средство вводят в разное время, а также по существу одновременное введение указанных лекарственных средств или, по меньшей мере, двух лекарственных средств. По существу одновременное введение может быть достигнуто, например, при введении субъекту одной капсулы с постоянным соотношением каждого лекарственного средства или в виде нескольких отдельных капсул, содержащих разные лекарственные средства.

Лекарственные средства могут быть введены последовательно или по существу одновременно любыми приемлемыми способами, которые включают, не ограничиваясь ими, местное введение, пероральное введение, внутривенное введение, внутримышечное введение и прямую абсорбцию через ткани слизистой оболочки. Указанные лекарственные средства можно вводить одинаковыми или разными способами. Например, первое лекарственное средство выбранной комбинации может быть введено при помощи инъекции, в то время как другие лекарственные средства данной комбинации могут быть введены местно.

Например, альтернативно все лекарственные средства могут быть введены местно или при помощи инъекции. Последовательность введения лекарственных средств не имеет конкретных ограничений за исключением особо оговоренных случаев. “Комбинированная терапия” может также включать введение вышеуказанных лекарственных средств в другой комбинации с другими биологически активными ингредиентами. Если комбинированная терапия далее включает лечение без применения лекарственных средств, такое лечение может быть проведено в любое приемлемое время при достижении благоприятного результата, обеспечиваемого комбинацией лекарственных средств и лечением без применения лекарственных средств. Например, в некоторых случаях благоприятный результат достигается при временной отмене лечения без применения лекарственных средств во время введения лекарственных средств, возможно, на несколько дней или даже недель.

Как было указано выше, лекарственное средство по настоящему изобретению можно вводить в любой форме, известной специалистам в данной области. Предпочтительным способом введения является системное введение, более предпочтительно парентеральное введение, в частности, при помощи инъекций. Альтернативно лекарственное средство можно вводить местно. Другие способы введения включают внутримышечное, внутрибрюшинное и подкожное введение, пероральное, назальное, внутритрахеальное или легочное введение, при этом предпочтительным способом введения является наименее инвазивный, но эффективный способ.

Парентеральное введение обычно осуществляют при помощи подкожных, внутримышечных или внутривенных инъекций и вливаний. Кроме того, одним способом парентерального введения, хорошо известным специалистам в данной области, является имплантация систем с медленным или пролонгированных действием, которые позволяют поддерживать постоянный уровень дозы.

Кроме того, предпочтительные лекарственные средства по настоящему изобретению можно вводить в назальной форме путем местного применения вводимых в нос препаратов, лекарственных форм для ингаляции или путем чрескожного введения с использованием чрескожных пластырей, хорошо известных специалистам в данной области. Введение дозы в виде системы чрескожной доставки должно быть непрерывным, а не периодическим на протяжении всей схемы введения. Другие предпочтительные местнодействующие препараты включают кремы, мази, лосьоны, аэрозоли и гели, в которых концентрация активного ингредиента обычно находится в пределах от 0,01% до 15% мас./мас. или мас./об.

Лекарственное средство по настоящему изобретению обычно содержит эффективное количество активного компонента, который включает, не ограничиваясь ею, молекулу нуклеиновой кислоты по настоящему изобретению, растворенную или диспергированную в фармацевтически приемлемой среде. Фармацевтически приемлемые среды или носители включают любые растворители, диспергирующие среды, покрытия, антибактериальные и противогрибковые средства, изотонические средства, средства, замедляющие абсорбцию, и тому подобные. В данной области известно применение таких сред и агентов для фармацевтически активных веществ. В лекарственное средство по настоящему изобретению могут быть также введены дополнительные активные ингредиенты.

Еще одним объектом настоящего изобретения является фармацевтическая композиция. Такая фармацевтическая композиция содержит по меньшей мере одну из нуклеиновых кислот по настоящему изобретению и предпочтительно фармацевтически приемлемое связывающее вещество. Такое связывающее вещество может быть любым связывающим веществом, используемым и/или известным в данной области. В частности, таким связывающим веществом является любое связывающее вещество, рассмотренное в связи с приготовлением лекарственного средства по настоящему изобретению. В еще одном варианте осуществления изобретения фармацевтическая композиция содержит другое фармацевтически активное средство.

Специалистам в данной области должен быть известен способ получение лекарственного средства и фармацевтической композиции в свете настоящего описания изобретения. Такие композиции могут быть получены в виде инъецируемых средств, представляющих собой жидкие растворы или суспензии; твердых форм, пригодных для растворения или получения суспензии в жидкости перед инъецированием; таблеток или других твердых форм для перорального введения; капсул с пролонгированным действием; или любых других форм, используемых в настоящее время, которые включают глазные капли, кремы, лосьоны, целебные мази, лекарственные препараты для ингаляции и тому подобные. Применение стерильных композиций, таких как примочки на основе физиологического раствора, хирургами, лечащими врачами или медицинскими работниками для обработки определенного участка операционного поля также может быть весьма полезным. Композиции могут быть также доставлены при помощи микроустройства, микрочастиц или губки.

Полученное лекарственное средство вводят способом, совместимым с типом лекарственной формы, и в фармакологически эффективном количестве. Указанные композиции можно легко вводить в разных лекарственных формах, таких как вышеуказанные инъекционные растворы, но могут быть также использованы капсулы с пролонгированным действием и подобные лекарственные формы.

В данном контексте количество активного ингредиента и объем вводимой композиции зависит от субъекта, подлежащего лечению. Конкретные вводимые количества активного соединения зависят от решения лечащего врача и являются индивидуальными для каждого субъекта.

Обычно используют минимальный объем лекарственного средства, необходимый для диспергирования активных соединений. Приемлемые схемы введения также являются различными, но должны быть конкретизированы на основании первоначального введения соединения, контроля результатов и введения последующих регулируемых доз через разные интервалы времени.

Например, в таблетке или капсуле (например, в желатиновой капсуле), предназначенной для перорального введения, активный компонент лекарственного средства, то есть молекула нуклеиновой кислоты по настоящему изобретению и/или любой другой фармацевтически активный агент, определяемый также как лекарственное(ые) средство(а) или активное(ые) соединение(я), могут быть объединены с предназначенным для перорального введения нетоксичным фармацевтически приемлемым инертным носителем, таким как этанол, глицерин, вода и тому подобные. Кроме того, при желании или необходимости в смесь могут быть также добавлены приемлемые связывающие вещества, смазывающие вещества, дезинтегрирующие вещества и красители. Приемлемые связывающие вещества включают крахмал, алюмосиликат магния, пастообразный крахмал, желатин, метилцеллюлозу, натрий-карбоксиметилцеллюлозу и/или поливинилпирролидон, натуральные сахара, такие как глюкоза или бета-лактоза, кукурузные подсластители, природные или синтетические камеди, такие аравийская камедь, трагант или альгинат натрия, полиэтиленгликоль, воски и тому подобные. Смазывающие вещества, используемые в указанных лекарственных формах, включают олеат натрия, стеарат натрия, стеарат магния, бензоат натрия, ацетат натрия, хлорид натрия, диоксид кремния, тальк, стеариновую кислоту, ее магниевую или кальциевую соль и/или полиэтиленгликоль и тому подобные. Дезинтеграторы включают без каких-либо ограничений крахмал, метилцеллюлозу, агар, бентонит, крахмалы из ксантановой камеди, агар, альгиновую кислоту или ее натриевую соль, углекислые смеси и тому подобные. Разбавители включают, например, лактозу, декстрозу, сахарозу, маннит, сорбит, целлюлозу и/или глицин.

Лекарственное средство по настоящему изобретению можно также вводить в таких лекарственных формах для перорального введения как таблетки или капсулы с пролонгированным действием, пилюли, порошки, гранулы, эликсиры, настойки, суспензии, сиропы и эмульсии. Суппозитории предпочтительно получают из жирных эмульсий или суспензий.

Фармацевтическая композиция или лекарственное средство могут быть стерилизованы и/или могут содержать вспомогательные вещества, такие как консервирующие, стабилизирующие, смачивающие или эмульгирующие вещества, ускорители растворения, соли, регулирующие осмотическое давление, и/или буферы. Кроме того, фармацевтические композиции могут также содержать другие терапевтически полезные вещества. Указанные композиции получают стандартными методами смешивания, гранулирования или нанесения покрытия и обычно содержат примерно 0,1%-75%, предпочтительно примерно 1%-50% активного ингредиента.

Жидкие, в частности, инъецируемые композиции могут быть получены путем растворения, диспергирования и т.д. Активное соединение растворяют или смешивают с фармацевтически чистым растворителем, таким как, например, вода, физиологический раствор, водный раствор декстрозы, глицерин, этанол и тому подобные, с образованием инъекционного раствора или суспензии. Кроме того, могут быть получены твердые формы, пригодные для растворения в жидкости перед выполнением инъекции.

Наполнители, используемые для получения твердых композиций, включают фармацевтические сорта маннита, лактозы, крахмала, стеарата магния, натрий-сахарина, талька, целлюлозы, глюкозы, сахарозы, карбоната магния и тому подобных. Вышеуказанное активное соединение может быть также получено в виде суппозиториев с использованием в качестве носителя полиалкиленгликолей, например пропиленгликоля. В некоторых вариантах осуществления изобретения суппозитории преимущественно получают из жирных эмульсий или суспензий.

Лекарственные средства и молекулы нуклеиновых кислот по настоящему изобретению можно также вводить в форме систем для доставки липосом, таких как мелкие однослойные пузырьки, крупные однослойные пузырьки и многослойные пузырьки. Липосомы могут быть получены из целого ряда фосфолипидов, содержащих холестерин, стеариламин или фосфатидилхолины. В некоторых вариантах осуществления изобретения пленку липидных компонентов гидратируют водным раствором лекарственного средства с образованием липидного слоя, инкапсулирующего лекарственное средство, что хорошо известно специалистам в данной области. Например, молекулы нуклеиновых кислот по настоящему изобретению могут быть получены в виде комплекса с липофильным соединением или неиммуногенным высокомолекулярным соединением, полученным методами, известными в данной области. Кроме того, липосомы могут нести на своей поверхности молекулы нуклеиновых кислот, предназначенные для направленного воздействия и переноса находящихся внутри цитотоксических агентов, опосредующих уничтожение клеток. Пример комплексов, ассоциированных с нуклеиновой кислотой, приведен в патенте США № 6011020.

Лекарственные средства и молекулы нуклеиновых кислот по настоящему изобретению могут быть также связаны с растворимыми полимерами, используемыми в качестве носителей направленно воздействующего лекарственного средства. Такие полимеры могут включать поливинилпирролидон, сополимер пирана, сополимер полигидроксипропила, метакриламида и фенола, полигидроксиэтиласпанамидофенол или полиэтиленоксидеполилизин, замещенный пальмитоильными остатками. Кроме того, лекарственные средства и молекулы нуклеиновых кислот по настоящему изобретению могут быть связаны с поддающимися биологическому разложению полимерами, используемыми для контролируемого высвобождения лекарственного средства, такими как, например, полимер молочной кислоты, полиэпсилонкапролактон, полигидроксимасляная кислота, сложные полиортоэфиры, полиацетали, полидигидропираны, полицианоакрилаты и перекрестно сшитые или амфипатические блок-сополимеры гидрогелей.

При желании предназначенные для введения фармацевтическая композиция и лекарственное средство могут также содержать незначительные количества нетоксичных вспомогательных веществ, таких как смачивающие или эмульгирующие вещества, буферы, регулирующие значение рН, и другие вещества, такие как, например, ацетат натрия и олеат триэтаноламина.

Схему введения молекул нуклеиновых кислот и лекарственных средств по настоящему изобретению выбирают с учетом целого ряда факторов, включающих тип, вид, возраст, массу тела, пол и медицинское состояние субъекта; тяжесть заболевания, подлежащего лечению; способ введения; функционирование почек и печени субъекта; конкретный используемый аптамер или его соль. Квалифицированный врач или ветеринар может легко определить эффективное количество лекарственного средства, необходимое для предотвращения, противодействия или прекращения развития заболевания.

Эффективные уровни нуклеиновой кислоты по настоящему изобретению в плазме предпочтительно находятся в пределах от 500 фМ до 500 мкМ при лечении любых вышеуказанных заболеваний.

Молекулы нуклеиновых кислот и лекарственные средства по настоящему изобретению можно предпочтительно вводить в виде одной суточной дозы, через один или два дня, один раз в неделю, через неделю, один раз в месяц или через два месяца.

В соответствии с настоящим изобретением лекарственное средство по настоящему изобретению представляет собой фармацевтическую композицию по настоящему изобретению.

Еще одним объектом настоящего изобретения является способ лечения субъекта, нуждающегося в таком лечении, который включает введение фармацевтически активного количества, по меньшей мере, одной из нуклеиновых кислот по настоящему изобретению. В одном варианте осуществления изобретения субъект страдает заболеванием или подвержен риску возникновения такого заболевания, в частности, любого заболевания, рассмотренного в связи с применением любых нуклеиновых кислот по настоящему изобретению для приготовления лекарственного средства.

В значении, предпочтительно используемом в настоящем описании изобретения, диагностический агент или диагностическое средство предназначено для прямого или непрямого обнаружения SDF-1, описанного в связи с разными нарушениями и заболеваниями по настоящему изобретению. Диагностическое средство предназначено для обнаружения и/или наблюдения за развитием любых нарушений и заболеваний, рассмотренных в настоящем описании изобретения. Обнаружение возможно благодаря связыванию нуклеиновых кислот по настоящему изобретению с SDF-1. Такое связывание может быть обнаружено прямыми или непрямыми методами. Соответствующие методы и средства обнаружения известны специалистам в данной области. Нуклеиновые кислоты по настоящему изобретению могут содержать метку, позволяющую обнаружить указанные нуклеиновые кислоты, предпочтительно нуклеиновые кислоты, связанные с SDF-1. Такую метку предпочтительно выбирают из группы, включающей радиоактивные, ферментативные и флуоресцентные метки. В частности, для нуклеиновых кислот по настоящему изобретению могут быть адаптированы все известные методы, разработанные для антител, в которых нуклеиновую кислоту, связывающую мишень, заменяют антителом, связывающим мишень. При выполнении анализов с использованием немеченных антител, связывающих мишень, обнаружение предпочтительно производят вторичным антителом, модифицированным радиоактивными, ферментативными и флуоресцентными метками, которое связывается с антителом, связывающим мишень, у Fc-фрагмента. Нуклеиновую кислоту, предпочтительно нуклеиновую кислоту по настоящему изобретению, модифицируют меткой, которую предпочтительно выбирают из группы, включающей биотин, Су-3 и Су-5, и обнаруживают при помощи антитела против такой метки, например, антитела против биотина, антитела против Су-3 или антитела против Су-5, либо, в случае использования биотина, такую метку обнаруживают при помощи стрептавидина или авидина, которые естественно связываются с биотином. Такое антитело, стрептавидин или авидин в свою очередь предпочтительно модифицируют соответствующей меткой, например, радиоактивной, ферментативной или флуоресцентной меткой (подобно вторичному антителу).

В другом варианте осуществления изобретения молекулы нуклеиновых кислот по настоящему изобретению обнаруживают или анализируют при помощи второго детектирующего средства, которое является молекулярным маяком. Метод применения молекулярного маяка известен специалистам в данной области. Зонды нуклеиновых кислот, которые также определяются как молекулярные маяки, представляют собой обратный комплемент к подлежащему обнаружению образцу нуклеиновой кислоты и благодаря этому гибридизируют с частью такого образца нуклеиновой кислоты. При связывании с образцом нуклеиновой кислоты флуорофорные группы молекулярного маяка отделяются, что вызывает изменение флуоресцентного сигнала, предпочтительно его интенсивности. Данное изменение соответствует количеству присутствующего образца нуклеиновой кислоты.

Специалисту в данной области должно быть известно, что благодаря описанному взаимодействию между SDF-1 и соответствующим рецептором, заболевания и состояния, которые могут быть диагностированы при помощи молекул нуклеиновых кислот по настоящему изобретению, в принципе аналогичны заболеваниям и состояниям, описанным в связи с применением указанных молекул нуклеиновых кислот для лечения и/или профилактики указанных заболеваний.

Помимо вышеизложенного, применение молекул нуклеиновых кислот по настоящему изобретению позволяет уменьшить гемопоэз, инвазию опухоли или метастазирование, сократить образование В-клеток и гемотаксис, уменьшить хемоатракцию Т-клеток, затормозить рост клеток и вызвать их апоптоз.

Предпочтительный метод обнаружения SDF-1 включает следующие стадии:

(а) получение образца, подлежащего испытанию на наличие SDF-1;

(b) получение нуклеиновой кислоты по настоящему изобретению;

(с) осуществление взаимодействие образца с нуклеиновой кислотой, предпочтительно выполняемого в реакционном сосуде;

при этом стадия (а) может быть выполнена до стадии (b) и стадия (b) может быть выполнена до стадии (а).

В предпочтительном варианте осуществления изобретения выполняют еще одну стадию (d), которая включает обнаружение взаимодействия образца с нуклеиновой кислотой. Нуклеиновую кислоту, полученную на стадии (b), предпочтительно иммобилизуют на поверхности. Такой поверхностью может быть поверхность реакционного сосуда, например, пробирки, лунка планшета или поверхность устройства, находящегося в реакционном сосуде, например, гранулы. Нуклеиновую кислоту можно иммобилизовать на поверхности любыми способами, известными специалистам в данной области, которые включают, не ограничиваясь им, связывание нековалентными или ковалентными связями. Нуклеиновую кислоту предпочтительно связывают с поверхностью при помощи ковалентной химической связи. Однако в соответствии с настоящим изобретением нуклеиновая кислота может быть иммобилизована на поверхности непрямым методом, при этом такая непрямая иммобилизация включает использование дополнительного компонента или пары партнеров взаимодействия. Таким дополнительным компонентом предпочтительно является соединение, специфически взаимодействующее с иммобилизуемой нуклеиновой кислотой, которое также определяется как партнер взаимодействия и опосредует прикрепление нуклеиновой кислоты к поверхности. Партнера взаимодействия предпочтительно выбирают из группы, включающей нуклеиновые кислоты, полипептиды, белки и антитела. Партнером взаимодействия предпочтительно является антитело, более предпочтительно моноклональное антитело. Альтернативно партнером взаимодействия является нуклеиновая кислота, предпочтительно функциональная нуклеиновая кислота. Более предпочтительно такую функциональную нуклеиновую кислоту выбирают из группы, включающей аптамеры, шпигельмеры и нуклеиновые кислоты, которые, по меньшей мере, частично комплементарны данной нуклеиновой кислоте. В другом альтернативном варианте осуществления изобретения связывание нуклеиновой кислоты с поверхностью опосредовано многораздельным партнером взаимодействия. Таким многораздельным партнером взаимодействия предпочтительно является пара партнеров взаимодействия или партнер взаимодействия, состоящий из первого члена и второго члена, при этом первый член входит в структуру или присоединен к нуклеиновой кислоте и второй член присоединен или входит в структуру поверхности. Многораздельного партнера взаимодействия предпочтительно выбирают из группы пар партнеров взаимодействия, включающих биотин и авидин, биотин и стрептавидин, биотин и нейтравидин. Первым членом пары партнеров взаимодействия предпочтительно является биотин.

Предпочтительным результатом такого метода является образование иммобилизованного комплекса SDF-1 и нуклеиновой кислоты, и более предпочтительным результатом является возможность обнаружения указанного комплекса. В соответствии с настоящим изобретением в данном комплексе обнаруживают SDF-1.

Метод обнаружения SDF-1 также включает стадию удаления образца из реакционного сосуда, который был предпочтительно использован для выполнения стадии (с).

В другом варианте осуществления изобретения указанный метод включает также стадию иммобилизации партнера взаимодействия SDF-1 на поверхности, предпочтительно на вышеуказанной поверхности, при этом партнер взаимодействия аналогичен партнеру взаимодействия, описанному в связи с соответствующим методом, и более предпочтительно включает нуклеиновые кислоты, полипептиды, белки и антитела, указанные в разных вариантах осуществления изобретения. В данном варианте осуществления изобретения особенно предпочтительным детектирующим средством является нуклеиновая кислота по настоящему изобретению, которая может быть предпочтительно меченой или немеченой. Меченая нуклеиновая кислота может быть обнаружена прямым или непрямым методом. Такое обнаружение может быть также произведено с использованием второго детектирующего средства, которое предпочтительно выбирают из группы, включающей нуклеиновые кислоты, полипептиды, белки, описанные в разных вариантах осуществления изобретения. Такие детектирующие средства предпочтительно являются специфичными к нуклеиновой кислоте по настоящему изобретению. В более предпочтительном варианте осуществления изобретения вторым детектирующим средством является молекулярный маяк. В предпочтительном варианте осуществления изобретения нуклеиновая кислота или второе детектирующее средство либо оба вместе могут содержать обнаруживаемую метку. Обнаруживаемую метку предпочтительно выбирают из группы, включающей биотин, бромдезоксиуридиновую метку, дигоксигениновую метку, флуоресцентную метку, УФ-метку, радиоактивную метку и молекулу хелатора. Альтернативно второе детектирующее средство взаимодействует с обнаруживаемой меткой, которая предпочтительно входит в структуру или присоединена к нуклеиновой кислоте. Ниже приведены особенно предпочтительные комбинации:

обнаруживаемой меткой является биотин и вторым детектирующим средством является антитело против биотина;

обнаруживаемой меткой является биотин и вторым детектирующим средством является авидин или авидин-несущая молекула;

обнаруживаемой меткой является биотин и вторым детектирующим средством является стрептавидин или стрептавидин-несущая молекула;

обнаруживаемой меткой является биотин и вторым детектирующим средством является нейтравидин или нейтравидин-несущая молекула;

обнаруживаемой меткой является бромдезоксиуридин и вторым детектирующим средством является антитело против бромдезоксиуридина;

обнаруживаемой меткой является дигоксигенин и вторым детектирующим средством является антитело против дигоксигенина;

обнаруживаемой меткой является хелатор и вторым детектирующим средством является радиоактивный изотоп;

при этом указанная обнаруживаемая метка предпочтительно присоединена к нуклеиновой кислоте. Следует отметить, что комбинация подобного типа может быть также использована в варианте осуществления изобретения, в котором нуклеиновая кислота присоединена к поверхности. В таком варианте осуществления изобретения обнаруживаемую метку предпочтительно присоединяют к партнеру взаимодействия.

И наконец, в соответствии с настоящим изобретением второе детектирующее средство обнаруживают при помощи третьего детектирующего средства, которое предпочтительно является ферментом, более предпочтительно вызывает ферментативную реакцию при обнаружении второго детектирующего средства, или является средством обнаружения излучения, более предпочтительно излучения радиоактивного изотопа. Третье детектирующее средство предпочтительно специфически обнаруживает и/или взаимодействует со вторым детектирующим средством.

В соответствии с вариантом осуществления изобретения, в котором партнер взаимодействия SDF-1 иммобилизован на поверхности, и нуклеиновая кислота по настоящему изобретению предпочтительно введена в комплекс, образованный между партнером взаимодействия и SDF-1, образец может быть удален из реакционной смеси, более предпочтительно из реакционного сосуда, в котором выполняют стадии (с) и/или (d).

В одном вариант осуществления изобретения нуклеиновая кислота по настоящему изобретению включает флуоресцирующую часть, флуоресценция которой является различной для комплекса, образованного между нуклеиновой кислотой и SDF-1, и свободного SDF-1.

В другом варианте осуществления изобретения нуклеиновая кислота является производным нуклеиновой кислоты по настоящему изобретению, которое включает, по меньшей мере, одно флуоресцирующее производное аденозина, заменяющее аденозин. В предпочтительном варианте осуществления изобретения флуоресцирующим производным аденозина является этеноаденозин.

В другом варианте осуществления изобретения комплекс, включающий производное нуклеиновой кислоты по настоящему изобретению и SDF-1, обнаруживают с помощью флуоресценции.

В одном варианте осуществления изобретения указанный способ включает образование сигнала на стадии (с) или стадии (d), который предпочтительно соответствует концентрации SDF-1 в образце.

В предпочтительном варианте осуществления изобретения анализы могут быть выполнены на 96-луночных планшетах, где лунки выполняют роль реакционных сосудов, в которых иммобилизованы компоненты.

Нуклеиновая кислота по настоящему изобретению может быть далее использована в качестве исходного вещества для создания лекарственного средства. Существуют два возможных метода использования нуклеиновой кислоты по настоящему изобретению для указанной цели. Одним методом является скрининг библиотек соединений, которые предпочтительно являются библиотеками низкомолекулярных соединений. В одном варианте осуществления изобретения скрининг характеризуется высокой производительностью. Высокопроизводительный скрининг позволяет произвести быструю, эффективную оценку соединений методом проб и ошибок при выполнении анализа с использованием мишени. Указанный анализ предпочтительно выполняют колориметрическим методом. Специалистам в данной области известны библиотеки, используемые для указанной цели.

Альтернативно нуклеиновая кислота по настоящему изобретению может быть использована для рационального создания лекарственных средств. Рациональное создание лекарственного средства предпочтительно предполагает создание фармацевтической первичной структуры. Начиная с трехмерной структуры мишени, которую обычно идентифицируют такими методами как рентгеновская кристаллография или спектроскопия ядерного магнитного резонанса, при помощи компьютерных программ ведут поиск в базах данных, содержащих структуры многих разных химических соединений. Отобранные компьютером соединения могут быть затем испытаны в лаборатории.

Рациональное создание лекарственных средств может быть начато с любой нуклеиновой кислоты по настоящему изобретению и включает использование структуры, предпочтительно трехмерной структуры, которая подобна структуре нуклеиновых кислот по настоящему изобретению или идентична опосредующим связывание частям структуры нуклеиновых кислот по настоящему изобретению. В любом случае такая структура должна обладать такими же или подобными характеристиками связывания, что и нуклеиновые кислоты по настоящему изобретению. В качестве последующей или альтернативной стадии процесса рационального создания лекарственных средств предпочтительно трехмерную структуру частей нуклеиновых кислот, связывающихся с нейромедиатором, имитируют химическими группами, отличными от нуклеотидов и нуклеиновых кислот. Благодаря такой имитации может быть создано соединение, отличающееся от нуклеиновых кислот. Такое соединение предпочтительно является мелкой молекулой или пептидом.

В случае скрининга библиотек соединений при помощи анализа конкурентного связывания, известного специалистам в данной области, могут быть найдены соответствующие аналоги SDF-1, агонисты SDF-1 или антагонисты SDF-1. Анализы конкурентного связывания могут быть выполнены следующим образом. Нуклеиновую кислоту по настоящему изобретению, предпочтительно шпигельмер, которая является L-нуклеиновой кислотой, связывающей мишень, связывают с твердой фазой. Для идентификации аналогов SDF-1 при выполнении указанного анализа может быть использован меченый SDF-1. Потенциальный аналог будет конкурировать с молекулами SDF-1 за связывание со шпигельмером, что приведет к ослаблению сигнала, полученному соответствующей меткой. Скрининг агонистов или антагонистов может быть выполнен при помощи анализа в культуре клеток, хорошо известного специалистам в данной области.

Набор по настоящему изобретению может включать, по меньшей мере, одну или несколько нуклеиновых кислот по настоящему изобретению. Кроме того, указанный набор может включать, по меньшей мере, одно или несколько положительных или отрицательных контрольных веществ. Положительным контрольным веществом может быть, например, SDF-1, в частности фактор, на который воздействует данная нуклеиновая кислота по настоящему изобретению или с которым она связывается, предпочтительно в жидкой форме. Отрицательным контрольным веществом может быть, например, пептид, выбранный на основании сходства биофизических свойств с SDF-1, но не узнаваемый нуклеиновыми кислотами по настоящему изобретению. Кроме того, указанный набор может включать один или несколько буферов. Разные ингредиенты могут находиться в наборе в сухой или лиофилизованной форме либо растворенными в жидкости. В комплект набора могут входить одна или несколько емкостей, которые в свою очередь могут содержать один или несколько ингредиентов набора. В другом варианте осуществления изобретения в комплект набора входит инструкция или информационная листок, содержащие информацию об использовании набора и находящихся в нем разных ингредиентов.

В значении, предпочтительно использованном в настоящем описании изобретения, термин “лечение” в предпочтительном варианте осуществления изобретения дополнительно или альтернативно означает предотвращение и/или наблюдение за развитием заболевания.

Фармацевтическое и биоаналитическое определение нуклеиновой кислоты по настоящему изобретению необходимо для оценки фармакокинетического и биодинамического профиля в разных тканевых жидкостях, тканях и органах человека и субъекта, отличного от человека. Для указанной цели могут быть использованы любые методы обнаружения, рассмотренные в настоящем описании изобретения или известные специалистам в данной области. Еще одним объектом настоящего изобретения является анализ методом многослойной гибридизации, служащий для обнаружения нуклеиновой кислоты по настоящему изобретению. При выполнении данного анализа используют улавливающий зон и детектирующий зонд. Улавливающий зонд комплементарен первой части и детектирующий зонд комплементарен второй части нуклеиновой кислоты по настоящему изобретению. Улавливающий и детектирующий зонды могут быть образованы нуклеотидами ДНК, нуклеотидами модифицированной ДНК, нуклеотидами модифицированной РНК, нуклеотидами РНК, нуклеотидами ЛНК и/или нуклеотидами ПНК.

Таким образом, улавливающий зонд содержит фрагмент последовательности, комплементарный 5'-концу нуклеиновой кислоты по настоящему изобретению и детектирующий зонд содержит фрагмент последовательности, комплементарный 3'-концу нуклеотидной последовательности по настоящему изобретению. В данном случае улавливающий зонд иммобилизован на поверхности или матрице при помощи 5'-конца, причем указанный зонд может быть иммобилизован непосредственно у 5'-конца или при помощи линкера, расположенного между 5'-концом и поверхностью или матрицей. Однако в принципе линкер может быть присоединен к каждому нуклеотиду улавливающего зонда. Линкер может быть образован гидрофильными линкерами, известными специалистам в данной области, или нуклеотидами D-ДНК, нуклеотидами модифицированной D-ДНК, нуклеотидами D-РНК, нуклеотидами модифицированной D-РНК, нуклеотидами D-ЛНК, нуклеотидами ПНК, нуклеотидами L-РНК, нуклеотидами L-ДНК, нуклеотидами модифицированной L-РНК, нуклеотидами модифицированной L-ДНК и/или нуклеотидами L-ЛНК.

Альтернативно улавливающий зонд содержит фрагмент последовательности, комплементарный 3'-концу нуклеиновой кислоты по настоящему изобретению и детектирующий зонд содержит фрагмент последовательности, комплементарный 5'-концу нуклеиновой кислоты по настоящему изобретению. В данном случае улавливающий зонд иммобилизован на поверхности или матрице при помощи 3'-конца, причем улавливающий зонд может быть иммобилизован непосредственно у 3'-конца или при помощи линкера, расположенного между 3'-концом и поверхностью или матрицей. Однако в принципе линкер может быть присоединен к каждому нуклеотиду фрагмента последовательности, комплементарному нуклеиновой кислоте по настоящему изобретению. Линкер может быть образован гидрофильными линкерами, известными специалистам в данной области, или нуклеотидами D-ДНК, нуклеотидами модифицированной D-ДНК, нуклеотидами D-РНК, нуклеотидами модифицированной D-РНК, нуклеотидами D-ЛНК, нуклеотидами ПНК, нуклеотидами L-РНК, нуклеотидами L-ДНК, нуклеотидами модифицированной L-РНК, нуклеотидами модифицированной L-ДНК и/или нуклеотидами L-ЛНК.

Число нуклеотидов в улавливающем и детектирующем зондах, способных гибридизировать с нуклеиновой кислотой по настоящему изобретению является различным и может зависеть от числа нуклеотидов в улавливающем и/или детектирующем зонде и/или в самой нуклеиновой кислоте по настоящему изобретению. Общее число нуклеотидов в улавливающем и детектирующем зондах, способных гибридизировать с нуклеиновой кислотой по настоящему изобретению, должно соответствовать максимальному числу нуклеотидов в нуклеиновой кислоте по настоящему изобретению. Гибридизацию с 5'-концом или 3'-концом нуклеиновой кислоты по настоящему изобретению должно обеспечивать минимальное число нуклеотидов (2-10 нуклеотидов) в детектирующем и улавливающем зондах. Для достижения высокой специфичности и избирательности между нуклеиновой кислотой по настоящему изобретению и другими нуклеиновыми кислотами в анализируемых образцах общее число нуклеотидов в улавливающем и детектирующем зондах должно быть максимальным или должно соответствовать числу нуклеотидов, имеющихся в нуклеиновой кислоте по настоящему изобретению.

Кроме того, детектирующий зонд предпочтительно несет молекулу маркера или метку, которая может быть обнаружена вышеописанным методом. Метка или молекула маркера в принципе может быть присоединена к каждому нуклеотиду детектирующего зонда. Метка или маркер предпочтительно расположены у 5'-конца или 3'-конца детектирующего зонда, при этом между нуклеотидами детектирующего зонда, комплементарными нуклеиновой кислоте по настоящему изобретению, и меткой может быть вставлен линкер. Линкер может быть образован гидрофильными линкерами, известными специалистам в данной области, или нуклеотидами D-ДНК, нуклеотидами модифицированной D-ДНК, нуклеотидами D-РНК, нуклеотидами модифицированной D-РНК, нуклеотидами D-ЛНК, нуклеотидами ПНК, нуклеотидами L-РНК, нуклеотидами L-ДНК, нуклеотидами модифицированной L-РНК, нуклеотидами модифицированной L-ДНК и/или нуклеотидами L-ЛНК.

Нуклеиновая кислота по настоящему изобретению может быть обнаружена следующим образом.

Один конец нуклеиновой кислоты по настоящему изобретению гибридизирует с улавливающим зондом, и другой конец гибридизирует с детектирующим зондом. Несвязанный детектирующий зонд удаляют в результате выполнения одной или нскольких стадий промывки. Затем может быть измерено количество связанного детектирующего зонда, предпочтительно несущего метку или молекулу маркера.

В значении, предпочтительно использованном в настоящем описании изобретения, термины “заболевание” и “нарушение” являются взаимозаменяемыми за исключением особо оговоренных случаев.

В используемом здесь значении термин “включает” предпочтительно не ограничивает объект, определяемый таким термином. Однако в альтернативном варианте осуществления изобретения указанный термин имеет значение “содержит” и, таким образом, ограничивает объект, определяемый таким термином.

В приведенной ниже таблице представлены идентификационные номера последовательностей (SEQ ID NO:), химические структуры молекул нуклеиновых кислот по настоящему изобретению и молекул-мишеней SDF-1, их действительные последовательности и внутренние справочные номера.

Следует отметить, что нуклеиновые кислоты исследовали на уровне аптамера, то есть D-нуклеиновой кислоты (D-РНК), с использованием биотинилированного D-SDF-1 человека (SEQ ID NO:4) или на уровне шпигельмера, то есть L-нуклеиновой кислоты (L-РНК), с использованием природной конфигурации SDF-1, L-SDF-1 (SDF-1α человека, SEQ ID NO:1). Различные нуклеиновые кислоты имеют одно внутреннее справочное название, но один SEQ ID для молекулы D-РНК (аптамера) и один SEQ ID для молекулы L-РНК (шпигельмера).

Таблица 1 (А)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
1 L-пептид KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK SDF-1α человека/обезьяны/кошки
SDF-1 человека/обезьяны/кошки
2 L-пептид KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM SDF-1β человека/обезьяны/кошки
3 L-пептид KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK SDF-1α мыши
SDF-1 мыши
4 D-пептид KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFK-биотин биотинилированный D-SDF-1 человека
5 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC 192-A10-001
6 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-G10
7 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCGCAGC 192-F10
8 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCACAGC 192-B11
9 L-РНК (ШПИГЕЛЬМЕР) GCUGUAAAAGUAACAUGUCAAUGAAAGGUAACUACAGC 192-C9
10 L-РНК (ШПИГЕЛЬМЕР) GCUGUAAAAGUAACAAGUCAAUGAAAGGUAACUACAGC 192-E10
11 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGUAACAAGUCAAUGAAAGGUAACCACAGC 192-C10
12 L-РНК (ШПИГЕЛЬМЕР) GCAGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-D11
13 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACUGC 192-G11
14 L-РНК (ШПИГЕЛЬМЕР) GCUAUGAAAGUAACAUGUCAAUGAAAGGUAACCAUAGC 192-H11
15 L-РНК (ШПИГЕЛЬМЕР) GCUGCGAAAGCGACAUGUCAAUGAAAGGUAGCCGCAGC 192-D10
16 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCACAGC 192-E9
17 L-РНК (ШПИГЕЛЬМЕР) GCUGUGAAAGUAACAUGUCAAUGAAAGGUAGCCGCAGC 192-H9
Таблица 1 (В)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
18 L-РНК (ШПИГЕЛЬМЕР) AGCGUGAAAGUAACACGUAAAAUGAAAGGUAACCACGCU 191-A6
19 L-РНК (ШПИГЕЛЬМЕР) AAAGYRACAHGUMAAXAUGAAAGGUARC; XA = A или отсутствует Формула типа А-1
20 L-РНК (ШПИГЕЛЬМЕР) AAAGYRACAHGUMAAUGAAAGGUARC Формула типа А-2
21 L-РНК (ШПИГЕЛЬМЕР) AAAGYRACAHGUMAAAUGAAAGGUARC Формула типа А-3
22 L-РНК (ШПИГЕЛЬМЕР) AAAGYAACAHGUCAAUGAAAGGUARC Формула типа А-4
23 L-RNA (ШПИГЕЛЬМЕР) RSHRYR Формула типа А-5-5'
24 L-RNA (ШПИГЕЛЬМЕР) YRYDSY Формула типа А-5-3'
25 L-РНК (ШПИГЕЛЬМЕР) CUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAG 192-A10-002
26 L-РНК (ШПИГЕЛЬМЕР) UGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCA 192-A10-003
27 L-РНК (ШПИГЕЛЬМЕР) GUGAAAGCAACAUGUCAAUGAAAGGUAGCCGC 192-A10-004
28 L-РНК (ШПИГЕЛЬМЕР) UGAAAGCAACAUGUCAAUGAAAGGUAGCCG 192-A10-005
29 L-РНК (ШПИГЕЛЬМЕР) GAAAGCAACAUGUCAAUGAAAGGUAGCC 192-A10-006
30 L-РНК (ШПИГЕЛЬМЕР) AAAGCAACAUGUCAAUGAAAGGUAGC 192-A10-007
31 L-РНК (ШПИГЕЛЬМЕР) GCGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-008
32 L-РНК (ШПИГЕЛЬМЕР) GCGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-015
33 L-РНК (ШПИГЕЛЬМЕР) GCGGAAAGCAACAUGUCAAUGAAAGGUAGCCCGC 192-A10-014
34 L-РНК (ШПИГЕЛЬМЕР) CGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCG 192-A10-016
35 L-РНК (ШПИГЕЛЬМЕР) GCGCAAAGCAACAUGUCAAUGAAAGGUAGCGUGC 192-A10-017
36 L-РНК (ШПИГЕЛЬМЕР) GUGCAAAGCAACAUGUCAAUGAAAGGUAGCGCGC 192-A10-018
Таблица 1 (С)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
37 L-РНК (ШПИГЕЛЬМЕР) CGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGUG 192-A10-019
38 L-РНК (ШПИГЕЛЬМЕР) GGGCAAAGCAACAUGUCAAUGAAAGGUAGCGCCC 192-A10-020
39 L-РНК (ШПИГЕЛЬМЕР) GGCCAAAGCAACAUGUCAAUGAAAGGUAGCGGCC 192-A10-021
40 L-РНК (ШПИГЕЛЬМЕР) GCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGC 192-A10-022
41 L-РНК (ШПИГЕЛЬМЕР) CCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGG 192-A10-023
42 L-РНК (ШПИГЕЛЬМЕР) X2BBBS; X2 = S или отсутствует Формула типа А-6-5'
43 L-РНК (ШПИГЕЛЬМЕР) SBBVX3; X3 = S или отсутствует Формула типа А-6-3'
44 L-РНК (ШПИГЕЛЬМЕР) X1X2NNBV; X1 = R или отсутствует, X2 = S или отсутствует Формула типа А-7-5'
45 L-РНК (ШПИГЕЛЬМЕР) BNBNX3X4; X3 = R или отсутствует, X4 = Y или отсутствует Формула типа А-7-3'
46 L-РНК (ШПИГЕЛЬМЕР) AGCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGCU 193-C2-001
47 L-РНК (ШПИГЕЛЬМЕР) AGCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGCU 193-G2-001
48 L-РНК (ШПИГЕЛЬМЕР) AGCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGUGCGCU 193-F2-001
49 L-РНК (ШПИГЕЛЬМЕР) GCGAGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-G1-002
50 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-D2-002
51 L-РНК (ШПИГЕЛЬМЕР) GCAUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCCC 193-A1-002
52 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGGACGC 193-D3-002
Таблица 1 (D)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
53 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAGAGGCUGAUCCUAGUCAGGUACGC 193-B3-002
54 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAAAGGCUGAUCCUAGUCAGGUACGC 193-H3-002
55 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGUUCCUAGUCAGGUAUGC 193-E3-002
56 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUUAGGUACGC 193-D1-002
57 L-РНК (ШПИГЕЛЬМЕР) GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG Формула типа B-1
58 L-РНК (ШПИГЕЛЬМЕР) GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG Формула типа B-2
59 L-РНК (ШПИГЕЛЬМЕР) X1GCRWG; X1 = A или отсутствует Формула типа B-3-5'
60 L-РНК (ШПИГЕЛЬМЕР) KRYSCX4; X4 = U или отсутствует Формула типа B-3-3'
61 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGC 193-C2-002
62 L-РНК (ШПИГЕЛЬМЕР) CGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACG 193-C2-003
63 L-РНК (ШПИГЕЛЬМЕР) GUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUAC 193-C2-004
64 L-РНК (ШПИГЕЛЬМЕР) UGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUA 193-C2-005
65 L-РНК (ШПИГЕЛЬМЕР) GGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGU 193-C2-006
66 L-РНК (ШПИГЕЛЬМЕР) GUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGG 193-C2-007
67 L-РНК (ШПИГЕЛЬМЕР) GCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGC 193-G2-012
Таблица 1 (Е)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
68 L-РНК (ШПИГЕЛЬМЕР) GCGCGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGCGCGC 193-G2-013
69 L-РНК (ШПИГЕЛЬМЕР) GCGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCGC 193-G2-014
70 L-РНК (ШПИГЕЛЬМЕР) GGGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCCC 193-G2-015
71 L-РНК (ШПИГЕЛЬМЕР) GGCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGCC 193-G2-016
72 L-РНК (ШПИГЕЛЬМЕР) GCCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGGC 193-G2-017
73 L-РНК (ШПИГЕЛЬМЕР) X2SSBS; X2 = G или отсутствует Формула типа B-4-5'
74 L-РНК (ШПИГЕЛЬМЕР) BVSSX3; X3 = C или отсутствует Формула типа B-4-3'
75 L-РНК (ШПИГЕЛЬМЕР) X1GCGUG; X1 = A или отсутствует Формула типа B-5-5'
76 L-РНК (ШПИГЕЛЬМЕР) UACGCX4; X4 = U или отсутствует Формула типа B-5-3'
77 L-РНК (ШПИГЕЛЬМЕР) X1X2SVNS; X1 = A или отсутствует, X2 = G или отсутствует Формула типа B-6-5'
78 L-РНК (ШПИГЕЛЬМЕР) BVBSX3X4; X3 = C или отсутствует, X4 = U или отсутствует Формула типа B-6-3'
79 L-РНК (ШПИГЕЛЬМЕР) GUGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCAC 197-B2
80 L-РНК (ШПИГЕЛЬМЕР) AGCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGCU 191-D5-001
81 L-РНК (ШПИГЕЛЬМЕР) GUGUUGCGGAGGUUAGGGCUAGAAGUCGGUCAGCAGCAC 197-H1
82 L-РНК (ШПИГЕЛЬМЕР) CGUGCGCUUGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCACG 190-A3-001
83 L-РНК (ШПИГЕЛЬМЕР) AGCGUGAAGGGGUUAGGGCUCGAAGUCGGCUGACACGCU 191-A5
Таблица 1 (F)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
84 L-РНК (ШПИГЕЛЬМЕР) GUGCUGCGGGGGUUAGGGCUCGAAGUCGGCCCGCAGCAC 197-H3
85 L-РНК (ШПИГЕЛЬМЕР) GUGUUCCCGGGGUUAGGGCUUGAAGUCGGCCGGCAGCAC 197-B1
86 L-РНК (ШПИГЕЛЬМЕР) GUGUUGCAGGGGUUAGGGCUUGAAGUCGGCCUGCAGCAC 197-E3
87 L-РНК (ШПИГЕЛЬМЕР) GUGCUGCGGGGGUUAGGGCUCAAAGUCGGCCUGCAGCAC 197-H2
88 L-РНК (ШПИГЕЛЬМЕР) GUGCUGCCGGGGUUAGGGCUAA-AGUCGGCCGACAGCAC 197-D1
89 L-РНК (ШПИГЕЛЬМЕР) GUGCUGUGGGGGUCAGGGCUAGAAGUCGGCCUGCAGCAC 197-D2
90 L-РНК (ШПИГЕЛЬМЕР) GGUYAGGGCUHRXAAGUCGG; XA = A или отсутствует Формула типа C-1
91 L-РНК (ШПИГЕЛЬМЕР) GGUYAGGGCUHRAAGUCGG Формула типа C-2
92 L-РНК (ШПИГЕЛЬМЕР) GGUYAGGGCUHRAGUCGG Формула типа C-3
93 L-РНК (ШПИГЕЛЬМЕР) GGUUAGGGCUHGAAGUCGG Формула типа C-4
94 L-РНК (ШПИГЕЛЬМЕР) UGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCA 190-A3-003
95 L-РНК (ШПИГЕЛЬМЕР) GAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUC 190-A3-004
96 L-РНК (ШПИГЕЛЬМЕР) GGGGUUAGGGCUUAAAGUCGGCUGAUUCU 190-A3-007
97 L-РНК (ШПИГЕЛЬМЕР) GCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGC 191-D5-002
98 L-РНК (ШПИГЕЛЬМЕР) CGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACG 191-D5-003
99 L-РНК (ШПИГЕЛЬМЕР) CGGGCGAGGUUAGGGCUAGAAGUCGGUCGACCG 191-D5-004
100 L-РНК (ШПИГЕЛЬМЕР) CGGGCGAGGUUAGGGCUAGAAGUCGGUCGCCCG 191-D5-005
Таблица 1 (G)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
101 L-РНК (ШПИГЕЛЬМЕР) CGGCGAGGUUAGGGCUAGAAGUCGGUCGCCG 191-D5-006
102 L-РНК (ШПИГЕЛЬМЕР) CGGGAGGUUAGGGCUAGAAGUCGGUCCCG 191-D5-007
103 L-РНК (ШПИГЕЛЬМЕР) GGGAGGUUAGGGCUAGAAGUCGGUCCC 191-D5-010
104 L-РНК (ШПИГЕЛЬМЕР) CCGCGGUUAGGGCUAGAAGUCGGGCGG 191-D5-017
105 L-РНК (ШПИГЕЛЬМЕР) CCCGGGUUAGGGCUAGAAGUCGGCGGG 191-D5-029
106 L-РНК (ШПИГЕЛЬМЕР) GGCGGGUUAGGGCUAGAAGUCGGCGCC 191-D5-024
107 L-РНК (ШПИГЕЛЬМЕР) CCCGCGGUUAGGGCUAGAAGUCGGGCGGG 191-D5-017-29a
108 L-РНК (ШПИГЕЛЬМЕР) GCCGCGGUUAGGGCUAGAAGUCGGGCGGC 191-D5-017-29b
109 L-РНК (ШПИГЕЛЬМЕР) CCCCGGGUUAGGGCUAGAAGUCGGCGGGG 191-D5-019-29a
110 L-РНК (ШПИГЕЛЬМЕР) CGGCGGGUUAGGGCUAGAAGUCGGCGCCG 191-D5-024-29a
111 L-РНК (ШПИГЕЛЬМЕР) GGGCGGGUUAGGGCUAGAAGUCGGCGCCC 191-D5-024-29b
112 L-РНК (ШПИГЕЛЬМЕР) UGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCA 197-B2-001
113 L-РНК (ШПИГЕЛЬМЕР) GCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGC 197-B2-002
114 L-РНК (ШПИГЕЛЬМЕР) CUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAG 197-B2-003
115 L-РНК (ШПИГЕЛЬМЕР) UGCGGGGGUUAGGGCUAGAAGUCGGCCUGCA 197-B2-004
116 L-РНК (ШПИГЕЛЬМЕР) GCGGGGGUUAGGGCUAGAAGUCGGCCUGC 197-B2-005
Таблица 1 (H)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
117 L-РНК (ШПИГЕЛЬМЕР) GCCGGGGUUAGGGCUAGAAGUCGGCCGGC 197-B2-006
118 L-РНК (ШПИГЕЛЬМЕР) GGCCGGGGUUAGGGCUAGAAGUCGGCCGGCC 197-B2-006-31a
119 L-РНК (ШПИГЕЛЬМЕР) CGCCGGGGUUAGGGCUAGAAGUCGGCCGGCG 197-B2-006-31b
120 L-РНК (ШПИГЕЛЬМЕР) RKSBUSNVGR Формула типа C-5-5'
121 L-РНК (ШПИГЕЛЬМЕР) YYNRCASSMY Формула типа C-5-3'
122 L-РНК (ШПИГЕЛЬМЕР) RKSBUGSVGR Формула типа C-6-5'
123 L-РНК (ШПИГЕЛЬМЕР) YCNRCASSMY Формула типа C-6-3'
124 L-РНК (ШПИГЕЛЬМЕР) XSSSSV; Xs = S или отсутствует Формула типа C-7-5'
125 L-РНК (ШПИГЕЛЬМЕР) BSSSXS; Xs = S или отсутствует Формула типа C-7-3'
126 L-РНК (ШПИГЕЛЬМЕР) SGGSV Формула типа C-8-5'
127 L-РНК (ШПИГЕЛЬМЕР) YSCCS Формула типа C-8-3'
128 L-РНК (ШПИГЕЛЬМЕР) GCSGG Формула типа C-9-5'
129 L-РНК (ШПИГЕЛЬМЕР) CCKGC Формула типа C-9-3'
130 L-РНК (ШПИГЕЛЬМЕР) SSSSR Формула типа C-10-5'
131 L-РНК (ШПИГЕЛЬМЕР) YSBSS Формула типа C-10-3'
Таблица 1 (I)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
132 L-РНК (ШПИГЕЛЬМЕР) 5'-40 kDa-PEG-
GCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGC
193-G2-012-5'-PEG
133 L-РНК (ШПИГЕЛЬМЕР) 5'-40 kDa-PEG-
GCGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC
192-A10-008-5'-PEG
134 L-РНК (ШПИГЕЛЬМЕР) 5'-40 kDa-PEG-CGGGAGGUUAGGGCUAGAAGUCGGUCCCG 191-D5-007-5'-PEG
135 L-РНК (ШПИГЕЛЬМЕР) 5'-40 kDa-PEG-GCCGGGGUUAGGGCUAGAAGUCGGCCGGC 197-B2-006-5'-PEG
136 L-РНК (ШПИГЕЛЬМЕР) 5'-40 kDa-PEG-CGCCGGGGUUAGGGCUAGAAGUCGGCCGGCG 197-B2-006-31b-5'PEG
137 L-РНК (ШПИГЕЛЬМЕР) 5'-40 kDa-PEG-
GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC
192-A10-001-5'-PEG
192-A10-001-5'-PEG40
138 L-РНК (ШПИГЕЛЬМЕР) UAAGGAAACUCGGUCUGAUGCGGUAGCGCUGUGCAGAGCU Контрольный шпигельмер
139 L-РНК (ШПИГЕЛЬМЕР) 5'-30 kDa-PEG-
GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC
192-A10-001-5'-PEG30
140 L-РНК (ШПИГЕЛЬМЕР) 5'-100 kDa-HES-
GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC
192-A10-001-5'-HES100
141 L-РНК (ШПИГЕЛЬМЕР) 5'-130 kDa-HES-
GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC
192-A10-001-5'-HES130
142 L-РНК (ШПИГЕЛЬМЕР) CGUGGUCCGUUGUGUCAGGUCUAUUCGCCCCGGUGCAGGGCAUCCGCG 194-A2-001
143 L-РНК (ШПИГЕЛЬМЕР) GCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAGGUGAG 196-B12-003
144 L-РНК (ШПИГЕЛЬМЕР) CAACAGCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAG 196-B12-004
Таблица 1 (J)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
145 D-РНК (АПТАМЕР) GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC 192-A10-001
146 D-РНК (АПТАМЕР) GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-G10
147 D-РНК (АПТАМЕР) GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCGCAGC 192-F10
148 D-РНК (АПТАМЕР) GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCACAGC 192-B11
149 D-РНК (АПТАМЕР) GCUGUAAAAGUAACAUGUCAAUGAAAGGUAACUACAGC 192-C9
150 D-РНК (АПТАМЕР) GCUGUAAAAGUAACAAGUCAAUGAAAGGUAACUACAGC 192-E10
151 D-РНК (АПТАМЕР) GCUGUGAAAGUAACAAGUCAAUGAAAGGUAACCACAGC 192-C10
152 D-РНК (АПТАМЕР) GCAGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-D11
153 D-РНК (АПТАМЕР) GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACUGC 192-G11
154 D-РНК (АПТАМЕР) GCUAUGAAAGUAACAUGUCAAUGAAAGGUAACCAUAGC 192-H11
155 D-РНК (АПТАМЕР) GCUGCGAAAGCGACAUGUCAAUGAAAGGUAGCCGCAGC 192-D10
156 D-РНК (АПТАМЕР) GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCACAGC 192-E9
157 D-РНК (АПТАМЕР) GCUGUGAAAGUAACAUGUCAAUGAAAGGUAGCCGCAGC 192-H9
158 D-РНК (АПТАМЕР) AGCGUGAAAGUAACACGUAAAAUGAAAGGUAACCACGCU 191-A6
159 D-РНК (АПТАМЕР) CUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAG 192-A10-002
160 D-РНК (АПТАМЕР) UGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCA 192-A10-003
Таблица 1 (K)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
161 D-РНК (АПТАМЕР) GUGAAAGCAACAUGUCAAUGAAAGGUAGCCGC 192-A10-004
162 D-РНК (АПТАМЕР) UGAAAGCAACAUGUCAAUGAAAGGUAGCCG 192-A10-005
163 D-РНК (АПТАМЕР) GAAAGCAACAUGUCAAUGAAAGGUAGCC 192-A10-006
164 D-РНК (АПТАМЕР) AAAGCAACAUGUCAAUGAAAGGUAGC 192-A10-007
165 D-РНК (АПТАМЕР) GCGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-008
166 D-РНК (АПТАМЕР) GCGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-015
167 D-РНК (АПТАМЕР) GCGGAAAGCAACAUGUCAAUGAAAGGUAGCCCGC 192-A10-014
168 D-РНК (АПТАМЕР) CGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCG 192-A10-016
169 D-РНК (АПТАМЕР) GCGCAAAGCAACAUGUCAAUGAAAGGUAGCGUGC 192-A10-017
170 D-РНК (АПТАМЕР) GUGCAAAGCAACAUGUCAAUGAAAGGUAGCGCGC 192-A10-018
171 D-РНК (АПТАМЕР) CGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGUG 192-A10-019
172 D-РНК (АПТАМЕР) GGGCAAAGCAACAUGUCAAUGAAAGGUAGCGCCC 192-A10-020
173 D-РНК (АПТАМЕР) GGCCAAAGCAACAUGUCAAUGAAAGGUAGCGGCC 192-A10-021
174 D-РНК (АПТАМЕР) GCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGC 192-A10-022
175 D-РНК (АПТАМЕР) CCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGG 192-A10-023
176 D-РНК (АПТАМЕР) AGCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGCU 193-C2-001
Таблица 1 (L)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
177 D-РНК (АПТАМЕР) AGCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGCU 193-G2-001
178 D-РНК (АПТАМЕР) AGCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGUGCGCU 193-F2-001
179 D-РНК (АПТАМЕР) GCGAGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-G1-002
180 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-D2-002
181 D-РНК (АПТАМЕР) GCAUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCCC 193-A1-002
182 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGGACGC 193-D3-002
183 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAGAGGCUGAUCCUAGUCAGGUACGC 193-B3-002
184 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAAAGGCUGAUCCUAGUCAGGUACGC 193-H3-002
185 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGUUCCUAGUCAGGUAUGC 193-E3-002
186 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUUAGGUACGC 193-D1-002
187 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGC 193-C2-002
188 D-РНК (АПТАМЕР) CGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACG 193-C2-003
189 D-РНК (АПТАМЕР) GUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUAC 193-C2-004
190 D-РНК (АПТАМЕР) UGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUA 193-C2-005
191 D-РНК (АПТАМЕР) GGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGU 193-C2-006
Таблица 1 (M)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
192 D-РНК (АПТАМЕР) GUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGG 193-C2-007
193 D-РНК (АПТАМЕР) GCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGC 193-G2-012
194 D-РНК (АПТАМЕР) GCGCGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGCGCGC 193-G2-013
195 D-РНК (АПТАМЕР) GCGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCGC 193-G2-014
196 D-РНК (АПТАМЕР) GGGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCCC 193-G2-015
197 D-РНК (АПТАМЕР) GGCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGCC 193-G2-016
198 D-РНК (АПТАМЕР) GCCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGGC 193-G2-017
199 D-РНК (АПТАМЕР) GUGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCAC 197-B2
200 D-РНК (АПТАМЕР) AGCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGCU 191-D5-001
201 D-РНК (АПТАМЕР) GUGUUGCGGAGGUUAGGGCUAGAAGUCGGUCAGCAGCAC 197-H1
202 D-РНК (АПТАМЕР) CGUGCGCUUGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCACG 190-A3-001
203 D-РНК (АПТАМЕР) AGCGUGAAGGGGUUAGGGCUCGAAGUCGGCUGACACGCU 191-A5
204 D-РНК (АПТАМЕР) GUGCUGCGGGGGUUAGGGCUCGAAGUCGGCCCGCAGCAC 197-H3
205 D-РНК (АПТАМЕР) GUGUUCCCGGGGUUAGGGCUUGAAGUCGGCCGGCAGCAC 197-B1
Таблица 1 (N)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
206 D-РНК (АПТАМЕР) GUGUUGCAGGGGUUAGGGCUUGAAGUCGGCCUGCAGCAC 197-E3
207 D-РНК (АПТАМЕР) GUGCUGCGGGGGUUAGGGCUCAAAGUCGGCCUGCAGCAC 197-H2
208 D-РНК (АПТАМЕР) GUGCUGCCGGGGUUAGGGCUAA-AGUCGGCCGACAGCAC 197-D1
209 D-РНК (АПТАМЕР) GUGCUGUGGGGGUCAGGGCUAGAAGUCGGCCUGCAGCAC 197-D2
210 D-РНК (АПТАМЕР) UGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCA 190-A3-003
211 D-РНК (АПТАМЕР) GAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUC 190-A3-004
212 D-РНК (АПТАМЕР) GGGGUUAGGGCUUAAAGUCGGCUGAUUCU 190-A3-007
213 D-РНК (АПТАМЕР) GCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGC 191-D5-002
214 D-РНК (АПТАМЕР) CGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACG 191-D5-003
215 D-РНК (АПТАМЕР) CGGGCGAGGUUAGGGCUAGAAGUCGGUCGACCG 191-D5-004
216 D-РНК (АПТАМЕР) CGGGCGAGGUUAGGGCUAGAAGUCGGUCGCCCG 191-D5-005
217 D-РНК (АПТАМЕР) CGGCGAGGUUAGGGCUAGAAGUCGGUCGCCG 191-D5-006
218 D-РНК (АПТАМЕР) CGGGAGGUUAGGGCUAGAAGUCGGUCCCG 191-D5-007
219 D-РНК (АПТАМЕР) GGGAGGUUAGGGCUAGAAGUCGGUCCC 191-D5-010
220 D-РНК (АПТАМЕР) CCGCGGUUAGGGCUAGAAGUCGGGCGG 191-D5-017
221 D-РНК (АПТАМЕР) CCCGGGUUAGGGCUAGAAGUCGGCGGG 191-D5-029
222 D-РНК (АПТАМЕР) GGCGGGUUAGGGCUAGAAGUCGGCGCC 191-D5-024
223 D-РНК (АПТАМЕР) CCCGCGGUUAGGGCUAGAAGUCGGGCGGG 191-D5-017-29a
Таблица 1 (О)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
224 D-РНК (АПТАМЕР) GCCGCGGUUAGGGCUAGAAGUCGGGCGGC 191-D5-017-29b
225 D-РНК (АПТАМЕР) CCCCGGGUUAGGGCUAGAAGUCGGCGGGG 191-D5-019-29a
226 D-РНК (АПТАМЕР) CGGCGGGUUAGGGCUAGAAGUCGGCGCCG 191-D5-024-29a
227 D-РНК (АПТАМЕР) GGGCGGGUUAGGGCUAGAAGUCGGCGCCC 191-D5-024-29b
228 D-РНК (АПТАМЕР) UGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCA 197-B2-001
229 D-РНК (АПТАМЕР) GCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGC 197-B2-002
230 D-РНК (АПТАМЕР) CUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAG 197-B2-003
231 D-РНК (АПТАМЕР) UGCGGGGGUUAGGGCUAGAAGUCGGCCUGCA 197-B2-004
232 D-РНК (АПТАМЕР) GCGGGGGUUAGGGCUAGAAGUCGGCCUGC 197-B2-005
233 D-РНК (АПТАМЕР) GCCGGGGUUAGGGCUAGAAGUCGGCCGGC 197-B2-006
234 D-РНК (АПТАМЕР) GGCCGGGGUUAGGGCUAGAAGUCGGCCGGCC 197-B2-006-31a
235 D-РНК (АПТАМЕР) CGCCGGGGUUAGGGCUAGAAGUCGGCCGGCG 197-B2-006-31b
236 D-РНК (АПТАМЕР) CGUGGUCCGUUGUGUCAGGUCUAUUCGCCCCGGUGCAGGGCAUCCGCG 194-A2-001
237 D-РНК (АПТАМЕР) GCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAGGUGAG 196-B12-003
238 D-РНК (АПТАМЕР) CAACAGCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAG 196-B12-004
Таблица 1 (Р)
SEQ ID РНК/пептид Последовательность Внутренний справочный номер
239 L-РНК (ШПИГЕЛЬМЕР) 5'-PEG-
UAAGGAAACUCGGUCUGAUGCGGUAGCGCUGUGCAGAGCU
PEG-модифицированный контрольный шпигельмер
240 L-РНК (ШПИГЕЛЬМЕР) GATCACACCACGC-(C18-PEG-спейсер)-(C18-PEG-спейсер)-1-NH2-3' 193-G2-012-5'-PEG улавливающий зонд
241 L-РНК (ШПИГЕЛЬМЕР) 5'-NH2-(C18-PEG-спейсер)-(C18-PEG-спейсер)-GCGUACCUGAC 193-G2-012-5'-PEG детектирующий зонд

Настоящее изобретение далее проиллюстрировано чертежами, примерами и списком последовательностей, которые дают дальнейшее представление об отличительных признаках, вариантах осуществления и преимуществах настоящего изобретения.

На фиг.1 показан сравнительный анализ последовательностей родственных РНК-лигандов, связывающихся с SDF-1 человека, с указанием фрагмента последовательности (“тип А”), который в предпочтительном варианте осуществления изобретения полностью необходим для связывания с SDF-1 человека.

На фиг.2А показаны производные РНК-лиганда 192-А10-001 (РНК-лиганд фрагмента последовательности “типа А” SDF-1 человека).

На фиг.2В показаны производные РНК-лиганда 192-А10-001 (РНК-лиганд фрагмента последовательности “типа А” SDF-1 человека).

На фиг.3 показан сравнительный анализ последовательностей родственных РНК-лигандов, связывающихся с SDF-1 человека, с указанием фрагмента последовательности (“тип В”), который в предпочтительном варианте осуществления изобретения полностью необходим для связывания с SDF-1 человека.

На фиг.4А показаны производные РНК-лигандов 193-С2-001 и 193-G2-001 (РНК-лиганды фрагмента последовательности “типа В” SDF-1 человека).

На фиг.4В показаны производные РНК-лигандов 193-С2-001 и 193-G2-001 (РНК-лиганды фрагмента последовательности “типа В” SDF-1 человека).

На фиг.5 показан сравнительный анализ последовательностей родственных РНК-лигандов, связывающихся с SDF-1 человека, с указанием фрагмента последовательности (“тип С”), который в предпочтительном варианте осуществления изобретения полностью необходим для связывания с SDF-1 человека.

На фиг.6 показаны производные РНК-лиганда 190-А3-001 (РНК-лиганд фрагмента последовательности “типа С” SDF-1 человека).

На фиг.7А показаны производные РНК-лиганда 190-D5-001 (РНК-лиганд фрагмента последовательности “типа С” SDF-1 человека).

На фиг.7В показаны производные РНК-лиганда 190-D5-001 (РНК-лиганд фрагмента последовательности “типа С” SDF-1 человека).

На фиг.8 показаны производные РНК-лиганда 197-В2 (РНК-лиганд фрагмента последовательности “типа С” SDF-1 человека).

На фиг.9 показаны другие РНК-лиганды, связывающиеся с SDF-1 человека.

на фиг.10 показан индуцированный SDF-1 человека хемотаксис клеток Джурката Т-клеточного лейкоза человека, при котором после 3-часовой миграции клеток Джурката Т-клеточного лейкоза человека в направлении разных концентраций SDF-1 человека была получена кривая дозовой зависимости для SDF-1, представленная в виде флуоресцентного сигнала в зависимости от концентрации SDF-1 человека.

На фиг.11 показан результат анализа связывания аптамера 192-А10-001, связывающего SDF-1 человека, с биотинилированным D-SDF-1 человека при 37°С, представленный в виде связывания аптамера в зависимости от концентрации биотинилированного D-SDF-1 человека.

На фиг.12 показана эффективность шпигельмера 192-А10-001, связывающего SDF-1 человека, при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно инкубированного при 37°С с разными количествами шпигельмера 192-А10-001; результат представлен в виде процентного значения эффективности контрольного образца в зависимости от концентрации шпигельмера 192-А10-001.

На фиг.13 показан результат анализа конкурентного связывания аптамеров 192-А10-001, 192-F10-001, 192-C9-001, 192-E10-001, 192-C10-001, 192-D11-001, 192-G11-001, 192-H11-001, 192-D10-001, 192-E9-001 и 192-Н9-001, связывающих SDF-1 человека, с биотинилированным D-SDF-1 человека при 37°С, представленный в виде связывания меченого аптамера 192-А10-001 (использованного в качестве эталона, вытесняемого немеченными аптамерами) при использовании 1 нМ и 5 нМ немеченных аптамеров 192-А10-001, 192-F10-001, 192-C9-001, 192-E10-001, 192-C10-001, 192-D11-001, 192-G11-001, 192-H11-001, 192-D10-001, 192-E9-001 и 192-Н9-001.

На фиг.14 показан результат анализа связывания аптамера 192-А10-008, связывающего SDF-1 человека, с биотинилированным D-SDF-1 человека при 37°С, представленный в виде связывания аптамера в зависимости от концентрации биотинилированного D-SDF-1 человека.

На фиг.15 изображена сенсорграмма, полученная при помощи Biacore 2000, на которой показано значение KD шпигельмера 192-А10-008, связывающего SDF-1 человека, при связывании с SDF-1 человека, иммобилизованным на сенсорном чипе PioneerF1 методом связывания амином; результат представлен в виде реакции (RU) в зависимости от времени, при этом дополнительно указаны значения увеличения и снижения интенсивности, а также значения KD шпигельмеров 192-А10-008 и 192-А10-001.

На фиг.16 показана эффективность SDF-1-связывающего шпигельмера 192-А10-008 при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно инкубированного при 37°С с разными количествами шпигельмера 192-А10-008; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации шпигельмера 192-А10-008.

На фиг.17 изображена сенсорграмма, полученная при помощи Biacore 2000, на которой показано значение KD шпигельмера 193-G2-01, связывающегося с SDF-1 человека, иммобилизованным на сенсорном чипе PioneerF1 методом связывания амином; результат представлен в виде реакции (RU) в зависимости от времени, при этом дополнительно указаны значения скоростей увеличения и снижения интенсивности, а также значение KD шпигельмера 193-G2-001.

На фиг.18 показан результат анализа связывания аптамера 193-G2-012 против SDF-1 человека с биотинилированным D-SDF-1 человека при 37°С, представленный в виде связывания аптамера в зависимости от концентрации биотинилированного D-SDF-1 человека.

На фиг.19 показан результат анализа конкурентного связывания аптамеров 190-А3-001, 190-А3-003, 190-А3-004, 190-А3-007, 191-D5-001, 191-D5-002, 191-D5-003, 191-D5-004, 191-D5-005, 191-D5-006 и 191-D5-007, связывающих SDF-1 человека, с биотинилированным D-SDF-1 человека при 37°С, представленный в виде связывания меченого аптамера 190-А3-001 или 191-D5-001 (использованного в качестве эталона, вытесняемого немеченными аптамерами) при использовании 500 нМ, 50 нМ и 10 нМ немеченных аптамеров 190-А3-001, 190-А3-003, 190-А3-004, 190-А3-007, 191-D5-001, 191-D5-002, 191-D5-003, 191-D5-004, 191-D5-005, 191-D5-006 и 191-D5-007.

На фиг.20 показан результат анализа связывания аптамеров 190-А3-004 и 191-D5-007, связывающих SDF-1 человека, с биотинилированным D-SDF-1 человека при 37°С, представленный в виде связывания аптамера в зависимости от концентрации биотинилированного D-SDF-1 человека.

На фиг.21 изображена сенсорграмма, полученная при помощи Biacore 2000, на которой показано значение KD шпигельмера 191-D5-007, связывающегося с SDF-1 человека, который был иммобилизован на сенсорном чипе PioneerF1 методом связывания амином; результат представлен в виде реакции (RU) в зависимости от времени, при этом дополнительно указаны значения скоростей увеличения и снижения интенсивности, а также значение KD шпигельмера 191-D5-007.

На фиг.22 показана эффективность SDF-1-связывающего шпигельмера 190-А3-004 при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно инкубированного при 37°С с разными количествами шпигельмера 190-А3-004; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации шпигельмера 190-А3-004.

На фиг.23А показана эффективность SDF-1-связывающих шпигельмеров 193-G2-012-5'-PEG, 197-B2-006-5'-PEG, 191-D5-007-5'-PEG и 191-А10-008-5'-PEG при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно инкубированного при 37°С с разными количествами шпигельмеров 193-G2-012-5'-PEG, 197-B2-006-5'-PEG, 191-D5-007-5'-PEG и 191-А10-008-5'-PEG; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации шпигельмеров 193-G2-012-5'-PEG, 197-B2-006-5'-PEG, 191-D5-007-5'-PEG и 191-А10-008-5'-PEG.

На фиг.23В показана эффективность SDF-1-связывающих шпигельмеров 197-В2-006-5'-PEG и 197-В2-006-31b-5'-PEG при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно инкубированного при 37°С с разными количествами шпигельмеров 197-В2-006-5'-PEG и 197-В2-006-31b-5'-PEG; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации шпигельмеров 197-В2-006-5'-PEG и 197-В2-006-31b-5'-PEG.

На фиг.24А изображена сенсорграмма, полученная при помощи Biacore 2000, на которой показаны значения KD шпигельмеров 193-G2-012-5'-PEG, 191-A10-008-5'-PEG и 191-А10-001-5'-PEG, связывающихся с SDF-1 человека, иммобилизованным на сенсорном чипе PioneerF1 методом связывания амином; результат представлен в виде реакции (RU) в зависимости от времени.

На фиг.24В изображена сенсорграмма, полученная при помощи Biacore 2000, на которой показаны значения KD шпигельмеров 197-B2-006-5'-PEG, 197-B2-006-31b-5'-PEG и 191-D5-007-5'-PEG, связывающихся с SDF-1 человека, иммобилизованным на сенсорном чипе PioneerF1 методом связывания амином; результат представлен в виде реакции (RU) в зависимости от времени.

На фиг.25А показана эффективность SDF-1-связывающих шпигельмеров 192-А10-001, 192-А10-001-5'-HES130 и 192-А10-001-5'-HES100 при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно инкубированного при 37°С с разными количествами шпигельмеров 192-А10-001, 192-А10-001-5'-HES130 и 192-А10-001-5'-HES100; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации шпигельмеров 192-А10-001, 192-А10-001-5'-HES130 и 192-А10-001-5'-HES100.

На фиг.25В показана эффективность SDF-1-связывающих шпигельмеров 192-А10-001, 192-А10-001-5'-PEG30 и 192-А10-001-5'-PEG40 при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно инкубированного при 37°С с разными количествами шпигельмеров 192-А10-001, 192-А10-001-5'-PEG30 и 192-А10-001-5'-PEG40; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации шпигельмеров 192-А10-001, 192-А10-001-5'-PEG30 и 192-А10-001-5'-PEG40.

На фиг.26 показана неэффективность контрольного шпигельмера при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 человека или мыши, предварительно инкубированного при 37°С с разными количествами контрольного шпигельмера; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации контрольного шпигельмера.

На фиг.27 показан индуцированный SDF-1 мыши хемотаксис клеток Джурката Т-клеточного лейкоза человека, при котором после 3-часовой миграции клеток Джурката Т-клеточного лейкоза человека в направлении разных концентраций SDF-1 была получена кривая дозовой зависимости для SDF-1, представленная в виде флуоресцентного сигнала.

На фиг.28 показана эффективность SDF-1-связывающих шпигельмеров 192-А10-001 и 191-D5-007-5'-PEG при выполнении анализа хемотаксиса; клетки оставляли мигрировать в направлении 0,3 нМ SDF-1 мыши, предварительно инкубированного при 37°С с разными количествами шпигельмеров 192-А10-001 и 191-D5-007-5'-PEG; результат представлен в виде процентного значения контрольного образца в зависимости от концентрации шпигельмеров 192-А10-001 и 191-D5-007-5'-PEG.

На фиг.29 показана эффективность SDF-1-связывающего шпигельмера 192-А10-001 при выполнении анализа связывания рецептора CXCR4 с использованием [125I]-SDF-1α человека, который предварительно инкубировали при 37°С с разными количествами шпигельмеров 192-А10-001; график специфически связанного [125J]-SDF-1α был построен в зависимости от концентрации шпигельмера 192-А10-001.

На фиг.30 показано ингибирование стимуляции МАР-киназой CXCR4-экспрессирующих клеток с 1 нМ SDF-1α человека шпигельмером 192-А10-001, связывающим SDF-1 человека.

На фиг.31 показано ингибирование SDF-1-индуцированного разрастания кольца аорты SDF-1-связывающим шпигельмером 193-G2-012-5'-PEG и PEG-модифицированным контрольным шпигельмером при выполнения анализа разрастания кольца аорты, в соответствии с которым кольца, полученные из аорты крысы, погружали в коллагеновую матрицу и инкубировали в течение 6 дней с SDF-1 в присутствии или отсутствии шпигельмеров (а: контрольный образец; b: 10 нМ SDF-1; с: 10 нМ SDF-1 + 1 мкМ шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека; d: 10 нМ SDF-1 + 1 мкМ PEG-модифицированного контрольного шпигельмера).

На фиг.32 показано ингибирование SDF-1-индуцированного разрастания кольца аорты SDF-1-связывающим шпигельмером 193-G2-012-5'-PEG и PEG-модифицированным контрольным шпигельмером при выполнении анализа разрастания кольца аорты, в соответствии с которым индексы разрастания указаны в виде среднего значения ± стандартное отклонение для 5 колец в одном испытании (*: значение, полученное для SDF-1, значительно отличается от контрольного образца (испытание Манна-Витнея; р = 0,009); **: значение, полученное для SDF-1 + шпигельмер 193-G2-012-5'-PEG, связывающий SDF-1 человека, значительно отличается от значения, полученного для SDF-1 (испытание Манна-Витнея; р = 0,028).

На фиг.33 показан уровень шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, и SDF-1 в плазме крыс после внутривенной инъекции ударной дозы шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, по сравнению с уровнем SDF-1 в плазме крысы, которой не вводили шпигельмер 193-G2-012-5'-PEG, связывающий SDF-1 человека; уровень шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, и SDF-1 в плазме определяли в течение 96 часов.

Пример 1. Нуклеиновые кислоты, связывающие SDF-1 человека

Используя биотинилированный D-SDF-1 человека в качестве мишени, можно получить несколько нуклеиновых кислот, связывающихся с SDF-1 человека, нуклеотидные последовательности которых показаны на фигурах 1-9. Нуклеиновые кислоты исследовали на уровне аптамера, то есть D-нуклеиновой кислоты, с использованием биотинилированного D-SDF-1 человека, или на уровне шпигельмера, то есть L-нуклеиновой кислоты, с использованием природной конфигурации SDF-1 (L-SDF-1).

Аптамеры анализировали, используя биотинилированный D-SDF-1 человека, при помощи анализов ослабления конкурентного или прямого связывания с биотинилированным D-SDF-1 человека (пример 4). Шпигельмеры исследовали, используя природную конфигурацию SDF-1 (L-SDF-1), путем измерения резонанса поверхностного плазмона в приборе Biacore 2000 (пример 6) и при помощи анализа хемотаксиса in vitro в культуре клеток (пример 5).

Полученные таким образом молекулы нуклеиновой кислоты содержат разные фрагменты последовательностей, три основных типа которых показаны на фиг.1, 2А и 2В (тип А), фиг.3, 4А и 4В (тип В), фиг.5, 6, 7А, 7В и 8 (тип С). Для обозначения фрагментов нуклеиновых кислот были использованы аббревиатуры IUPAC для неопределенных нуклеотидов.

S сильный G или С
W слабый А или U
R пурин G или А
Y пиримидин С или U
K кето G или U
М имино А или С
В не А С или U или G
D не С А или G или U
Н не G А или С или U
V не U А или С или G
N все А или G или С или U

За исключением особо оговоренных случаев любая последовательность нуклеиновой кислоты или последовательность фрагментов и блоков указана в направлении 5'→3'.

1.1 SDF-1-связывающие нуклеиновые кислоты типа А

Как показано на фиг.1, все последовательности SDF-1-связывающих нуклеиновых кислот типа А включают одну центральную нуклеотидную последовательность, фланкированную 5'- и 3'-концевыми фрагментами, которые могут гибридизировать друг с другом. Однако такая гибридизация не обязательно происходит в молекуле.

Нуклеиновые кислоты исследовали на уровне аптамера при помощи анализов ослабления прямого и конкурентного связывания с биотинилированным D-SDF-1 человека для распределения их по рангу в соответствии с характеристиками связывания (пример 4). Выбранные последовательности синтезировали в виде шпигельмеров (пример 3) и испытывали, используя природную конфигурацию SDF-1 (L-SDF), при помощи анализа хемотаксиса in vitro в культуре клеток (пример 5) и путем измерения резонанса поверхностного плазмона в приборе Biacore 2000 (пример 6).

Последовательности определенных блоков или фрагментов могут отличаться в SDF-1-связывающих нуклеиновых кислотах типа А, что влияет на сродство связывания с SDF-1. На основании анализа связывания разных SDF-1-связывающих нуклеиновых кислот, представленных в виде SDF-1-связывающих нуклеиновых кислот типа А, установлено, что центральная нуклеотидная последовательность и ее нуклеотидные последовательности, рассмотренные ниже, в отдельности и более предпочтительно полностью необходимы для связывания с SDF-1.

Центральная нуклеотидная последовательность всех идентифицированных последовательностей SDF-1-связывающих нуклеиновых кислот типа А имеет последовательность (формула-1 типа А), где ХА отсутствует или означает 'А'. Если 'А' отсутствует, последовательность центральной нуклеотидной последовательности может быть представлена в виде формулы-2 типа А (). На основании SDF-1-связывающей нуклеиновой кислоты 191-А6 типа А (центральная нуклеотидная последовательность ), содержащей дополнительный нуклеотид 'A' в центральной нуклеотидной последовательности и связывающейся с SDF-1, можно вывести альтернативную центральную нуклеотидную последовательность (, формула-3 типа А). Как и все другие нуклеиновые кислоты SDF-1-связывающих нуклеиновых кислот типа А, SDF-1-связывающая нуклеиновая кислота типа А 192-А10-001 характеризовалась сродством связывания с SDF-1 человека. Константа равновесного связывания KD была определена при помощи анализа ослабления связывания (KD = 1,5 нМ, фиг.11) и измерения резонанса поверхностного плазмона (KD = 1,0 нМ, фиг.15). Значение IC50 (50% ингибирующая концентрация), равное 0,12 нМ, было получено для 192-А10-001 при помощи анализа хемотаксиса in vitro в культуре клеток (фиг.12). Все SDF-1-связывающие нуклеиновые кислоты типа А, показанные на фиг.1, анализировали при помощи анализа ослабления конкурентного связывания по сравнению с 192-А10-001 (фиг.13; на фиг.13 показаны не все испытанные SDF-1-связывающие нуклеиновые кислоты типа А). SDF-1-связывающие нуклеиновые кислоты типа А 192-В11 и 192-С10 характеризовались таким же сродством связывания, что и 192-А10-001, при выполнении указанных анализов конкурентного связывания. Более слабое сродство связывания было определено для SDF-1-связывающих нуклеиновых кислот типа А 192-G10, 192-F10, 192-C9, 192-E10, 192-D11, 192-G11, 192-H11 и 191-А6. SDF-1-связывающие нуклеиновые кислоты типа А 192-D10, 192-E9 и 192-Н9 характеризуются гораздо более слабым сродством связывания, чем 192-А10-001 (фиг.13).

Как было указано выше, SDF-1-связывающие нуклеиновые кислоты типа А 192-В11 и 192-С10 обладают таким же сродством связывания с SDF-1, что и 192-А10-001. Однако указанные нуклеиновые кислоты характеризуются небольшими отличиями центральной нуклеотидной последовательности. Поэтому консенсусная последовательность трех молекул, связывающихся с SDF-1 почти с одинаковым высоким сродством, может быть представлена нуклеотидной последовательностью AAAGYAACAHGUCAAUGAAAGGUARC (формула-4 типа А), при этом центральная нуклеотидная последовательность 192-А10-001 (нуклеотидная последовательность: AAAGCAACAUGUCAAUGAAAGGUAGC) является нуклеотидной последовательностью с лучшим сродством связывания SDF-1-связывающих нуклеиновых кислот типа А.

Пять или шесть из шести нуклеотидов 5'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа А могут гибридизировать с соответствующими пятью или шестью нуклеотидами из шести нуклеотидов 3'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа А с образованием концевой спирали. Хотя указанные нуклеотиды являются изменчивыми в нескольких положениях, другие нуклеотиды делают возможной гибридизацию пяти или шести из шести нуклеотидов 5'- и 3'-концевых фрагментов. 5'-Концевые и 3'-концевые фрагменты SDF-1-связывающих нуклеиновых кислот типа А, показанные на фиг.1, могут иметь общую формулу для 5'-концевого фрагмента ('RSHRYR', формула-5-5' типа А) и 3'-концевого фрагмента ('YRYDSY', формула-5-3' типа А). Усеченные производные SDF-1-связывающей нуклеиновой кислоты типа А 192-А10-001 анализировали при выполнении анализа ослабления конкурентного связывания по сравнению с исходной молекулой 192-А10-001 и 192-А10-008 (фиг.2А и 2В). Выполненные эксперименты показывают, что сокращение шести концевых нуклеотидов (5'-конец: GCUGUG; 3'-конец: CGCAGC) 192-А10-001 до пяти нуклеотидов (5'-конец: CUGUG; 3'-конец: CGCAG) производного 192-А10-002 может быть произведено без ослабления сродства связывания. Однако усечение до четырех концевых нуклеотидов (5'-конец: UGUG; 3'-конец: CGCA; 192-А10-003) или меньше (192-А10-004/-005/-006/-007) вызывает ослабление сродства связывания с SDF-1 (фиг.2А). Определенные 5'-концевые и 3'-концевые фрагменты длиной пять или четыре нуклеотида производных SDF-1-связывающей нуклеиновой кислоты типа А 192-А10-001, показанные на фиг.2А и В, могут иметь общую формулу для 5'-концевого фрагмента ('X2BBBS', формула-6-5' типа А) и 3'-концевого фрагмента ('SBBVX3'; формула-6-3' типа А), где Х2 отсутствует или означает 'S' и Х3 отсутствует или означает 'S'.

Нуклеотидная последовательность 5'- и 3'-концевых фрагментов влияет на сродство связывания SDF-1-связывающих нуклеиновых кислот типа А. Данное явление характерно не только для нуклеиновых кислот 192-F10 и 192-Е10, но и для производных 192-А10-001 (фиг.2В). Центральные нуклеотидные последовательности 192-F10 и 192-Е10 идентичны 192-В11 и 192-С10, но имеют незначительные отличия у 3'-конца 5'-концевого фрагмента и у 5'-конца 3'-концевого фрагмента, вызывающие ослабление сродства связывания.

Замена 5'- и 3'-концевых нуклеотидов 'CUGUG' и 'CGCAG' SDF-1-связывающей нуклеиновой кислоты типа А 192-А10-002 нуклеотидами 'GCGCG' и 'CGCGC' (192-А10-015) вызывает ослабление сродства связывания, в то время как замены нуклеотидами 'GCGUG' и 'CGCGC' (192-А10-008) характеризуются таким же сродством связывания, что и 192-А10-002 (фиг.2В, фиг.15, фиг.12, фиг.16). Кроме того, девять производных SDF-1-связывающей нуклеиновой кислоты типа А 192-А10-001 (192-А10-014/-015/-016/-017/-018/-019/-020/-021/-022/-023), содержащих соответственно четыре 5'-концевых и 3'-концевых нуклеотида, были испытаны в качестве аптамеров в отношении сродства связывания по сравнению с 192-А10-001 и его производным 192-А10-008 (оба характеризуются одинаковым сродством связывания с SDF-1). Все клоны демонстрировали более слабое, гораздо более слабое или намного гораздо более слабое сродство связывания с SDF-1 по сравнению с 192-А10-001 (шесть нуклеотидов, образующих концевую спираль) или 192-А10-008 с пятью концевыми нуклеотидами (фиг.2В). Следовательно, последовательность и число нуклеотидов 5'- и 3'-концевых фрагментов имеют важное значение для эффективного связывания с SDF-1. Как показано для SDF-1-связывающих нуклеиновых кислот типа А 192-А10-002 и 192-А10-08, предпочтительными комбинациями 5'- и 3'-концевых фрагментов являются 'CUGUG' и 'CGCAG' (5'- и 3'-концевые фрагменты SDF-1-связывающей нуклеиновой кислоты типа А 192-А10-002) и 'GCGUG' и 'CGCGC' (5'- и 3'-концевые фрагменты SDF-1-связывающей нуклеиновой кислоты типа А 192-А10-008).

Однако при объединении 5'- и 3'-концевых фрагментов всех испытанных SDF-1-связывающих нуклеиновых кислот типа А общая формула для 5'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа А представляет собой 'X1X2NNBV' (формула-7-5' типа А) и общая формула для 3'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа А представляет собой 'BNBNX3X4' (формула-7-3' типа А), где

Х1 означает 'R' или отсутствует, Х2 означает 'S', Х3 означает 'S', и Х4 означает 'Y' или отсутствует;

либо

Х1 отсутствует, Х2 означает 'S' или отсутствует, Х3 означает 'S' или отсутствует, и Х4 отсутствует.

1.2 SDF-1-связывающие нуклеиновые кислоты типа В

Как показано на фиг.3, все последовательности SDF-1-связывающих нуклеиновых кислот типа В включают одну центральную нуклеотидную последовательность, фланкированную 5'- и 3'-концевыми фрагментами, которые могут гибридизировать друг с другом. Однако такая гибридизация не обязательно происходит в молекуле.

Нуклеиновые кислоты исследовали на уровне аптамера при помощи анализов ослабления прямого и конкурентного связывания с биотинилированным D-SDF-1 человека для распределения их по рангу в соответствии с характеристиками связывания (пример 4). Выбранные последовательности синтезировали в виде шпигельмеров (пример 3) и испытывали, используя природную конфигурацию SDF-1 (L-SDF), при помощи анализа хемотаксиса in vitro в культуре клеток (пример 5) и путем измерении резонанса поверхностного плазмона в приборе Biacore 2000 (пример 6).

Последовательности определенных блоков или фрагментов могут отличаться в SDF-1-связывающих нуклеиновых кислотах типа В, что влияет на сродство связывания с SDF-1. На основании анализа связывания разных SDF-1-связывающих нуклеиновых кислот, представленных в виде SDF-1-связывающих нуклеиновых кислот типа В, установлено, что центральная нуклеотидная последовательность и ее нуклеотидные последовательности, рассмотренные ниже, в отдельности и более предпочтительно полностью необходимы для связывания с SDF-1.

Центральная нуклеотидная последовательность всех идентифицированных последовательностей SDF-1-связывающих нуклеиновых кислот типа В имеет последовательность GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG (формула-1 типа В). SDF-1-связывающие нуклеиновые кислоты типа В 193-G2-001, 193-C2-001 и 192-F2-001, которые отличаются в одном положении центральной нуклеотидной последовательности, анализировали при помощи анализа ослабления конкурентного связывания по сравнению с SDF-1-связывающей нуклеиновой кислотой типа А 192-А10-001 (значение KD = 1,5 нМ, определено при помощи анализа ослабления связывания [фиг.11], значение KD = 1,0 нМ, определено путем измерения резонанса поверхностного плазмона [фиг.15], значение IC50 = 0,12 нМ [фиг.12]). Все три испытанные SDF-1-связывающие нуклеиновые кислоты характеризовались более высоким связыванием с SDF-1 человека по сравнению с SDF-1-связывающей нуклеиновой кислотой типа А 192-А10-001, при этом сродство связывания 193-G2-001 соответствует аналогичному показателю 193-С2-001 и 193-F2-001 (фиг.3). Полученные данные позволяют предположить, что отличие центральной нуклеотидной последовательности SDF-1-связывающих нуклеиновых кислот типа В 193-G2-001, 193-C2-001 и 193-F2-001 не влияет на сродство связывания с SDF-1. SDF-1-Связывающую нуклеиновую кислоту типа В 193-G2-001 исследовали в отношении сродства связывания с SDF-1 человека. Константу равновесного связывания KD определяли при помощи анализа ослабления связывания (KD = 0,3 нМ) и путем измерения резонанса поверхностного плазмона (KD = 0,5 нМ, фиг.17). Значение IC50 (50% ингибирующая концентрация), равное 0,08 нМ, было измерено для 193-G2-001 при помощи анализа хемотаксиса in vitro в культуре клеток. В отличие от этого SDF-1-связывающие нуклеиновые кислоты типа В 193-В3-002, 193-Н3-002, 193-Е3-002 и 193-D1-002, имеющие разные центральные нуклеотидные последовательности, обладают худшими характеристиками связывания (фиг.3). Таким образом SDF-1-связывающие нуклеиновые кислоты типа В с лучшим сродством связывания с SDF-1 имеют центральную нуклеотидную последовательность GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG (формула-2 типа В).

Четыре, пять или шесть нуклеотидов из шести нуклеотидов 5'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа В могут гибридизировать с соответствующими четырьмя, пятью или шестью из шести нуклеотидов 3'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа В с образованием концевой спирали. Хотя указанные нуклеотиды являются изменчивыми в нескольких положениях, другие нуклеотиды делают возможной гибридизацию четырех, пяти или шести нуклеотидов из шести нуклеотидов 5'- и 3'-концевых фрагментов. 5'- и 3'-концевые фрагменты SDF-1-связывающих нуклеиновых кислот типа В, показанные на фиг.3, могут иметь общую формулу для 5'-концевого фрагмента (формула-3-5' типа В; 'X1GCRWG', где Х1 означает 'А' или отсутствует) и 3'-концевого фрагмента (формула-3-3' типа В; 'KRYSCX4', где Х4 означает 'U' или отсутствует). SDF-1-связывающие нуклеиновые кислоты типа В 193-G1-002, 193-D2-002, 193-A1-002 и 193-D3-002 обладают более слабым сродством связывания с SDF-1, хотя имеют одинаковую центральную нуклеотидную последовательность (формула-2 типа В) с 193-С2-001, 193-G2-001 и 193-F2-001 (фиг.3). Неблагоприятные характеристики связывания SDF-1-связывающих нуклеиновых кислот типа В 193-G1-002, 193-D2-002, 193-A1-002 и 193-D3-002 могут быть обусловлены числом нуклеотидов и последовательностью 5'- и 3'-концевых фрагментов.

Усеченные производные SDF-1-связывающих нуклеиновых кислот типа В 193-G2-001 и 193-С2-001 анализировали при помощи анализа ослабления конкурентного связывания по сравнению с 193-G2-001 и 193-G2-012 (фиг.4А и 4В). Указанные эксперименты показали, что сокращение шести концевых нуклеотидов (5'-конец: AGCGUG; 3'-конец: UACGCU) SDF-1-связывающих нуклеиновых кислот типа В 193-G2-001 и 193-С2-001 до пяти нуклеотидов (5'-конец: GCGUG; 3'-конец: UACGC) позволяет получить молекулы с одинаковым сродством связывания (193-С3-002 и 193-G2-012). Константу равновесной диссоциации KD определяли при помощи анализа ослабления связывания (KD = 0,3 нМ, фиг.18). Усечение до четырех (5'-конец: CGUG; 3'-конец: UACG; 193-C2-003) или менее нуклеотидов (193-С2-004, 193-С2-005, 193-С2-006, 193-С2-007) вызывало ослабление сродства связывания с SDF-1, которое измеряли при помощи анализа ослабления конкурентного связывания (фиг.4А). Нуклеотидная последовательность из пяти концевых нуклеотидов у 5'- и 3'-концов влияет на сродство связывания SDF-1-связывающих нуклеиновых кислот типа В. Замена 5'- и 3'-концевых нуклеотидов 'GCGUG' и 'UACGC' (193-С2-002, 193-G2-12) нуклеотидами 'GCGCG' и 'CGCGC' (193-G2-013) вызывали ослабление сродства связывания. Кроме того, были испытаны четыре разных производных SDF-1-связывающей нуклеиновой кислоты типа В 193-G2-001 с концевой спиралью, имеющей длину, равную четырем нуклеотидам, полученным в результате спаривания оснований (192-G2-014/-015/-016/-017). Все указанные производные характеризовались меньшим сродством связывания с SDF-1 (фиг.4В). Таким образом, последовательность и длина 5'- и 3'-концевых нуклеотидов имеет важное значение для эффективного связывания с SDF-1. 5'-Концевые и 3'-концевые фрагменты длиной пять и четыре нуклеотида производных SDF-1-связывающих нуклеиновых кислот типа В 193-С2-003 и 193-G2-012, показанные на фиг.4А и 4В, могут иметь общую формулу для 5'-концевого фрагмента ('X2SSBS', формула-4-5' типа В), где Х2 или отсутствует, или означает 'G', и 3'-концевого фрагмента ('BVSSX3', формула-4-3' типа В), где Х3 или отсутствует, или означает 'С'. Как показано для SDF-1-связывающих нуклеиновых кислот типа В 193-G2-001 и 193-С2-01 и их производных 193-G2-012 и 193-С2-002, предпочтительные комбинации 5'- и 3'-концевых фрагментов представляют собой 'X1GCGUG' (5'-концевой фрагмент; формула 5-5' типа В) и 'UACGCX4' (3'-концевой фрагмент; формула 5-3' типа В), где Х1 или означает 'А', или отсутствует и Х4 означает 'U' или отсутствует.

Однако при объединении 5'- и 3'-концевых фрагментов всех испытанных SDF-1-связывающих нуклеиновых кислот типа В общая формула для 5'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа В представляет собой 'X1X2SVNS' (формула-6-5' типа В) и общая формула для 3'-концевого фрагмента SDF-1-связывающих нуклеиновых кислот типа В представляет собой 'BVBSX3X4' (формула-6-3' типа В), где

Х1 означает 'А' или отсутствует, Х2 означает 'G', Х3 означает 'С', и Х4 означает 'U' или отсутствует;

либо Х1 отсутствует, Х2 означает 'G' или отсутствует, Х3 означает 'С' или отсутствует, и Х4 отсутствует.

1.3 SDF-1-Связывающие нуклеиновые кислоты типа С

Как показано на фиг.5, все последовательности SDF-1-связывающих нуклеиновых кислот типа С включают одну центральную нуклеотидную последовательность, фланкированную 5'- и 3'-концевыми фрагментами, которые могут гибридизировать друг с другом. Однако такая гибридизация не обязательно происходит в молекуле.

Нуклеиновые кислоты исследовали на уровне аптамера при помощи анализов ослабления прямого и конкурентного связывания с биотинилированным D-SDF-1 человека для распределения их по рангу в соответствии с характеристиками связывания (пример 4). Выбранные последовательности синтезировали в виде шпигельмеров (пример 3) и испытывали, используя природную конфигурацию SDF-1 (L-SDF), при помощи анализа хемотаксиса in vitro в культуре клеток (пример 5) и путем измерения резонанса поверхностного плазмона в приборе Biacore 2000 (пример 6).

Последовательности определенных блоков или фрагментов могут отличаться в SDF-1-связывающих нуклеиновых кислотах типа С, что влияет на сродство связывания с SDF-1. На основании анализа связывания разных SDF-1-связывающих нуклеиновых кислот, представленных в виде SDF-1-связывающих нуклеиновых кислот типа С, установлено, что центральная нуклеотидная последовательность и ее нуклеотидные последовательности, рассмотренные ниже, в отдельности и более предпочтительно полностью необходимы для связывания с SDF-1.

Центральная нуклеотидная последовательность всех идентифицированных последовательностей SDF-1-связывающих нуклеиновых кислот типа С имеет последовательность (формула-1 типа С), где ХА отсутствует или означает 'А'. За исключением SDF-1-связывающей нуклеиновой кислоты типа С 197-D1 центральная нуклеотидная последовательность всех идентифицированных последовательностей SDF-1-связывающих нуклеиновых кислот типа С имеет нуклеотидную последовательность (формула-2 типа С). SDF-1-связывающая нуклеиновая кислота типа С 197-D1 (центральная нуклеотидная последовательность: ), в которой отсутствует один нуклеотид 'A' в центральной нуклеотидной последовательности и которая все же связывается с SDF-1, позволяет сделать вывод о возможности существования альтернативной центральной нуклеотидной последовательности (, формула-3 типа С). Все SDF-1-связывающие нуклеиновые кислоты типа С, показанные на фиг.5, сначала исследовали при помощи анализа ослабления конкурентного связывания по сравнению с SDF-1-связывающей нуклеиновой кислотой типа А 192-А10-001 (значение KD = 1,5 нМ, определено при помощи анализа ослабления связывания и путем измерений резонанса поверхностного плазмона; IC50 = 0,12 нМ). SDF-1-связывающие нуклеиновые кислоты типа С 191-D5-001, 197-B2, 190-A3-001, 197-H1, 197-H3 и 197-Е3 демонстрировали более слабое сродство связывания, чем 192-А10-001 при выполнении анализов конкурентного связывания. Гораздо меньшее сродство связывания было установлено для 191-А5, 197-В1, 197-D1, 197-Н2 и 197-D2 (фиг.5). Указанные молекулы и их производные далее исследовали при помощи других анализов ослабления конкурентного связывания, измерений резонанса плазмона и анализа хемотаксиса in vitro. SDF-1-связывающую нуклеиновую кислоту типа С 191-D5-001 исследовали в отношении сродства связывания с SDF-1 человека, при этом константу равновесного связывания KD определяли путем измерения резонанса поверхностного плазмона (KD = 0,8 нМ, фиг.21). Значение IC50 (50% ингибирующая концентрация), равное 0,2 нМ, было измерено для 191-D5-001 при помощи анализа хемотаксиса in vitro в культуре клеток. Сродство связывания SDF-1-связывающей нуклеиновой кислоты типа С 197-В2 для SDF-1 человека определяли путем измерения резонанса поверхностного плазмона (KD = 0,9 нМ), значение IC50 (50% ингибирующая концентрация), равное 0,2 нМ, определяли при помощи анализа хемотаксиса in vitro в культуре клеток. Полученные данные показывают, что SDF-1-связывающие нуклеиновые кислоты типа С 191-D5-001 и 197-В2 обладают одинаковым сродством связывания с SDF-1 (фиг.5 и 8).

SDF-1-Связывающая нуклеиновая кислота типа С 190-А3-001 (48 нуклеотидов) содержит 5'-концевой фрагмент из 17 нуклеотидов и 3'-концевой фрагмент из 12 нуклеотидов, при этом четыре нуклеотида у 5'-конца 5'-концевого фрагмента и четыре нуклеотида у 3'-конца 3'-концевого фрагмента могут гибридизировать друг с другом с образованием концевой спирали. Альтернативно нуклеотиды 'UGAGA' в 5'-концевом фрагменте могут гибридизировать с нуклеотидами 'UCUCA' в 3'-концевом фрагменте с образованием концевой спирали. Уменьшение 5'-концевого фрагмента до восьми нуклеотидов ('GAGAUAGG') и 3'-концевого фрагмента до девяти нуклеотидов ('CUGAUUCUC') молекулы 190-А3-001 (при этом шесть из восьми/девяти нуклеотидов 5'- и 3'-концевых фрагментов могут гибридизировать друг с другом) не влияет на сродство связывания с SDF-1 (190-А3-004; фиг.6 и фиг.19). Константу равновесного связывания KD 190-А3-004 определяли при помощи анализа ослабления связывания (KD = 4,6 нМ, фиг.20) и путем измерения резонанса поверхностного плазмона (KD = 4,7 нМ). Значение IC50 (50% ингибирующая концентрация), равное 0,1 нМ, было измерено для 190-А3-004 при помощи анализа хемотаксиса in vitro в культуре клеток (фиг.22). Однако усечение до двух нуклеотидов 5'-концевого фрагмента вызывает очень сильное ослабление сродства связывания (190-А3-007; фиг.6 и фиг.19).

SDF-1-связывающие нуклеиновые кислоты типа С 191-D5-001, 197-B2 и 197-Н1 (центральная нуклеотидная последовательность: GGUUAGGGCUAGAAGUCGG), 197-Н3/191-А5 (центральная нуклеотидная последовательность: ) и 197-Е3/197-В1 (центральная нуклеотидная последовательность:) имеют почти одинаковую центральную нуклеотидную последовательность (формула-4 типа С; нуклеотидная последовательность ). Нуклеиновые кислоты 191-D5-001, 197-B2 и 197-Н1 имеют разные 5'- и 3'-концевые фрагменты (197-Н3 и 197-Е3 имеют такие же 5'- и 3'-концевые фрагменты, что и 197-В2). Однако соответствующие десять (197-В2, 197-Е3, 197-Н3) или девять из десяти (191-D5-001, 197-Н1) нуклеотидов 5'-концевого фрагмента могут гибридизировать с соответствующими десятью (197-В2, 197-Е3, 197-Н3) или девятью из десяти (191-D5-001, 197-Н1) нуклеотидами 3'-концевого фрагмента (фиг.5). Таким образом, 5'-концевой фрагмент SDF-1-связывающих нуклеиновых кислот типа С 197-В2, 191-D5-001, 197-Н1, 197-Е3 и 197-Н3, указанных выше, и 191-А5, 197-В1, 197-Н2, 197-D1 и 197-D2 содержат общую нуклеотидную последовательность 'RKSBUSNVGR' (формула-5-5' типа С). 3'-Концевой фрагмент SDF-1-связывающих нуклеиновых кислот типа С 197-В2, 191-D5-001, 197-Н1, 197-Е3 и 197-Н3, описанных выше, и 191-А5, 197-В1, 197-Н2, 197-D1 и 197-D2 содержат общую нуклеотидную последовательность 'YYNRCASSMY' (формула-5-3' типа С), при этом предпочтительными являются 5'- и 3'-концевые фрагменты SDF-1-связывающих нуклеиновых кислот типа С 197-В2, 191-D5-001, 197-Н1, 197-Е3 и 197-Н3. Указанные предпочтительные 5'- и 3'-концевые фрагменты SDF-1-связывающих нуклеиновых кислот типа С 197-В2, 191-D5-001, 197-Н1, 197-Е3 и 197-Н3 могут быть представлены общей формулой 'RKSBUGSVGR' (формула-6-5' типа С; 5'-концевой фрагмент) и 'YCNRCASSMY' (формула-6-3'; 3'-концевой фрагмент).

Были созданы усеченные производные SDF-1-связывающей нуклеиновой кислоты типа С 191-D5-001, которые испытывали при помощи анализа ослабления конкурентного связывания по сравнению с исходной молекулой 191-D5-001 (фиг.7А, фиг.7В и фиг.19). Длину 5'- и 3'-концевых фрагментов укорачивали с десяти нуклеотидов (191-D5-001) до семи нуклеотидов (191-D5-004), как показано на фиг.7А, при этом девять из десяти (191-D5-001) или шесть из семи нуклеотидов (191-D5-004) соответственно 5'-концевого фрагмента и 3'-концевого фрагмента могут гибридизировать друг с другом. Уменьшение до семи нуклеотидов соответственно 5'- и 3'-концевых фрагментов (при этом шесть из семи нуклеотидов могут гибридизировать друг с другом) вызывает ослабление сродства связывания с SDF-1 (191-D5-004). Концевые фрагменты SDF-1-связывающей нуклеиновой кислоты типа С 191-D5-004 модифицировали, заменяя неспаривающийся нуклеотид 'A' в 3'-концевом фрагменте 191-D5-004 нуклеотидом 'C' (191-D5-005). Такая модификация вызывала улучшение связывания. Указанное производное SDF-1-связывающей нуклеиновой кислоты типа С 191-D5-005 характеризовалось таким же связыванием с SDF-1, что и 191-D5-001. Дальнейшее усечение 5'- и 3'-концевых фрагментов до пяти нуклеотидов вызывало образование молекулы, длина которой в общей сложности была равна 29 нуклеотидам (191-D5-007). Благодаря сходству 191-D5-001 и SDF-1-связывающих нуклеиновых кислот типа С 197-В2, 191-D5-001, 197-Н1, 197-А5, 197-Н3, 197-В1, 197-Е3, 197-D1, 197-Н2 и 197-D2 и на основании данных, полученных для 191-D5-007, можно предположить, что 5'- и 3'-концевые фрагменты могут быть в принципе усечены до пяти нуклеотидов, при этом были успешно испытаны нуклеотидные последовательности 'CGGGA' для 5'-концевого фрагмента и 'UCCCG' для 3'-концевого фрагмента (SDF-1-связывающая нуклеиновая кислота типа С 191-D5-007). Весьма удивительным является то, что SDF-1-связывающая нуклеиновая кислота типа С 191-D5-007 связывается с SDF-1 лучше, чем 191-D5-001 (определение было произведено на уровне аптамера при помощи анализа конкурентного связывания). Константу равновесного связывания KD 191-D5-007 определяли при помощи анализа ослабления связывания (KD = 2,2 нМ, фиг.20) и путем измерения резонанса поверхностного плазмона (KD = 0,8 нМ, фиг.21). Значение IC50 (50% ингибирующая концентрация), равное 0,1 нМ, было измерено для 191-D5-007 при помощи анализа хемотаксиса in vitro в культуре клеток. Далее было произведено усечение обоих концевых фрагментов до четырех нуклеотидов (191-D5-010, фиг.7А).

Другие производные SDF-1-связывающей нуклеиновой кислоты типа С 191-D5-001 (191-D5-017/-024/-029), в которых 5'- и 3'-концевые фрагменты имели четыре нуклеотида, также характеризовались меньшим сродством связывания с SDF-1 при выполнении анализа ослабления конкурентного связывания по сравнению с 191-D5-007 (фиг.7В). Дополнительно были испытаны альтернативные 5'- и 3'-концевые фрагменты, длина которых была равна 5 нуклеотидам (191-D5-017-29a, 191-D5-017-29b, 191-D5-019-29a, 191-D5-024-29a, 191-D5-025-29b). Указанные производные имеют общую формулу для 5'-концевого фрагмента 'XSSSSV' (формула-7-5' типа С) и 3'-концевого фрагмента 'BSSSXS' (формула-7-3' типа С), где XS отсутствует или означает 'S'. Два из пяти испытанных вариантов обладали таким же сродством связывания с SDF-1, что и 191-D5-007 (191-D5-024-29a, 191-D5-024-29b; фиг.7В). Последовательности 5'-концевого и 3'-концевого фрагментов производных 191-D5-001, которые характеризуются лучшим сродством связывания с SDF-1 и содержат 5'-концевой и 3'-концевой фрагменты, состоящие из пяти нуклеотидов, (191-D5-007, 191-D5-024-29a, 191-D5-024-29b) могут быть представлены общей формулой (5'-концевой фрагмент: 'SGGSR', формула-8-5' типа С; 3'-концевой фрагмент: 'YSCCS', формула-8-3' типа С).

Усеченные производные SDF-1-связывающей нуклеиновой кислоты типа С 197-В2 анализировали при помощи анализа ослабления конкурентного связывания по сравнению с исходной молекулой 197-В2 и 191-D5-007 (фиг.8). При выполнении анализа ослабления конкурентного связывания по сравнению с 191-D5-007 было установлено, что 197-В2 обладает таким же сродством связывания с SDF-1, что и 191-D5-007. 5'- и 3'-концевые фрагменты были укорочены без потери сродства связывания с десяти нуклеотидов (197-В2) до пяти нуклеотидов (197-В2-005), при этом нуклеотиды 5'-концевого фрагмента и 3'-концевого фрагмента могут полностью гибридизировать друг с другом. При замене 5'-концевого фрагмента ('GCGGG') и 3'-концевого фрагмента ('CCUGC') 197-В2-005 фрагментом 'GCCGG' (5'-концевой фрагмент) и фрагментом 'CCGGC' (3'-концевой фрагмент) 197-В2-006 полностью сохранялось сродство связывания с SDF-1. Так как нуклеиновые кислоты 197-В2 и 191-D5-001 (и их производные) имеют идентичную центральную нуклеотидную последовательность (GGUUAGGGCUAGAAGUCGG) и были испытаны несколько производных 191-D5 с 5'-и 3'-концевыми фрагментами длиной четыре нуклеотида, дальнейшее усечение 5'- и 3'-концевых фрагментов не производили. Были созданы еще два производных, содержащих шесть нуклеотидов соответственно у 5'- и 3'-конца (5'- и 3'-концевые фрагменты). Сродство связывания с SDF-1 обеих молекул (197-В2-006-31а и 197-В2-00631b) было аналогично установленному для 191-D5-007 и 197-В2-006 (фиг.8). Последовательности 5'-концевого и 3'-концевого фрагментов производных 197-В2, которые характеризуются лучшим сродством связывания с SDF-1 и содержат 5'-концевой и 3'-концевой фрагменты из пяти нуклеотидов, могут быть представлены общей формулой (5'-концевой фрагмент: 'GCSGG', формула-9-5' типа С; 3'-концевой фрагмент: 'CCKGC', формула-9-3' типа С).

При объединении предпочтительных 5'- и 3'-концевых фрагментов усеченных производных SDF-1-связывающих нуклеиновых кислот типа С 191-D5-001 (5'-концевой фрагмент: 'SGGSR', формула-8-5' типа С; 3'-концевой фрагмент: 'YSCCS', формула-8-3' типа С) и 197-В2 (5'-концевой фрагмент: 'GCSGG', формула-9-5' типа С; 3'-концевой фрагмент: 'CCKGC', формула-9-3' типа С) предпочтительная общая формула для 5'-концевого и 3'-концевого фрагментов представляет собой 'SSSSR' (5'-концевой фрагмент, формула-10-5' типа С) и 'YSBSS' (3'-концевой фрагмент: формула-10-3' типа С).

1.4 Другие SDF-1-связывающие нуклеиновые кислоты

Кроме того, были идентифицированы еще три SDF-1-связывающие нуклеиновые кислоты, не имеющие SDF-1-связывающих фрагментов 'типа А', 'типа В' и 'типа С'. Указанные нуклеиновые кислоты анализировали в виде аптамеров при помощи анализа ослабления связывания (фиг.9).

Следует отметить, что любые последовательности, показанные на фиг.1-9, являются нуклеиновыми кислотами по настоящему изобретению, включая их усеченные формы, а также удлиненные формы, при условии, однако, что таким образом усеченные и удлиненные молекулы нуклеиновых кислот могут связываться с мишенью.

Пример 2. Модификация SDF-1-связывающих шпигельмеров полиэтиленгликолем (PEG) с молекулярной массой 40 кДа и другие модификации указанных шпигельмеров

Чтобы увеличить время пребывания шпигельмера в плазме in vivo, шпигельмеры 193-G2-012, 192-А10-008, 191-D5-007, 197-B2-006 и 197-В2-006-31b ковалентно связывали у 5'-конца с полиэтиленгликолевой (PEG) частью с молекулярной массой 40 кДа, как описано в Примере 3 (PEG-модифицированные клоны: 193-G2-012-5'-PEG, 192-A10-008-5'-PEG, 191-D5-007-5'-PEG, 197-B2-006-5'-PEG и 197-В2-006-31b-5'-PEG).

Молекулы PEG-модифицированного шпигельмера анализировали при помощи анализа ТАХ in vitro в культуре клеток (Пример 5) и путем измерений резонанса плазмона в приборе Biacore (Пример 6). Все шпигельмеры, модифицированные PEG с молекулярной массой 40 кДа, по-прежнему способны ингибировать SDF-1-индуцированный хемотаксис и связываться с SDF-1 на низком наномолярном уровне (фиг.23А, 23В, 24А и фиг.24В).

Кроме того, SDF-связывающий шпигельмер 192-А10-001 модифицировали PEG с молекулярной массой 40 кДа, PEG с молекулярной массой 30 кДа, HES с молекулярной массой 100 кДа или HES с молекулярной массой 130 кДа (PEG-модифицированные клоны: 192-А10-001-5'-PEG40, 192-A10-001-5'-PEG30, 192-A10-001-5'-HES100, 192-A10-001-5'-HES130; метод связывания описан в Примере 3). Как показано на фиг.25А и фиг.25В, части PEG и HES не влияют на способность шпигельмеров ингибировать SDF-1-индуцированный хемотаксис.

Пример 3. Синтез и получение производных аптамеров и шпигельмеров

3.1 Лабораторный синтез

Аптамеры и шпигельмеры были получены твердофазным синтезом в синтезаторе ABI 394 (Applied Biosystems, Foster City, CA, USA) с использованием РНК-фосфорамидитов 2'TBDMS (Damha and Ogilvie, 1993). rA(N-Bz)-, rC(Ac)-, rG(N-ibu)- и rU-фосфорамидиты в D- и L-конфигурации были приобретены в компании ChemGenes, Wilmington, MA. Аптамеры и шпигельмеры очищали гель-электрофорезом.

3.2 Широкомасштабный синтез и модификация

Шпигельмеры были получены твердофазным синтезом в синтезаторе AktaPilot100 (Amersham Biosciences; General Electric Healthcare, Freiburg) с использованием РНК-фосфорамидитов 2'TBDMS (Damha and Ogilvie, 1993). L-rA(N-Bz)-, L-rC(Ac)-, L-rG(N-ibu)- и L-rU-фосфорамидиты были приобретены в компании ChemGenes (Wilmington, MA, USA). Модификатор 5'-аминоконца был приобретен в компании American International Chemicals Inc. (Framingham, MA, USA). Синтез шпигельмеров начинали на матрице CPG с размером пор 1000 Å, модифицированной соответственно L-riboG, L-riboC, L-riboA, L-riboU (Link Technology, Glasgow, UK). Для связывания (15 мин/цикл) использовали 0,3 М раствор бензилтиотетразола (American International Chemicals Inc., Framingham, MA, USA) в ацетонитриле и 3,5 эквивалента соответствующего 0,2 М раствора фосфорамидита в ацетонитриле. Выполняли цикл окисления - кэппирования. Другие стандартные растворители и реагенты для синтеза олигонуклеотидов были приобретены в компании Biosolve (Valkenswaard, NL). Шпигельмеры были синтезированы с включением DMT-ON; после снятия защиты шпигельмеры очищали препаративной ВЭЖХ с обращенной фазой (Wincott F. et al., 1995), используя среду Source15RPC (Amersham). 5'-концевую группу DMT удаляли при помощи 80% уксусной кислоты (90 минут при комнатной температуре). Затем добавляли 2 М водный раствор NaOAc и шпигельмер обессоливали посредством фильтрования прямым потоком с использованием регенерируемой целлюлозной мембраны с размером пор 5 К (5000 Å) (Millipore, Bedford, MA).

3.3 Модификация полиэтиленгликолем (PEG)

Чтобы увеличить время пребывания шпигельмера в плазме in vivo, шпигельмеры ковалентно связывали у 5'-конца с полиэтиленгликолевой (PEG) частью с молекулярной массой 40 кДа.

Для модификации полиэтиленгликолем (для ознакомления с техническими деталями метода модификации полиэтиленгликолем см. заявку на европейский патент ЕР 1306382) очищенные шпигельмеры с модифицированным 5'-аминоконцом растворяли в смеси Н2О (2,5 мл), ДМФА (5 мл) и буфера А (5 мл; полученного в результате смешивания лимонной кислоты · Н2О [7 г], борной кислоты [3,54 г], фосфорной кислоты [2,26 мл] и 1 М раствора NaOH [343 мл] и добавления воды до конечного объема, равного 1 л; значение рН = 8,4 было получено при добавлении 1 М раствора HCl).

Значение рН раствора шпигельмера доводили до 8,4, добавляя 1 М раствор NaOH. Затем каждые 30 минут при 37°С добавляли сложный эфир N-гидроксисукцинимида (NHS) полиэтиленгликоля с молекулярной массой 40 кДа (Nektar Therapeutics, Huntsville, AL) в виде шести порций, равных 0,25 эквивалента, до достижения максимального выхода 75-85%. Значение рН реакционной смеси сохраняли равным 8-8,5, добавляя 1 М раствор NaOH во время добавления сложного эфира N-гидроксисукцинимида (NHS) полиэтиленгликоля.

Реакционную смесь перемешивали с 4 мл раствора мочевины (8 М) и 4 мл буфера В (0,1 М раствор ацетата триэтиламмония в Н2О) и нагревали до 95°С в течение 15 минут. PEG-модифицированный шпигельмер очищали ВЭЖХ с обращенной фазой в среде Source 15RPC (Amersham), используя градиент ацетонитрила (буфер В; буфер С: 0,1 М раствор ацетата триэтиламмония в ацетонитриле). Избыток PEG элюировали 5% буфера С, PEG-модифицированный шпигельмер элюировали 10-15% буфера С. Фракции продукта с чистотой >95% (по результатам ВЭЖХ) объединяли и смешивали с 40 мл 3 М раствора NaOAC. PEG-модифицированный шпигельмер обессоливали посредством фильтрования прямым потоком (регенерируемая целлюлозная мембрана с размером пор 5 К (5000 Å), Millipore, Bedford, MA).

3.4 Модификация гидроксиэтиловым крахмалом (HES)

Чтобы увеличить время пребывания шпигельмера в плазме in vivo, шпигельмеры ковалентно связывали с гидроксиэтиловым крахмалом (HES), имеющим разные молекулярные массы >130 кДа и степень замещения >0,5. 5'-Конец шпигельмера является предпочтительным местом для конъюгирования.

Для модификации гидроксиэтиловым крахмалом (для ознакомления с техническими деталями метода модификации гидроксиэтиловым крахмалом см. заявку на патент Германии DE 10112825 A1, и для ознакомления с D/L-нуклеиновыми кислотами см. публикацию РСТ WO 02/080979 A2) очищенный шпигельмер с модифицированным 5'-аминоконцом растворяли в бикарбонате натрия (0,3 М раствор, 1 мл) и значение рН доводили до 8,5.

В зависимости от шпигельмера к N,N-диметилформамиду (1 мл) добавляли 5-кратный избыток свободной кислоты HES (3,3 ммоль, Supramol, Rosbach, Germany) и ди(N-сукцинимидил)карбонат (3,3 ммоль), получая при этом раствор активированного сложного эфира N-гидроксисукцинимида HES. Для растворения всех реагентов смесь недолго перемешивали при 60°С, охлаждали до 25°С и затем перемешивали в течение 1,5 часа при 25°С. Раствор шпигельмера добавляли к раствору активированного HES и полученную смесь перемешивали при 25°С и рН 8,5. Ход реакции контролировали при помощи аналитической IEX-ВЭЖХ. Конъюгирование обычно продолжалось до >75% в течение 1 часа.

Реакционную смесь очищали при помощи IEX-ВЭЖХ в среде Source 15Q (GE, Freiburg, Germany), перемешивали с 10-кратным количеством буфера А (1 мМ EDTA, 25 мМ трис-буфера, 10 мМ NaClO4 в воде/ацетонитриле, 9:1, рН 4). Избыток HES элюировали 5% буфера А (1 мМ EDTA, 25 мМ трис-буфера, 500 мМ NaClO4 в воде/ацетонитриле, 9:1, рН 4) и конъюгат HES-шпигельмера элюировали 20-30% буфера В. Фракции продукта с чистотой >95% (по результатам ВЭЖХ) объединяли и обессоливали посредством фильтрования прямым потоком (регенерируемая целлюлозная мембрана с размером пор 5 К (5000 Å), Millipore, Bedford, MA).

Пример 4. Определение констант связывания (анализ ослабления связывания)

4.1 Анализ ослабления прямого связывания

Сродство аптамеров к биотинилированному D-SDF-1 человека измеряли при помощи анализа ослабления связывания при 37°С. Аптамеры метили у 5'-фосфата полинуклеотидкиназой Т4 (Invitrogen, Karlsruhe, Germany), используя [γ-32Р]-меченный АТР (Hartmann Analytic, Braunschweig, Germany). Удельная радиоактивность меченых аптамеров была равна 200000-800000 импульсам/мин/пмоль. Аптамеры инкубировали после денатурации и ренатурации с концентрацией 10, 20, 30 или 40 пМ при 37°С в буфере для селекции (20 мМ трис-HCl, рН 7,4; 137 мМ NaCl; 5 мМ KCl; 1 мМ MgCl2; 1 мМ CaCl2; 0,1% [мас./об.] твина-20) вместе с разными количествами биотинилированного D-SDF-1 человека в течение 4-12 часов для достижения равновесия при низких концентрациях. В буфер для селекции добавляли 10 мкг/мл сывороточного альбумина человека (Sigma-Aldrich, Steinheim, Germany) и 10 мкг/мл РНК дрожжей (Ambion, Austin, USA), чтобы предотвратить адсорбцию партнеров связывания поверхностями используемой пластиковой посуды или иммобилизующей матрицей. Концентрация биотинилированного D-SDF-1 человека находилась в пределах от 8 пМ до 100 пМ; общий объем реакционной смеси был равен 1 мл. Пептид и комплексы пептида с аптамером иммобилизовали на частицах стрептавидина размером 1,5 мкл Ultralink Plus (Pierce Biotechnology, Rockford, USA), которые предварительно уравновешивали буфером для селекции и ресуспендировали в общем объеме, равном 6 мкл. Частицы выдерживали в термосмесителе в суспензии в течение 30 минут при соответствующей температуре. Подсчет радиоактивности иммобилизованного образца производили в сцинтилляционном счетчике после отделения супернатанта и соответствующей промывки. Был построен график зависимости процентного значения связывания от концентрации биотинилированного D-SDF-1 человека и определены константы диссоциации при помощи алгоритмов программного обеспечения (GRAFIT; Erithacus Software; Surrey U.K.) исходя из предположения, что стехиометрия соответствует отношению 1:1.

4.2 Анализ ослабления конкурентного связывания

Для сравнения разных D-SDF-1-связывающих аптамеров был выполнен анализ конкурентного связывания с распределением аптамеров по рангу. Для указанной цели самый аффинный аптамер метили радиоактивным изотопом (см. выше) и использовали в качестве эталона. После денатурации и ренатурации указанный аптамер инкубировали при 37°С с биотинилированным D-SDF-1 человека в 1 мл буфера для селекции в условиях, обеспечивающих примерно 5-10% связывание с пептидом после иммобилизации и промывки на агарозе NeutrAvidin или стрептавидине Ultralink Plus (оба вещества приобретены в компании Pierce) без конкурентного связывания. Добавляли избыток денатурированных и ренатурированных немеченных вариантов аптамера D-РНК до достижения разных концентраций (например, 2, 10 и 50 нМ) с меченым эталонным аптамером для выполнения параллельных реакций связывания. Испытуемые аптамеры конкурировали с эталонным аптамером за связывание с мишенью, в результате чего сигнал связывания ослабевал в зависимости от характеристик связывания. Аптамер, который был признан наиболее активным при выполнении данного анализа, затем мог служить в качестве нового эталона для анализа конкурентного связывания других вариантов аптамеров.

Пример 5. Анализ ингибирования SDF-1-индуцированного хемотаксиса SDF-1-связывающими шпигельмерами

Клетки Джурката Т-клеточного лейкоза человека (приобретенные в компании DSMZ, Braunschweig) культивировали при 37°С и 5% СО2 в среде RPMI 1640 с глутамаксом (Invitrogen, Karlsruhe, Germany), содержащей 10% фетальной телячьей сыворотки, 100 единиц/мл пенициллина и 100 мкг/мл стрептомицина (Invitrogen, Karlsruhe, Germany). За один день до эксперимента клетки высевали в новую колбу с плотностью 0,3×106/мл (9×106/30 мл) в стандартную среду (Invitrogen, Karlsruhr, Germany).

Для выполнения данного эксперимента клетки центрифугировали (5 минут с ускорением 300 g), ресуспендировали, подсчитывали и один раз промывали 15 мл НВН (сбалансированный солевой раствор Хэнкса, содержащий 1 мг/мл бычьего сывороточного альбумина и 20 мМ HEPES; Invitrogen, Karlsruhe, Germany). Затем клетки ресуспендировали в количестве 3×106/мл или 1,33×106/мл в зависимости от типа используемого фильтровального планшета. Затем клетки оставляли на несколько часов мигрировать через пористые мембраны фильтровальных планшетов в раствор, содержащий SDF-1 и разные количества шпигельмера. Использовали планшеты Transwell и вставки с пористой поликарбонатной мембраной с размером пор 5 мкм (Corning; 3421) или планшеты MultiScreen MIC (Millipore, MAMIC5S10).

5.1 Методика использования планшетов Transwell

Стимулирующие растворы (SDF-1 + шпигельмер в разных концентрациях) получали в 600 мкл НВН в нижних отделениях планшетов Transwell и инкубировали в течение 20-30 минут. Все условия дублировали, по меньшей мере, дважды. Вставки переносили в лунки, содержащие стимулирующие растворы, и помещали на вставки (3×105 клеток/лунку) 100 мкл взвеси клеток в количестве 3×106/мл. Затем клетки оставляли мигрировать в течение 3 часов при 37°С.

Затем вставки удаляли и в лунки (а также в калибровочные лунки) добавляли 60 мкл рабочего раствора ресазурина (Sigma, Deisenhofen, Germany) (440 мкМ в PBS; Biochrom, Berlin, Germany). Планшеты инкубировали при 37°С в течение 2,5-3 часов. После инкубации 200 мкл содержимого каждой лунки переносили на черный 96-луночный планшет. Флуоресцентные сигналы измеряли при длине волны 544 нм (возбуждение) и 590 нм (излучение) в многоканальном спектрофотометре для прочтения планшетов Fluostar Optima (BMG, Offenburg, Germany).

5.2 Методика использования миллипористых планшетов MultiScreen

Стимулирующие растворы (SDF-1 + шпигельмер в разных концентрациях) получали в виде 10-кратных растворов на 0,2 мл низкопрофильном 96-луночном планшете. В нижние отделения планшета MultiScreen пипетировали 135 мкл НВН и добавляли 15 мкл стимулирующих растворов. Все условия дублировали трижды. Через 20-30 минут в планшет, содержащих стимулирующие растворы, вставляли фильтровальный планшет и в лунки фильтровального планшета (1×105 клеток/лунку) вводили 75 мкл взвеси клеток в количестве 1,33×106/мл. Затем клетки оставляли мигрировать в течение 3 часов при 37°С.

Затем вставочный планшет удаляли и в нижние лунки добавляли 20 мкл рабочего раствора ресазурина (440 мкМ в PBS). Планшеты инкубировали при 37°С в течение 2,5-3 часов. После инкубации 100 мкл содержимого каждой лунки переносили на черный 96-луночный планшет. Флуоресцентные сигналы измеряли в соответствии с приведенным выше описанием.

5.3 Оценка

Для оценки полученных результатов значения флуоресценции корректировали в отношении фоновой флуоресценции (при отсутствии клеток в лунке). Затем вычисляли разницу между экспериментальными условиями в присутствии и отсутствии SDF-1. Значение для образца без шпигельмера (только SDF-1) было задано равным 100%, и значения для образцов со шпигельмером вычисляли в виде процентного значения от заданной величины. При построении кривой дозовой зависимости процентные значения определяли в зависимости от концентрации шпигельмера и на основании полученной кривой графически определяли значение IC50 (концентрация шпигельмера, соответствующая 50% активности без шпигельмера).

5.4 Результаты

5.4.1 Стимуляция клеток Джурката SDF-1 человека в зависимости от дозы

Было установлено, что SDF-1 человека стимулирует миграцию клеток Джурката в зависимости от дозы, при этом половина максимальной стимуляции имеет место при концентрации, примерно равной 0,3 нМ (фиг.11).

5.4.2 Ингибирование хемотаксиса, индуцированного SDF-1 человека, SDF-1-связывающими шпигельмерами в зависимости от дозы

Когда клетки оставляли мигрировать в направлении раствора, содержащего SDF-1 человека и SDF-1-связывающие шпигельмеры в возрастающих концентрациях, имело место ингибирование в зависимости от дозы. Соответствующие значения IC50 испытанных шпигельмеров указаны в примере 1. При использовании неспецифического контрольного шпигельмера вместо SDF-1-связывающих шпигельмеров ингибирующее действие отсутствовало до концентрации, равной 1 мкМ (фиг.26).

5.4.3 Ингибирование хемотаксиса, индуцированного SDF-1 мыши, SDF-1-связывающими шпигельмерами в зависимости от дозы

SDF-1 хорошо сохраняется в разных видах: SDF-1 мыши отличается от SDF-1a человека одной аминокислотой (изолейцин в положении 18 вместо валина). SDF-1 мыши может стимулировать хемотаксис клеток Джурката (фиг.27), при этом было установлено, что шпигельмеры 192-А10-001 и 191-D5-007-5'-PEG ингибируют данное действие с такой же силой, как и в случае SDF-1 человека (фиг.28).

Пример 6. Анализ связывания путем измерения резонанса поверхностного плазмона

Для анализа связывания шпигельмеров с SDF-1α человека использовали прибор Biacore 2000 (Biacore AB, Uppsala, Sweden). Когда SDF-1α связывали с помощью аминогрупп, SDF-1α диализировали от воды в течение 1-2 часов (смешанные сложные эфиры целлюлозы Millipore VSWP; размер пор 0,025 мкМ) для удаления интерферирующих аминов. Сенсорные чипы СМ4 (Biacore AB, Uppsala, Sweden) активировали до связывания с белком, инъецируя 35 мкл разведенного в отношении 1:1 раствора 0,4 М NHS и 0,1 М EDC со скоростью потока 5 мкл/мин. Затем инъецировали хемокин в концентрациях 0,1-1,5 мкг/мл при скорости потока 2 мкл/мин до достижения показания прибора в диапазоне 1000-2000 RU (условных единиц). Непрореагировавшие сложные эфиры NHS дезактивировали при помощи инъекции 35 мкл раствора гидрохлорида этаноламина (рН 8,5) со скоростью потока 5 мкл/мин. Сенсорный чип дважды инициировали связывающим буфером и уравновешивали при скорости 10 мкл/мин в течение 1-2 часов до достижения устойчивых исходных данных. Кинетические параметры и константы диссоциации определяли для всех белков, выполняя серию инъекций шпигельмера в концентрациях 1000, 500, 250, 125, 62,5, 31,25 и 0 нМ в буфере для селекции (трис-HCl, 20 мМ; NaCl, 137 мМ; KCl, 5 мМ; CaCl2, 1 мМ; MgCl2, 1 мМ; твин 20, 0,1% [мас./об.]; рН 7,4). Во всех экспериментах анализ выполняли при 37°С, используя команду Kinject, определяющую время ассоциации в 180 секунд и время диссоциации в 360 секунд при скорости потока 10 мкл/мин. Анализ данных и вычисление констант диссоциации (KD) производили при помощи программного обеспечения BIAevaluation 3.0 (BIACORE AB, Uppsala, Sweden), используя алгоритм стехиометрического соответствия Лангмуира при соотношении 1:1.

Пример 7. Ингибирование связывания [ 125 J]-SDF-1 с CXCR4-экспрессирующими клетками SDF-1-связывающими шпигельмерами

7.1 Способ

Клон кДНК, кодирующий рецептор CXCR4 человека (NM_003467.2), был приобретен в компании OriGene Technologies (Rockville, MD) и клонирован в вектор pCR3.1 (Invitrogen, Karlsruhe, Germany). Полученный вектор трансфецировали в клетки СНО-К1 (DSMZ, Braunschweig, Germany), используя липофектамин 2000 (Invitrogen), и отбирали устойчиво экспрессирующие линии клеток, производя обработку генетицином. Экспрессию рецепторов проверяли при помощи полимеразной цепной реакции с обратной транскрипцией (RT-PCR).

Для выполнения анализов связывания CXCR4-экспрессирующие клетки высевали на 24-луночные планшеты, сенсибилизированные полилизином, с плотностью клеток 1×105 клеток/лунку и культивировали в течение ночи при 37°С и 5% СО2 в среде СНО-Ultra (Cambrex, Verviers, Belgium), содержащей 50 единиц/мл пенициллина, 50 мкг/мл стрептормицина и 0,5 мг/мл генетицина.

При выполнении эксперимента по связыванию среду удаляли и клетки один раз промывали сбалансированным солевым раствором Хэнкса, дополнительно содержащим 20 мМ HEPES, 1 мг/мл бычьего сывороточного альбумина, 0,1 мг/мл бацитрацина (НВВ). Затем клетки инкубировали в 0,2 мл НВВ в течение 1 часа при комнатной температуре вместе с 50 пМ [125J]-SDF-1 (PerkinElmer, Rodgau, Germany) и шпигельмером в разных концентрациях.

Неспецифическое связывание определяли, добавляя в несколько лунок немеченный SDF-1 человека (R & D Systems, Wiesbaden, Germany) до конечной концентрации, равной 0,5 мкМ.

После окончания инкубации супернатант удаляли и лунки 3 раза промывали охлаждаемым льдом НВВ. Затем клетки лизировали 0,1 мл 0,1 М раствора NaOH. Лизаты переносили в сцинтилляционные флаконы, добавляли 4 мл жидкого сцинтилляционного коктейля Unisafe 1 (Zinsser, Frankfurt, Germany) и производили подсчет в сцинтилляционном счетчике Beckman LS6500.

Так как значения для неспецифического связывания (связывание в присутствии большого количества немеченного SDF-1) были несколько выше значений для общего связывания в присутствии шпигельмера в высоких концентрациях (500 пМ), то для вычисления значений IC50 использовали разность между максимальным связыванием (“max”) и связыванием в присутствии 500 пМ шпигельмера.

7.2 Результаты

Построение графика зависимости связанного [125I]-SDF-1 от концентрации шпигельмера показано, что шпигельмер 192-А10-001 может блокировать связывание SDF-1 при значении IC50, равном примерно 60 пМ (фиг.29).

Пример 8. Ингибирование SDF-1-индуцированной активации МАР-киназы SDF-1-связывающими шпигельмерами

8.1 Способ

CXCR4-экспрессирующие клетки СНО высевали на 6-луночные планшеты с плотностью 0,5×106 клеток/лунку и культивировали в течение примерно трех часов при 37°С и 5% СО2 в среде СНО-Ultra (Cambrex, Verviers, Belgium), содержащей 50 единиц/мл пенициллина, 50 мкг/мл стрептомицина и 0,5 мг/мл генетицина. После прикрепления клеток среду удаляли и заменяли средой F12 Хэма, содержащей 50 единиц/мл пенициллина, 50 мкг/мл стрептомицина. Затем клетки инкубировали в течение ночи при 37°С и 5% СО2. За три часа до стимуляции среду еще раз заменяли свежей средой F12 Хэма. Клетки стимулировали 1 нМ SDF-1 человека и разными количествами шпигельмера в течение 5 или 10 минут. Затем среду удаляли и клетки быстро промывали один раз 1 мл охлаждаемого льдом физиологического раствора с фосфатным буфером (PBS) и лизировали буфером для образца, содержащим додецилсульфат натрия (трис/HCl, рН 6,8, 62,5 мМ; глицерин, 10%; SDS, 2%; бромфенол синий, 0,01%; бета-меркаптоэтанол, 5%). В каждую лунку добавляли 1 мкл 0,5 ед./мкл бензоназы (Merck, Darmstadt, Germany), клетки инкубировали в течение 5-10 минут при комнатной температуре, лизаты переносили в пробирки Эппендорфа, инкубировали при 95°С в течение 5 минут и хранили при -20°С до выполнения последующего анализа.

25 мкл лизатов разделяли на 10% денатурирующих полиакриламидных гелях с додецилсульфатом натрия. Белки переносили при помощи электроблоттинга на нитроцеллюлозные мембраны HybonECL (Amersham/GE Healthcare, Munich, Germany). После блоттинга мембраны окрашивали понсо красным (0,2% в 3% трихлоруксусной кислоте) для определения наполнения и переноса белка и затем блокировали, инкубируя в TBS-T (физиологический раствор с трис-буфером (20 мМ трис/HCl, рН 7,6, 137 мМ NaCl) с 0,1% твина 20), содержащем 10% обезжиренного сухого молока, при 2-8°С в течение ночи. Затем мембрану инкубировали с антителом кролика против фосфо-МАР-киназы (1:1000 в 10% молоке в TBS-T) в течение 2 часов при комнатной температуре. Мембрану трижды промывали TBS-T в течение 5 минут и инкубировали с конъюгатом HRP с антителом против IgG кролика (1:2000 в 10% молоке в TBS-T) в течение 1 часа при комнатной температуре. Затем мембрану снова трижды промывали TBS-T в течение 5 минут и инкубировали в хемилюминесцентном реагенте LumiGloR в течение 1 минуты. Люминесценцию детектировали, экспонируя изображение на хемилюминесцентных пленках Hyperfilm™ECL (Amersham/GE Healthcare) в течение периода времени от 30 секунд до 2 минут. Антитела и детектирующий люминесценцию реагент входили в набор антител против МАР-киназы ProsphoPlus p44/42 (Thr202/Tyr204), приобретенный в компании Cell Signaling Technology (New England Biolabs, Frankfurt a.M., Germany).

8.2 Результаты

Стимуляция CXCR4-экспрессирующих клеток 1 нМ SDF-1 человека в течение 5 минут вызывало сильную стимуляцию МАР-киназы, о чем свидетельствовало увеличение интенсивности полосы, соответствующей активированной МАР-киназе. Шпигельмер 191-А10-001 (фиг.30) может ингибировать такую активацию МАР-киназы в зависимости от дозы.

Пример 9. Функциональный анализ шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, при выполнении анализа разрастания кольца аорты

Для испытания функциональности шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, в процессе стандартного исследования развития кровеносных сосудов в органной культуре выполняли анализы разрастания кольца аорты. Данный анализ, при выполнении которого определяют длину и количество сосудоподобных выростов из эксплантатов, является наиболее широко используемой моделью развития кровеносных сосудов в органной культуре (Auerbach et al., 2003). Установлено, что SDF-1 индуцирует разрастание при выполнении анализа указанного типа (Salcedo et al., 1999).

Аорты крыс разрезали на кольца, погружали в коллагеновую матрицу и инкубировали с SDF-1, а также с SDF-1 и шпигельмером 193-G2-012-5'-PEG, связывающим SDF-1 человека, или SDF и нефункциональным PEG-модифицированным контрольным шпигельмером, не связывающим SDF-1. Через 6-7 дней разрастание (то есть вырост эндотелиальных клеток) анализировали, получая изображения и определяя индекс разрастания.

Способ

Аорты самцов крыс были приобретены в компании Bagheri Life sciences (Berlin, Germany). Свежеприготовленные аорты транспортировали на льду в среде MCDB 131 (Invitrogen, Karlsruhe, Germany), содержащей 50 единиц/мл пенициллина, 50 мкг/мл стрептомицина (оба вещества были приобретены в компании Invitrogen, Karlsruhe, Germany) и 2,5 мкг/мл фунгизона (Cambrex, USA).

Для выполнения эксперимента одну аорту переносили в чашку с культурой клеток вместе со средой и удаляли остаточную соединительную ткань. Затем аорту разрезали скальпелем на кольца длиной около 1-2 мм. Полученные кольца обильно промывали (по меньшей мере, пять раз) в среде 199 (Invitrogen, Karlsruhe, Germany) и помещали в лунки 24-луночного планшета, содержащего в каждой лунке 450 мкл раствора коллагена. Раствор коллагена был получен в результате смешивания 9 мл коллагена из хвоста крысы (3 мг/мл в 0,1% уксусной кислоте; Sigma, Deisenhofen, Germany) с 1,12 мл 10-кратной среды 199 (Invitrogen, Karlsruhe, Germany), 1,12 мл 10-кратного буфера для коллагена (0,05 н раствор NaOH, 200 мМ HEPES, 260 мМ NaHCO3) и 0,6 мл 200 мМ глутамина. Кольца ориентировали таким образом, чтобы обрезанные края были перпендикулярны основанию лунки. Коллаген оставляли затвердевать, для чего планшеты инкубировали в течение по меньшей мере одного часа при 37°С. Затем в каждую лунку добавляли 1 мл среды MCDB 131 с добавками (SDF-1 и шпигельмеры). Кольца инкубировали при 37°С в течение шести-семи дней. При выполнении экспериментов по разрастанию в качестве контрольного образца дополнительно использовали VEGF (эндотелиальный фактор роста сосудов).

Разрастание документировали, получая изображения с помощью цифровой камеры. В некоторых случаях кольца фиксировали, добавляя 1 мл 10% параформальдегида, и хранили при 2-8°С для последующего документирования. Полученные изображения анализировали при помощи программного обеспечения для обработки изображений Scion Image. После калибровки с использованием изображения, полученного с помощью микрометра, чертили линию на расстоянии 0,33 мм от одного края кольца. С помощью программного обеспечения был построена гистограмма вдоль указанной линии, затем гистограммы печатали и подсчитывали пики (представляющие выросты, пересекающие указанную линию). Полученное число было принято в качестве индекса разрастания. Оценивали 4-5 колец в каждом эксперименте. Статистический анализ выполняли при помощи программы WinSTAT для Excel.

Результаты

Можно отметить, что SDF-1 индуцирует разрастание и указанный эффект может быть блокирован шпигельмером 193-G2-012-5'-PEG, связывающим SDF-1 человека. Блокирование SDF-1-индуцированного разрастания не было отмечено при использовании нефункционального PEG-модифицированного контрольного шпигельмера (фиг.31 и 32).

Пример 10. Уровень в плазме SDF-1 и шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, введенного крысам в виде одной внутривенной ударной дозы шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека

Для испытания функциональности шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, in vivo крысам вводили шпигельмер 193-G2-012-5'-PEG, связывающий SDF-1 человека, в виде внутривенной ударной дозы и определяли уровень в плазме шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, и SDF-1. В качестве контрольного эксперимента определяли уровни SDF-1 в плазме крыс, не подвергавшихся никакому воздействию.

Животные, введение и получение образца

Шпигельмер 193-G2-012-5'-PEG, связывающий SDF-1 человека, растворяли в PBS до конечной концентрации, равной 0,5 мг/мл, и стерилизовали фильтрованием. Самцам крыс Sprague Dawley (масса тела около 300 г) вводили 1,0 мг/кг шпигельмера 193-G2-012-5'-PEG, связывающий SDF-1 человека, в виде одной внутривенной ударной дозы. Пробы крови брали через несколько промежутков времени (как показано на фиг.33) для определения клиренса шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, из плазмы.

Анализ методом многослойной гибридизации для количественного определения шпигельмера

Количество шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, в образцах определяли при помощи анализа методом многослойной гибридизации. Принцип выполнения анализа методом многослойной гибридизации аналогичен широко используемому методу ELISA (твердофазный иммуноферментный анализ) и включает иммобилизацию и обнаружение шпигельмера. Обнаружение основано на гибридизации биотинилированного детектирующего зонда с одним концом шпигельмера. Оставшийся однонитевый конец шпигельмера опосредует иммобилизацию комплекса при гибридизации с иммобилизованным улавливающим зондом. После удаления несвязанных комплексов детектирующий зонд, гибиридизированный со шпигельмером, обнаруживают при помощи конъюгата стрептавидина/щелочной фосфатазы, изменяющего хемилюминесцентный субстрат. Анализ методом многослойной гибридизации был также использован для обнаружения и количественного определения РНК-аптамера в соответствии с описанием, приведенным в публикации Drolet et al., 2000.

Приготовление планшета для гибридизации

Зонд, улавливающий 193-G2-012 (SEQ ID NO:240), иммобилизовали на белых ДНК-связывающих 96-луночных планшетах (Corning Costar, Wiesbaden, Germany) в количестве 100 нМ в 0,5 М фосфата натрия, 1 мМ EDTA, рН 8,5 в течение ночи при 4°С. Лунки дважды промывали и блокировали 0,5% мас./об. BSA в 0,25 М фосфата натрия, 0,5 мМ EDTA, рН 8,5 в течение 2 часов при 25°С, снова промывали и хранили при комнатной температуре до последующего использования. До гибридизации планшеты дважды промывали промывочным буфером (3×SSC, 0,5% [мас./об.] додецилсаркозината натрия, рН 7,0; заранее был получен 20-кратный исходный раствор [3 М NaCl, 0,3 М цитрата натрия] без лауроилсаркозина натрия, который разводили соответствующим образом).

Приготовление образца

Все образцы анализировали в виде двух копий. Образцы плазмы оттаивали на льду, подвергали вихревому перемешиванию и недолго центрифугировали в охлаждаемой настольной центрифуге. Гомогенаты ткани оттаивали при комнатной температуре и центрифугировали с максимальной скоростью в течение 5 минут при комнатной температуре. Образцы разводили буфером для гибридизации (40 нМ зонда, детектирующего 193-G2-012 [SEQ ID NO:241], в промывочном буфере) при комнатной температуре в соответствии со следующей схемой:

1:10 10 мкл образца + 90 мкл буфера для гибридизации
1:100 20 мкл 1:10 + 180 мкл буфера для гибридизации

Анализировали все разведенные образцы. Стандартный шпигельмер 193-G2-012-5'-PEG, связывающий SDF-1 человека, последовательно разводили до получения калибровочной кривой из 12 точек в диапазоне 0,001-40 нМ. Калибровочный эталон был идентичен калибровочному эталону исследуемых образцов.

Гибридизация и обнаружение

Образцы нагревали в течение 5 минут при 95°С и охлаждали до комнатной температуры. Комплексы шпигельмера/детектирующего зонда гибридизировали с иммобилизованными улавливающими зондами в течение 45 минут при 25°С в шейкере со скоростью вращения 500 оборотов/мин. Несвязанные шпигельмеры удаляли, производя двукратную промывку соответственно промывочным буфером и 1×TBST (20 мМ трис-Cl, 137 мМ NaCl, 0,1% твина 20, рН 7,5). Гибридизированные комплексы обнаруживали при помощи конъюгата стрептавидина/щелочной фосфатазы, разведенного в отношении 1:5000 в 1×TBST, который встряхивали в течение 1 часа при 25°С в шейкере со скоростью вращения 500 оборотов/мин. Для удаления несвязанного конъюгата лунки снова промывали 1×TBST. Затем лунки заполняли 100 мл субстрата CSDP (Applied Biosystems, Darmstadt, Germany) и инкубировали в течение 45 минут при 25°С. Хемилюминесценцию измеряли в спектрофотометре для прочтения микропланшетов FLUOstar Optima (BMG Labtechnologies, Offenburg, Germany).

Анализ данных

Для количественного анализа данных использовали следующие разведения анализируемого образца:

EDTA в плазме крыс 1:100

Данные, полученные в группе, получавшей наполнитель (без введения шпигельмера), вычитали в виде фонового сигнала.

Выполнение ELISA для количественного определения шпигельмера

Количество SDF-1, присутствующего в образцах плазмы, определяли при помощи твердофазного иммуноферментного анализа, при выполнении которого использовали антитело, специфичное к SDF-1α человека, которое было нанесено на 96-луночный планшет (набор для ELISA SDF-1α человека; RayBiotech, Norcross GA, USA). Анализ выполняли в соответствии с инструкциями поставщика.

Результаты

Как показано на фиг.33, постоянное содержание SDF-1 в плазме не подвергнутых никакому воздействию крыс находится на низком пикомолярном уровне (примерно 50 пМ). В отличие от этого содержание SDF-1 в плазме крыс, которым вводили шпигельмер 193-G2-012-5'-PEG, связывающий SDF-1 человека, было другим: в течение первых восьми часов после введения шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, уровень SDF-1 в плазме повышался примерно до 700 пМ. В период времени между 12 и 72 часами уровень SDF-1 в плазме понижался примерно до 50 пМ. Изменение уровня SDF-1 в плазме в указанный период времени можно прямо коррелировать с уровнем в плазме шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека. В результате почечной элиминации шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, уровень в плазме шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, снизился примерно с 1100 нМ до менее 50 нМ в течение 72 часов. Однако шпигельмер 193-G2-012-5'-PEG, связывающий SDF-1 человека, (молекулярная масса около 54000 Да) не был выведен из организма в течение одного часа по сравнению с PEG-немодифицированными шпигельмерами (примерно 15000 Да) или другими молекулами с молекулярной массой ниже фильтрационного предела почки, такими как SDF-1. Эндогенный SDF-1 был связан шпигельмером 193-G2-012-5'-PEG, связывающим SDF-1 человека, с образованием комплексов SDF-1 и шпигельмера, вследствие чего элиминация и/или разложение SDF-1 было замедлено, что вызывало повышенные уровни SDF-1 в плазме в течение первых восьми часов. В результате последующей элиминации шпигельмера 193-G2-012-5'-PEG, связывающего SDF-1 человека, которая происходит с гораздо меньшей скоростью по сравнению со многими более мелкими молекулами, такими как SDF-1, уровень в плазме комплексов, образованных шпигельмером 193-G2-012-5'-PEG, связывающим SDF-1 человека, и SDF-1, снижается (фиг.33).

Пример 1. Фармацевтическая композиция для лечения заболевания или нарушения, опосредованного SDF-1 и обусловленного повышенным количеством и/или активностью SDF-1

Композиция содержит 2 мл стерильного 200 мМ раствора глюкозы, содержащего шпигельмер 192-А10-001-5'-PEG40 с концентрацией 1 нМ.

Шпигельмер 192-А10-001-5'-ПЭГ40 представляет собой антагонист SDF-1 (см. Фигуру 25А) и является одной из молекул L-нуклеиновой кислоты, описанной в настоящей заявке. Упомянутый шпигельмер содержит 40 кДа фрагмент ПЭГ, присоединенный к 5' концу нуклеотидной последовательности. В материалах заявки шпигельмер обозначен последовательностью SEQ ID NO: 137.

Пример 2. Фармацевтическая композиция для лечения заболевания или нарушения, опосредованного SDF-1 и обусловленного повышенным количеством и/или активностью SDF-1

Композиция содержит 2 мл стерильного 200 мМ раствора глюкозы, содержащего шпигельмер 192-А10-001-5'-PEG30 с концентрацией 1 нМ.

Шпигельмер 192-А10-001-5'-PEG30 представляет собой антагонист SDF-1 (см. Фигуру 25А) и является одной из молекул L-нуклеиновой кислоты, описанной в настоящей заявке. Упомянутый шпигельмер содержит 30 кДа фрагмент ПЭГ, присоединенный к 5' концу нуклеотидной последовательности. В материалах заявки шпигельмер обозначен последовательностью SEQ ID NO: 139.

Пример 3. Фармацевтическая композиция для лечения заболевания или нарушения, опосредованного SDF-1 и обусловленного повышенным количеством и/или активностью SDF-1

Композиция содержит 2 мл стерильного 200 мМ раствора глюкозы, содержащего шпигельмер 193-G2-012-5'-ПЭГ40 с концентрацией 1 нМ.

Шпигельмер 193-G2-012-5'-ПЭГ40 представляет собой антагонист SDF-1 (см. Фигуру 23А) и является одной из молекул L-нуклеиновой кислоты, описанной в настоящей заявке. Упомянутый шпигельмер содержит 40 кДа фрагмент ПЭГ, присоединенный к 5' концу нуклеотидной последовательности. В материалах заявки шпигельмер обозначен последовательностью SEQ ID NO: 132.

Пример 4. Фармацевтическая композиция для лечения заболевания или нарушения, опосредованного SDF-1 и обусловленного повышенным количеством и/или активностью SDF-1

Композиция содержит 2 мл стерильного 200 мМ раствора глюкозы, содержащего шпигельмер 197-B2-006-5'-ПЭГ40 с концентрацией 1 нМ.

Шпигельмер 197-B2-006-5'-ПЭГ40 представляет собой антагонист SDF-1 (см. Фигуру 23А) и является одной из молекул L-нуклеиновой кислоты, описанной в настоящей заявке. Упомянутый шпигельмер содержит 40 кДа фрагмент ПЭГ, присоединенный к 5' концу нуклеотидной последовательности. В материалах заявки шпигельмер обозначен последовательностью SEQ ID NO: 135.

Пример 5. Фармацевтическая композиция для лечения заболевания или нарушения, опосредованного SDF-1 и обусловленного повышенным количеством и/или активностью SDF-1

Композиция содержит 2 мл стерильного 200 мМ раствора глюкозы, содержащего шпигельмер 191-D5-007-5'-ПЭГ40 с концентрацией 1 нМ.

Шпигельмер 191-D5-007-5'-ПЭГ40 представляет собой антагонист SDF-1 (см. Фигуру 23А) и является одной из молекул L-нуклеиновой кислоты, описанной в настоящей заявке. Упомянутый шпигельмер содержит 40 кДа фрагмент ПЭГ, присоединенный к 5' концу нуклеотидной последовательности. В материалах заявки шпигельмер обозначен последовательностью SEQ ID NO: 134.

Ссылки

Полные библиографические данные в документах, приведенных в настоящем описании изобретения, включены в настоящее описание изобретения в качестве ссылки за исключением особо оговоренных случаев.

Aiuti, A., I. J. Webb, et al. (1997). "The chemokine SDF-1 is a chemoattractant for human CD34+ hematopoietic progenitor cells and provides a new mechanism to explain the mobilization of CD34+ progenitors to peripheral blood." J Exp Med 185(1): 111-20.

Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ (1990), Basic local alignment search tool. J Mol Biol. 215(3):403-10.

Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ (1997). Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25(17):3389-402.

Ambati, J., A. Anand, et al. (2003). An animal model of age-related macular degeneration in senescent Ccl-2- or Ccr-2-deficient mice. Nat Med. 9: 1390-7.

Arya, S. K., C. C. Ginsberg, et al. (1999). "In vitro phenotype of SDF1 gene mutant that delays the onset of human immunodeficiency virus disease in vivo." J Hum Virol 2(3): 133-8.

Auerbach et al. (2003) Angiogenesis assays: a critical overview. Clin.Chem. 49: 32-40.

Baggiolini, M. (1998). "Chemokines and leukocyte traffic." Nature 392(6676): 565-8.

Baggiolini, M., B. Dewald, et al. (1994). "Interleukin-8 and related chemotactic cytokines--CXC and CC chemokines." Adv Immunol 55: 97-179.

Balabanian, K., B. Lagane, et al. (2005). "WHIM syndromes with different genetic anomalies are accounted for by impaired CXCR4 desensitization to CXCL12." Blood 105(6): 2449-57.

Balabanian, K., J. Couderc, et al. (2003). "Role of the chemokine stromal cell-derived factor 1 in autoantibody production and nephritis in мыши lupus." J Immunol 170(6): 3392-400.

Balkwill, F. (2004). "Cancer and the chemokine network." Nat Rev Cancer 4(7): 540-50.

Bazan, J. F., K. B. Bacon, et al. (1997). "A new class of membrane-bound chemokine with a CX3C motif." Nature 385(6617): 640-4.

Bertolini, F., C. Dell'Agnola, et al. (2002). "CXCR4 neutralization, a novel therapeutic approach for non-Hodgkin's lymphoma." Cancer Res 62(11): 3106-12.

Bleul, C. C., J. L. Schultze, et al. (1998). "B lymphocyte chemotaxis regulated in association with microanatomic localization, differentiation state, and B cell receptor engagement." J Exp Med 187(5): 753-62.

Bleul, C. C., M. Farzan, et al. (1996). "The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry." Nature 382(6594): 829-33.

Brooks, H. L., Jr., S. Caballero, Jr., et al. (2004). "Vitreous levels of vascular endothelial growth factor and stromal-derived factor 1 in patients with diabetic retinopathy and cystoid macular edema before and after intraocular injection of triamcinolone." Arch Ophthalmol 122(12): 1801-7.

Buckley, C. D., N. Amft, et al. (2000). "Persistent induction of the chemokine receptor CXCR4 by TGF-beta 1 on synovial T cells contributes to their accumulation within the rheumatoid synovium." J Immunol 165(6): 3423-9.

Burger, J. A., N. Tsukada, et al. (2000). "Blood-derived nurse-like cells protect chronic lymphocytic leukemia B cells from spontaneous apoptosis through stromal cell-derived factor-1." Blood 96(8): 2655-63.

Butler, J. M., S. M. Guthrie, et al. (2005). "SDF-1 is both necessary and sufficient to promote proliferative retinopathy." J Clin Invest 115(1): 86-93.

Cabioglu, N., A. Sahin, et al. (2005). "Chemokine receptor CXCR4 expression in breast cancer as a potential predictive marker of isolated tumor cells in bone marrow." Clin Exp Metastasis 22(1): 39-46.

Corcione, A., L. Ottonello, et al. (2000). "Stromal cell-derived factor-1 as a chemoattractant for follicular center lymphoma B cells." J Natl Cancer Inst 92(8): 628-35.

Crump, M. P., J. H. Gong, et al. (1997). "Solution structure and basis for functional activity of stromal cell-derived factor-1; dissociation of CXCR4 activation from binding and inhibition of HIV-1." Embo J 16(23): 6996-7007.

D'Apuzzo, M., A. Rolink, et al. (1997). "The chemokine SDF-1, stromal cell-derived factor 1, attracts early stage B cell precursors via the chemokine receptor CXCR4." Eur J Immunol 27(7): 1788-93.

De Klerck, B., L. Geboes, et al. (2005). "Pro-inflammatory properties of stromal cell-derived factor-1 (CXCL12) in collagen-induced arthritis." Arthritis Res Ther 7(6): R1208-20.

Drolet DW, Nelson J, Tucker CE, Zack PM, Nixon K, Bolin R, Judkins MB, Farmer JA, Wolf JL, Gill SC, Bendele RA (2000). Pharmacokinetics and safety of an anti-vascular endothelial growth factor aptamer (NX1838) following injection into the vitreous humor of rhesus monkeys. Pharm. Res. 17:1503.

Eaton, B. E., L. Gold, et al. (1997). "Post-SELEX combinatorial optimization of aptamers." Bioorg Med Chem 5(6): 1087-96.

Fedyk, E. R., D. Jones, et al. (2001). "Expression of stromal-derived factor-1 is decreased by IL-1 and TNF and in dermal wound healing." J Immunol 166(9): 5749-54.

Fong, D. S., L. P. Aiello, et al. (2004). "Diabetic retinopathy." Diabetes Care 27(10): 2540-53.

Geminder, H., O. Sagi-Assif, et al. (2001). "A possible role for CXCR4 and its ligand, the CXC chemokine stromal cell-derived factor-1, in the development of bone marrow metastases in neuroblastoma." J Immunol 167(8): 4747-57.

Godessart, N. (2005). "Chemokine receptors: attractive targets for drug discovery." Ann N Y Acad Sci 1051: 647-57.

Grassi, F., S. Cristino, et al. (2004). "CXCL12 chemokine up-regulates bone resorption and MMP-9 release by human osteoclasts: CXCL12 levels are increased in synovial and bone tissue of rheumatoid arthritis patients." J Cell Physiol 199(2): 244-51.

Grunewald, M., I. Avraham, et al. (2006). "VEGF-induced adult neovascularization: recruitment, retention, and role of accessory cells." Cell 124(1): 175-89.

Guleng, B., K. Tateishi, et al. (2005). "Blockade of the stromal cell-derived factor-1/CXCR4 axis attenuates in vivo tumor growth by inhibiting angiogenesis in a vascular endothelial growth factor-independent manner." Cancer Res 65(13): 5864-71.

Gulino, A. V., D. Moratto, et al. (2004). "Altered leukocyte response to CXCL12 in patients with warts hypogammaglobulinemia, infections, myelokathexis (WHIM) syndrome." Blood 104(2): 444-52.

Hartmann, T. N., M. Burger, et al. (2004). "The role of adhesion molecules and chemokine receptor CXCR4 (CD184) in small cell lung cancer." J Biol Regul Homeost Agents 18(2): 126-30.

Hwang, J. H., H. K. Chung, et al. (2003). "CXC chemokine receptor 4 expression and function in human anaplastic thyroid cancer cells." J Clin Endocrinol Metab 88(1): 408-16.

Jiang, W., P. Zhou, et al. (1994). "Molecular cloning of TPAR1, a gene whose expression is repressed by the tumor promoter 12-O-tetradecanoylphorbol 13-acetate (TPA)." Exp Cell Res 215(2): 284-93.

Jose, P. J., D. A. Griffiths-Johnson, et al. (1994). "Eotaxin: a potent eosinophil chemoattractant cytokine detected in a guinea pig model of allergic airways inflammation." J Exp Med 179(3): 881-7.

Juarez, J. and L. Bendall (2004). "SDF-1 and CXCR4 in normal and malignant hematopoiesis." Histol Histopathol 19(1): 299-309.

Kanbe, K., K. Takagishi, et al. (2002). "Stimulation of matrix metalloprotease 3 release from human chondrocytes by the interaction of stromal cell-derived factor 1 and CXC chemokine receptor 4." Arthritis Rheum 46(1): 130-7.

Kang, H., G. Watkins, et al. (2005). "Stromal cell derived factor-1: its influence on invasiveness and migration of breast cancer cells in vitro, and its association with prognosis and survival in human breast cancer." Breast Cancer Res 7(4): R402-10.

Kawai, T., U. Choi, et al. (2005). "Enhanced function with decreased internalization of carboxy-terminus truncated CXCR4 responsible for WHIM syndrome." Exp Hematol 33(4): 460-8.

Koshiba, T., R. Hosotani, et al. (2000). "Expression of stromal cell-derived factor 1 and CXCR4 ligand receptor system in pancreatic cancer: a possible role for tumor progression." Clin Cancer Res 6(9): 3530-5.

Krumbholz, M., D. Theil, et al. (2006). "Chemokines in multiple sclerosis: CXCL12 and CXCL13 up-regulation is differentially linked to CNS immune cell recruitment." Brain 129: 200-211.

Kryczek, I., A. Lange, et al. (2005). "CXCL12 and vascular endothelial growth factor synergistically induce neoangiogenesis in human ovarian cancers." Cancer Res 65(2): 465-72.

Kucia, M., R. Reca, et al. (2005). "Trafficking of normal stem cells and metastasis of cancer stem cells involve similar mechanisms: pivotal role of the SDF-1-CXCR4 axis." Stem Cells 23(7): 879-94.

Kusser, W. (2000). "Chemically modified nucleic acid aptamers for in vitro selections: evolving evolution." J Biotechnol 74(1): 27-38.

Lapteva, N., A. G. Yang, et al. (2005). "CXCR4 knockdown by small interfering RNA abrogates breast tumor growth in vivo." Cancer Gene Ther 12(1): 84-9.

M.J. Damha, K.K. Ogilvie, Methods in Molecular Biology, Vol. 20 Protocols for oligonucleotides and analogs, ed. S. Agrawal, p. 81-114, Humana Press Inc. 1993.

Ma, Q., D. Jones, et al. (1998). "Impaired B-lymphopoiesis, myelopoiesis, and derailed cerebellar neuron migration in CXCR4- and SDF-1-deficient mice." Proc Natl Acad Sci U S A 95(16): 9448-53.

Marechal, V., F. Arenzana-Seisdedos, et al. (1999). "Opposite effects of SDF-1 on human immunodeficiency virus type 1 replication." J Virol 73(5): 3608-15.

Matthys, P., S. Hatse, et al. (2001). "AMD3100, a potent and specific antagonist of the stromal cell-derived factor-1 chemokine receptor CXCR4, inhibits autoimmune joint inflammation in IFN-gamma receptor-deficient mice." J Immunol 167(8): 4686-92.

McGinnis S, Madden TL (2004). BLAST: at the core of a powerful and diverse set of sequence analysis tools. Nucleic Acids Res. 32(Web Server issue):W20-5.

Meleth, A. D., E. Agron, et al. (2005). "Serum inflammatory markers in diabetic retinopathy." Invest Ophthalmol Vis Sci 46(11): 4295-301.

Menu, E., K. Asosingh, et al. (2006). "The involvement of stromal derived factor 1alpha in homing and progression of multiple myeloma in the 5TMM model." Haematologica.

Miller, M. D. and M. S. Krangel (1992). "Biology and biochemistry of the chemokines: a family of chemotactic and inflammatory cytokines." Crit Rev Immunol 12(1-2): 17-46.

Moser, B., M. Wolf, et al. (2004). "Chemokines: multiple levels of leukocyte migration control." Trends Immunol 25(2): 75-84.

Muller, A., B. Homey, et al. (2001). "Involvement of chemokine receptors in breast cancer metastasis." Nature 410(6824): 50-6.

Murdoch, C. (2000). "CXCR4: chemokine receptor extraordinaire." Immunol Rev 177: 175-84.

Murphy, P. M., M. Baggiolini, et al. (2000). "International union of pharmacology. XXII. Nomenclature for chemokine receptors." Pharmacol Rev 52(1): 145-76.

Nagasawa, T., H. Kikutani, et al. (1994). "Molecular cloning and structure of a pre-B-cell growth-stimulating factor." Proc Natl Acad Sci U S A 91(6): 2305-9.

Nagasawa, T., S. Hirota, et al. (1996). "Defects of B-cell lymphopoiesis and bone-marrow myelopoiesis in mice lacking the CXC chemokine PBSF/SDF-1." Nature 382(6592): 635-8.

Needleman & Wunsch (1970), A general method applicable to the search for similarities in the amino acid sequence of two proteins. J Mol Biol. 48(3):443-53.

Oppenheim, J. J., C. O. Zachariae, et al. (1991). "Properties of the novel proinflammatory supergene "intercrine" cytokine family." Annu Rev Immunol 9: 617-48.

Orimo, A., P. B. Gupta, et al. (2005). "Stromal fibroblasts present in invasive human breast carcinomas promote tumor growth and angiogenesis through elevated SDF-1/CXCL12 secretion." Cell 121(3): 335-48.

Pearson & Lipman (1988), Improved tools for biological sequence comparison. Proc. Nat'l. Acad. Sci. USA 85: 2444

Perissinotto, E., G. Cavalloni, et al. (2005). "Involvement of chemokine receptor 4/stromal cell-derived factor 1 system during osteosarcoma tumor progression." Clin Cancer Res 11(2 Pt 1): 490-7.

Phillips, R. J., M. D. Burdick, et al. (2003). "The stromal derived factor-1/CXCL12-CXC chemokine receptor 4 biological axis in non-small cell lung cancer metastases." Am J Respir Crit Care Med 167(12): 1676-86.

Ponath, P. D., S. Qin, et al. (1996). "Cloning of the human eosinophil chemoattractant, eotaxin. Expression, receptor binding, and functional properties suggest a mechanism for the selective recruitment of eosinophils." J Clin Invest 97(3): 604-12.

Rubin, J. B., A. L. Kung, et al. (2003). "A small-molecule antagonist of CXCR4 inhibits intracranial growth of primary brain tumors." Proc Natl Acad Sci U S A 100(23): 13513-8.

Salcedo et al. (1999) Vascular endothelial growth factor and basic fibroblast growth factor induce expression of CXCR4 on human endothelial cells. In vivo neovascularization induced by stromal-derived factor-1a. Am.J.Pathol. 154:1125-1135.

Salcedo, R. and J. J. Oppenheim (2003). "Role of chemokines in angiogenesis: CXCL12/SDF-1 and CXCR4 interaction, a key regulator of endothelial cell responses." Microcirculation 10(3-4): 359-70.

Salcedo, R., K. Wasserman, et al. (1999). "Vascular endothelial growth factor and basic fibroblast growth factor induce expression of CXCR4 on human endothelial cells: In vivo neovascularization induced by stromal-derived factor-1alpha." Am J Pathol 154(4): 1125-35.

Salvucci, O., L. Yao, et al. (2002). "Regulation of endothelial cell branching morphogenesis by endogenous chemokine stromal-derived factor-1." Blood 99(8): 2703-11.

Saur, D., B. Seidler, et al. (2005). "CXCR4 expression increases liver and lung metastasis in a mouse model of pancreatic cancer." Gastroenterology 129(4): 1237-50.

Schall, T. J. and K. B. Bacon (1994). "Chemokines, leukocyte trafficking, and inflammation." Curr Opin Immunol 6(6): 865-73.

Scotton, C. J., J. L. Wilson, et al. (2002). "Multiple actions of the chemokine CXCL12 on epithelial tumor cells in human ovarian cancer." Cancer Res 62(20): 5930-8.

Sengupta, N., S. Caballero, et al. (2005). "Preventing stem cell incorporation into choroidal neovascularization by targeting homing and attachment factors." Invest Ophthalmol Vis Sci 46(1): 343-8.

Shirozu, M., T. Nakano, et al. (1995). "Structure and chromosomal localization of the human stromal cell-derived factor 1 (SDF1) gene." Genomics 28(3): 495-500.

Smith & Waterman (1981), Adv. Appl. Math. 2: 482

Soriano, A., C. Martinez, et al. (2002). "Plasma stromal cell-derived factor (SDF)-1 levels, SDF1-3'A genotype, and expression of CXCR4 on T lymphocytes: their impact on resistance to human immunodeficiency virus type 1 infection and its progression." J Infect Dis 186(7): 922-31.

Springer, T. A. (1995). "Traffic signals on endothelium for lymphocyte recirculation and leukocyte emigration." Annu Rev Physiol 57: 827-72.

Sun, Y. X., A. Schneider, et al. (2005). "Skeletal localization and neutralization of the SDF-1(CXCL12)/CXCR4 axis blocks prostate cancer metastasis and growth in osseous sites in vivo." J Bone Miner Res 20(2): 318-29.

Takenaga, M., H. Tamamura, et al. (2004). "A single treatment with microcapsules containing a CXCR4 antagonist suppresses pulmonary metastasis of мыши melanoma." Biochem Biophys Res Commun 320(1): 226-32.

Tamamura, H., M. Fujisawa, et al. (2004). "Identification of a CXCR4 antagonist, a T140 analog, as an anti-rheumatoid arthritis agent." FEBS Lett 569(1-3): 99-104.

Tashiro, K., H. Tada, et al. (1993). "Signal sequence trap: a cloning strategy for secreted proteins and type I membrane proteins." Science 261(5121): 600-3.

Venkatesan, N., S. J. Kim, et al. (2003). "Novel phosphoramidite building blocks in synthesis and applications toward modified oligonucleotides." Curr Med Chem 10(19): 1973-91.

Wang, J., E. Guan, et al. (2001). "Role of tyrosine phosphorylation in ligand-independent sequestration of CXCR4 in human primary monocytes-macrophages." J Biol Chem 276(52): 49236-43.

Wang, N., Q. L. Wu, et al. (2005). "Expression of chemokine receptor CXCR4 in nasopharyngeal carcinoma: pattern of expression and correlation with clinical outcome." J Transl Med 3: 26.

Wincott F, DiRenzo A, Shaffer C, Grimm S, Tracz D, Workman C, Sweedler D, Gonzalez C, Scaringe S, Usman N (1995). Synthesis, deprotection, analysis and purification of RNA and ribozymes. Nucleic Acids Res. 23(14):2677-84

Yamaguchi, J., K. F. Kusano, et al. (2003). "Stromal cell-derived factor-1 effects on ex vivo expanded endothelial progenitor cell recruitment for ischemic neovascularization." Circulation 107(9): 1322-8.

Yasumoto, K., K. Koizumi, et al. (2006). "Role of the CXCL12/CXCR4 axis in peritoneal carcinomatosis of gastric cancer." Cancer Res 66(4): 2181-7.

Zeelenberg, I. S., L. Ruuls-Van Stalle, et al. (2001). "Retention of CXCR4 in the endoplasmic reticulum blocks dissemination of a T cell hybridoma." J Clin Invest 108(2): 269-77.

Zeelenberg, I. S., L. Ruuls-Van Stalle, et al. (2003). "The chemokine receptor CXCR4 is required for outgrowth of colon carcinoma micrometastases." Cancer Res 63(13): 3833-9.

Zhou, Y., P. H. Larsen, et al. (2002). "CXCR4 is a major chemokine receptor on glioma cells and mediates their survival." J Biol Chem 277(51): 49481-7.

Zou, Y. R., A. H. Kottmann, et al. (1998). "Function of the chemokine receptor CXCR4 in haematopoiesis and in cerebellar development." Nature 393(6685): 595-9.

Отличительные признаки настоящего изобретения, рассмотренные в настоящем описании изобретения, формуле изобретения и/или на чертежах, могут отдельно и в любой комбинации представлять собой материал, необходимый для осуществления настоящего изобретения в разных формах.

1. Молекула нуклеиновой кислоты, связывающаяся с SDF-1, выбираемая из группы, включающей молекулу нуклеиновой кислоты типа А, молекулу нуклеиновой кислоты типа В, молекулу нуклеиновой кислоты типа С и молекулы нуклеиновых кислот, имеющие последовательность нуклеиновой кислоты, соответствующую любой из последовательностей SEQ ID NO: 142, SEQ ID NO: 143 и SEQ ID NO: 144, где молекула нуклеиновой кислоты типа А содержит следующую центральную нуклеотидную последовательность:
5′AAAGYRACAHGUMAAXAUGAAAGGUARC3′ (SEQ ID NO: 19),
где XA или отсутствует, или означает А, и где молекула нуклеиновой кислоты типа А содержит в направлении 5′→3′ первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов, или молекула нуклеиновой кислоты типа А содержит в направлении 5′→3′ второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов, где указанный первый и указанный второй фрагмент нуклеотидов имеют достаточную для гибридизации друг с другом степень обратной комплементарности, где при гибридизации образуется двунитевая структура, и где двунитевая структура состоит из 4-6 пар оснований;
где молекула нуклеиновой кислоты типа В содержит следующую центральную нуклеотидную последовательность: 5′GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG3′ (SEQ ID NO: 57),
где молекула нуклеиновой кислоты типа В содержит в направлении 5′→3′ первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов, или молекула нуклеиновой кислоты типа В содержит в направлении 5′→3′ второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов, где указанный первый и указанный второй фрагмент нуклеотидов имеют достаточную для гибридизации друг с другом степень обратной комплементарности, где при гибридизации образуется двунитевая структура, и где двунитевая структура состоит из 4-6 пар оснований;
где молекула нуклеиновой кислоты типа С содержит центральную нуклеотидную последовательность GGUYAGGGCUHRXAAGUCGG (SEQ ID NO: 90),
где XA или отсутствует, или означает А,
где молекула нуклеиновой кислоты типа С содержит в направлении 5′→3′ первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов, или молекула нуклеиновой кислоты типа С содержит в направлении 5′→3′ второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов, где длина первого фрагмента и длина второго фрагмента индивидуально и независимо равны 0-17 нуклеотидам, и где при гибридизации образуется двунитевая структура, и где двунитевая структура состоит из 4-10 пар оснований.

2. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты типа А содержит центральную нуклеотидную последовательность, выбираемую из группы, включающей:
5′AAAGYRACAHGUMAAUGAAAGGUARC3′ (SEQ ID NO: 20),
5′AAAGYRACAHGUMAAAUGAAAGGUARC3′ (SEQ ID NO: 21) и
5′AAAGYAACAHGUCAAUGAAAGGUARC3′ (SEQ ID NO: 22),
и, предпочтительно, центральная нуклеотидная последовательность включает 5′AAAGYAACAHGUCAAUGAAAGGUARC3′ (SEQ ID NO: 22).

3. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа А, и двунитевая структура состоит из пяти пар оснований.

4. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа А, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′X1X2NNBV3′ (SEQ ID NO: 44), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′BNBNX3X43′ (SEQ ID NO: 45),
где Х1 или отсутствует, или означает R, Х2 означает S, Х3 означает S, и Х4 или отсутствует, или означает Y; либо
Х1 отсутствует, Х2 или отсутствует, или означает S, Х3 или отсутствует, или означает S, и Х4 отсутствует.

5. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа А, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′X2BBBS3′ (SEQ ID NO: 42), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′SBBVX33′ (SEQ ID NO: 43),
где X2 или отсутствует, или означает S, и Х3 или отсутствует, или означает S;
где, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′CUGUG3′, и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′CGCAG3′; либо первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′GCGUG3′, и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′CGCGC3′.

6. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа А, и молекула нуклеиновой кислоты имеет последовательность нуклеиновой кислоты, соответствующую любой из последовательностей SEQ ID NO: 5-18, 25-41, 133, 137, 139-141.

7. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновых кислот типа В содержит центральную нуклеотидную последовательность GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG (SEQ ID NO: 58).

8. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа В, и двунитевая структура состоит из пяти пар оснований.

9. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа В, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′X1X2SVNS3′ (SEQ ID NO: 77), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′BVBSX3X43′ (SEQ ID NO: 78), где
X1 или отсутствует, или означает А, Х2 означает G, Х3 означает С, и Х4 или отсутствует, или означает U; либо
Х1 отсутствует, Х2 или отсутствует, или означает G, Х3 или отсутствует, или означает С, и Х4 отсутствует.

10. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа В, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′X2SSBS3′ (SEQ ID NO: 73), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′BVSSX33′ (SEQ ID NO: 74),
где Х2 или отсутствует, или означает G, и Х3 или отсутствует, или означает С,
где, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′GCGUG3′, и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′UACGC3′.

11. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа В, и молекула нуклеиновой кислоты имеет последовательность нуклеиновой кислоты, соответствующую любой из последовательностей SEQ ID NO: 46-56, 61-72 и 132.

12. Молекула нуклеиновой кислоты по п.1, где молекулы нуклеиновых кислот типа С содержат центральную нуклеотидную последовательность, выбираемую из группы, включающей:
5′GGUYAGGGCUHRAAGUCGG3′ (SEQ ID NO: 91),
5′GGUYAGGGCUHRAGUCGG3′ (SEQ ID NO: 92) и
5′GGUUAGGGCUHGAAGUCGG3′ (SEQ ID NO: 93),
где, предпочтительно, центральная нуклеотидная последовательность включает 5′GGUUAGGGCUHGAAGUCGG3′ (SEQ ID NO: 93).

13. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и длина первого фрагмента и длина второго фрагмента индивидуально и независимо равны 4-10 нуклеотидам и, предпочтительно, 4-6 нуклеотидам.

14. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и двунитевая структура включает 4-6 пар оснований, предпочтительно, 5 пар оснований.

15. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′RKSBUSNVGR3′ (SEQ ID NO: 120), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′YYNRCASSMY3′ (SEQ ID NO: 121),
где, предпочтительно, первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′RKSBUGSVGR3′ (SEQ ID NO: 122), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′YCNRCASSMY3′ (SEQ ID NO: 123).

16. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′XSSSSV3′ (SEQ ID NO: 124), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′BSSSXS3′ (SEQ ID NO: 125), где XS или отсутствует, или означает S.

17. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′SSSSR3′ (SEQ ID NO: 130), и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′YSBSS3′ (SEQ ID NO: 131).

18. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′CGUGCGCUUGAGAUAGG3′, и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′CUGAUUCUCACG3′.

19. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′UGAGAUAGG3′, и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′CUGAUUCUCA3′.

20. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и первый фрагмент нуклеотидов включает нуклеотидную последовательность 5′GAGAUAGG3′, и второй фрагмент нуклеотидов включает нуклеотидную последовательность 5′CUGAUUCUC3′.

21. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты типа С, и молекула нуклеиновой кислоты имеет последовательность нуклеиновой кислоты, соответствующую любой из последовательностей SEQ ID NO: 79-89, 94-119 и 134-136.

22. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты имеет последовательность нуклеиновой кислоты, соответствующую любой из последовательностей SEQ ID NO: 142-144.

23. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты является антагонистом системы рецепторов SDF-1, где, предпочтительно, рецептор SDF-1 системы рецепторов SDF-1 является рецептором CXCR4.

24. Молекула нуклеиновой кислоты по п.1, где SDF-1 является SDF-1 человека, где, предпочтительно, SDF-1 включает аминокислотную последовательность, соответствующую последовательности SEQ ID NO: 1.

25. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты включает модификацию, предпочтительно модификация выбрана из группы, включающей часть HES и часть PEG.

26. Молекула нуклеиновой кислоты по п.1, в которой нуклеотиды молекулы нуклеиновой кислоты являются L-нуклеотидами, предпочтительно нуклеотидами последовательностей, соответствующих любой из последовательностей SEQ ID NO: 19, 20, 21, 22, 57, 58, 90, 91, 92 и 93.

27. Молекула нуклеиновой кислоты по п.1 для применения в способе лечения заболевания.

28. Молекула нуклеиновой кислоты, являющаяся антагонистом SDF-1, способным ингибировать хемотаксис, индуцируемый SDF-1, и связывающаяся с SDF-1, выбираемая из группы, включающей молекулу нуклеиновой кислоты типа А, молекулу нуклеиновой кислоты типа В, молекулу нуклеиновой кислоты типа С и молекулы нуклеиновых кислот, имеющие последовательность нуклеиновой кислоты, соответствующую любой из последовательностей SEQ ID NO: 142, SEQ ID NO: 143 и SEQ ID NO: 144, где молекула нуклеиновой кислоты типа А содержит следующую центральную нуклеотидную последовательность:
5′AAAGYRACAHGUMAAXaUGAAAGGUARC3′ (SEQ ID NO: 19),
где ХА или отсутствует, или означает А, и где молекула нуклеиновой кислоты типа А содержит в направлении 5′→3′ первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов, или молекула нуклеиновой кислоты типа А содержит в направлении 5′→3′ второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов, где указанный первый и указанный второй фрагмент нуклеотидов имеют достаточную для гибридизации друг с другом степень обратной комплементарности, где при гибридизации образуется двунитевая структура, и где двунитевая структура состоит из 4-6 пар оснований;
где молекула нуклеиновой кислоты типа В содержит следующую центральную нуклеотидную последовательность: 5′GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG3′ (SEQ ID NO: 57),
где молекула нуклеиновой кислоты типа В содержит в направлении 5′→3′ первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов, или молекула нуклеиновой кислоты типа В содержит в направлении 5′→3′ второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов, где указанный первый и указанный второй фрагмент нуклеотидов имеют достаточную для гибридизации друг с другом степень обратной комплементарности, где при гибридизации образуется двунитевая структура, и где двунитевая структура состоит из 4-6 пар оснований;
где молекула нуклеиновой кислоты типа С содержит центральную нуклеотидную последовательность GGUYAGGGCUHRXAAGUCGG (SEQ ID NO: 90),
где XA или отсутствует, или означает А,
где молекула нуклеиновой кислоты типа С содержит в направлении 5′→3′ первый фрагмент нуклеотидов, центральную нуклеотидную последовательность и второй фрагмент нуклеотидов, или молекула нуклеиновой кислоты типа С содержит в направлении 5′→3′ второй фрагмент нуклеотидов, центральную нуклеотидную последовательность и первый фрагмент нуклеотидов, где длина первого фрагмента и длина второго фрагмента индивидуально и независимо равны 0-17 нуклеотидам, и где при гибридизации образуется двунитевая структура, и где двунитевая структура состоит из 4-10 пар оснований.

29. Фармацевтическая композиция, содержащая эффективное количество молекулы нуклеиновой кислоты по п.28 и дополнительный компонент, выбранный из группы, включающей фармацевтически приемлемые эксципиенты и фармацевтически активные агенты, где фармацевтическая композиция предназначена для лечения заболевания или нарушения, где такое заболевание или нарушение опосредовано SDF-1 и обусловлено повышенным количеством и/или активностью SDF-1.

30. Фармацевтическая композиция по п.29, где заболевание или нарушение выбирают из группы, состоящей из заболевания глазного дна, такого как диабетическая ретинопатия и возрастная дегенерация желтого пятна; рака молочной железы, яичника, предстательной железы, поджелудочной железы, щитовидной железы, носоглотки, ободочной кишки, легкого и желудка; остеосаркомы; меланомы; глиомы; медулло- и нейробластомы; лейкоза; синдрома WHIM; синдромов иммунологической недостаточности; патологической неоваскуляризации; воспаления; рассеянного склероза; ревматоидного артрита/остеоартрита и нефрита.

31. Применение молекулы нуклеиновой кислоты по п.28 для приготовления лекарственного средства для лечения и/или профилактики заболевания или нарушения, где заболевание или нарушение опосредовано SDF-1 и обусловлено повышенным количеством и/или активностью SDF-1.

32. Применение по п.31, где заболевание или нарушение выбрано из группы, включающей заболевания глазного дна, такие как диабетическая ретинопатия и возрастная дегенерация желтого пятна; рак молочной железы, яичника, предстательной железы, поджелудочной железы, щитовидной железы, носоглотки, ободочной кишки, легкого и желудка; остеосаркому; меланому; глиому; медуллобластому и нейробластому; лейкоз; синдром WHIM; синдромы иммунологической недостаточности; патологическую неоваскуляризацию; воспаление; рассеянный склероз; ревматоидный артрит/остеоартрит и нефрит.

33. Применение по п.31, где лекарственное средство предназначено для ингибирования ангиогенеза, неоваскуляризации, воспаления и метастазирования.

34. Применение молекулы нуклеиновой кислоты по п.1 для приготовления диагностического реагента для диагностики заболевания, где заболевание опосредовано SDF-1 и обусловлено повышенным количеством и/или активностью SDF-1, где диагностический реагент включает указанную молекулу нуклеиновой кислоты.

35. Применение по п.34, в котором заболевание выбрано из группы, включающей заболевания глазного дна, такие как диабетическая ретинопатия и возрастная дегенерация желтого пятна; рак молочной железы, яичника, предстательной железы, поджелудочной железы, щитовидной железы, носоглотки, ободочной кишки, легкого и желудка; остеосаркому; меланому; глиому; медуллобластому и нейробластому; лейкоз; синдром WHIM; синдромы иммунологической недостаточности; патологическую неоваскуляризацию; воспаление; рассеянный склероз; ревматоидный артрит/остеоартрит и нефрит.

36. Применение по п.34, где диагностический реагент предназначен для диагностики ангиогенеза, неоваскуляризации, воспаления и/или метастазирования.

37. Молекула нуклеиновой кислоты по п.1, где молекула нуклеиновой кислоты может образовывать с SDF-l комплекс, где указанный комплекс предпочтительно является кристаллическим комплексом.

38. Набор для обнаружения SDF-1, включающий молекулу нуклеиновой кислоты по п.1 и один или более буферов, где молекула нуклеиновой кислоты содержит детектируемую метку.



 

Похожие патенты:

Изобретение относится к области биотехнологии и вирусологии. Описаны способ прогнозирования раннего снижения вирусной нагрузки у человека, инфицированного вирусом гепатита С (ВГС), в ответ на лечение без применения интерферона, способ выбора длительности лечения без интерферона и способ прогнозирования ответа человека, инфицированного ВГС, на лечение без применения интерферона.

Предложенная группа изобретений относится к области медицины. Предложены способ, машиночитаемый носитель и система для определения генетической аномалии плода, которая представляет собой анеуплоидию.

Группа изобретений относится к области биотехнологии, в частности к детекции нуклеиновокислотной последовательности-мишени в анализе с РОСН (расщеплением и гибридизацией РО) на твердой подложке.

Изобретение относится к биотехнологии и молекулярной генетике. Описан способ определения нуклеотидной последовательности (сайта) 5'-R(5mC)GY-3'/3'-YG(5mC)R-5' в заданном положении протяженной ДНК.

Изобретение относится к биохимии. Описан способ ПЦР-секвенирования, включающий следующие стадии: получение образца; амплификация; смешивание; фрагментация; секвенирование и сплайсинг.

Изобретение относится к области медицины, в частности к онкологии и молекулярной биологии, и предназначено для диагностики плоскоклеточного рака легкого (ПКРЛ). Осуществляют получение исходной пары образцов ткани от пациента, где один из образцов получен из предположительно пораженной раком ткани, а второй - из прилегающей гистологически нормальной ткани, выделение и очистку препаратов РНК, синтез кДНК на матрице РНК, амплификацию фрагмента гена CALL и сравнение количества амплифицированного фрагмента ДНК CALL для образца, полученного из предположительно пораженной раком ткани, с количеством амплифицированного фрагмента ДНК для образца, полученного из нормальной ткани.
Изобретение относится к области биотехнологии и предназначено для неинвазивной диагностики колоректального рака. Осуществляют забор и транспортировку образцов стула пациента, выделение из стула пациента общей ДНК и определение целостности ДНК методом ПЦР-анализа.

Группа изобретений относится к области молекулярной биологии и генодиагностики, а именно к синтетическим праймерам, комплементарным высококонсервативной области гена N генома вируса эпизоотической диареи свиней (ЭДС) и способу выявления ЭДС.

Изобретения относятся к области биотехнологии и касаются набора синтетических олигонуклеотидных праймеров и способа его использования. Представленный набор включает две пары праймеров, имеющих следующую структуру - FIV F: 5′-AAGAGTCCCAAATATGCCATAGG-3′ и FIV R: 5′-TCCATCCAAATTGCTACTGTTC-3′; FeLV F: 5′-GAATAAACCTCTTGCTGTTTGC-3′ и FeLV R: 5′-AATCAGATCGAATGACAGAGACAC-3′.

Изобретение относится к биотехнологии и молекулярной генетике. Способ предусматривает картирование положений ряда метилированных нуклеотидных последовательностей Pu(5mC)GPy в протяженной ДНК для построения эпигенетического профиля и выявления аномально метилированных участков ДНК.

Изобретение относится к области биотехнологии, в частности к рекомбинантной плазмидной ДНК, созданной при помощи новых праймеров CTTCCATATGGAACGAAGGCGTTTGTG и TGTGGATCCAGCTAGTTAGGCATGAAA. Указанная рекомбинантная плазмидная ДНК используется для получения рекомбинантного белка PRAME-F, состоящего из пептида MGSSHHHHHHSSGLVPRGSH слитого с последовательностью природного белка PRAME, путём её экспрессии в бактериальных клетках.

Изобретение относится к биохимии. Описаны антисмысловые олигонуклеотиды, которые увеличивают экспрессию указанного гена альфа-субъединицы потенциалзависимого натриевого канала (SCNA) in vivo или in vitro по сравнению с нормальным контролем.

Настоящее изобретение относится к области биотехнологии, конкретно к получению иммуностимулирующих олигодезоксинуклеотидов общей формулы 5′[G]х{[Т]pTTCGTC [Т]q}n[G]z 3′, где х = 3-10, z = 0-10, n = 2-100, p = 1-15, и может быть использовано в ветеринарии.

Изобретение относится к области биохимии, в частности к трансгенному растению березы вида Betula pendula, обладающему устойчивостью к действию гербицидов на основе фосфинотрицина по сравнению с аналогом дикого типа, а также к способу его получения.

Изобретение относится к области биотехнологии, конкретно к получению антагомиров микроРНК, и может быть использовано в медицине для лечения сосудистого заболевания, выбранного из группы, включающей периферическое сосудистое окклюзионное заболевание, коронарную болезнь сердца, цереброваскулярное заболевание, васкулит, атеросклероз, ремоделирование сосудов в ответ на повреждение или рестеноз.

Изобретение относится к области биотехнологии, конкретно к способу лечения метаболического расстройства у субъекта путем введения средств, которые модулируют активность и экспрессию микроРНК, и может быть использовано в медицине.

Изобретение относится к области молекулярной биологии и диагностической медицины. Предложен способ выделения микроРНК из биологических жидкостей.

Изобретение относится к антисмысловому олигонуклеотиду, представляющему собой фосфотиоатный аналог длиной от 19 до 30 нуклеотидов, который представляет собой соединение, гибридизующееся с природным антисмысловым полинуклеотидом гена Атонального гомолога 1 (АТОН1) и увеличивает экспрессию указанного гена АТОН1 in vivo или in vitro по сравнению с нормальным контролем.

Группа изобретений относится к области биотехнологии. Двухцепочечный олигорибонуклеотид содержит последовательность антисмысловой цепи SEQ ID NO: 28: 5′ AGUAGUUUCCAUAGGUCUG 3′ и последовательность смысловой цепи SEQ ID NO: 5: 5′ CAGACCUAUGGAAACUACU 3′.

Настоящее изобретение относится к иммуностимулирующим олигодезоксинуклеотидам общей формулы: где х = 3-20, z = 0-10, n = 2-100, и может быть использовано в медицине, конкретно в ветеринарии.

Настоящие изобретения относятся к области ветеринарии и касаются иммуногенной композиции (варианты) и применения пептида рибосомального белка Р0 эктопаразитов. Охарактеризованная иммуногенная композиция содержит пептид рибосомального белка Р0 экстопаразитов, либо нуклеиновую кислоту, кодирующую такой полипептид.
Наверх