Радиоактивно меченые пептиды, связывающиеся с her2



Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2
Радиоактивно меченые пептиды, связывающиеся с her2

 

C07K1/13 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2592685:

АФФИБОДИ АБ (SE)
Дженерал Электрик Компани (US)

Настоящее изобретение относится к области биотехнологии, конкретно к применению полипептида, меченного радиоактивной меткой 99mTс, для визуализации экспрессии рецептора человеческого эпидермального фактора роста 2 типа (HER2), и может быть использовано в диагностике опухолевых заболеваний. Изобретение позволяет получить специфически связывающийся с HER2 полипептид, конъюгированный с радионуклидом и хелатообразующим агентом, причем введение радиоактивной группировки осуществляется на конечной стадии синтеза конъюгата, что обеспечивает более высокие выходы целевого продукта. 3 н. и 2 з.п. ф-лы, 22 ил., 10 табл., 1 пр.

 

Настоящая заявка на изобретение содержит перечень последовательностей, который размещен в формате ASCII при помощи EFS-Web и включен здесь посредством ссылки во всей его полноте. Указанная копия ASCII, созданная 13 декабря 2010 года, названа 2355971. txt и имеет размер 4957 байт.

Область изобретения

Изобретение в общем относится к визуализирующим агентам, которые связываются с рецептором человеческого эпидермального фактора роста 2 типа (HER2), и способам получения и применения таких агентов.

Предшествующий уровень техники

Рецептор человеческого эпидермального фактора роста 2 типа (HER2) представляет собой трансмембранный белок и члена семейства erbB белков-рецепторов тирозинкиназы. HER2 представляет собой общепризнанный опухолевый биомаркер, который сверхэкспрессируется при обширном разнообразии видов рака, включающих рак молочной железы, яичников, легкого, желудка и полости рта. Таким образом, HER2 обладает большой ценностью в качестве молекулярной мишени и в качестве диагностического или прогностического показателя выживания пациента, или в качестве прогностического показателя ответа на противоопухолевую хирургию.

В течение прошедшего десятилетия широко исследовали неинвазивную молекулярную визуализацию экспрессии HER2 с использованием различных способов визуализации. Эти способы включают радионуклидную визуализацию посредством позитронно-эмиссионной томографии (PET) и однофотонной эмиссионной компьютерной томографии (SPECT). Визуализация HER2 при помощи PET и SPECT (HER2-PET и HER2-SPECT соответственно) обеспечивают высокую чувствительность, высокое пространственное разрешение. Визуализация HER2 посредством PET также обеспечивает высокую способность к количественному определению. HER2-PET и HER2-SPECT особенно полезны в анализах общей экспрессии HER2 в опухоли у пациентов в режиме реального времени, идентификации экспрессии HER2 в опухолях с течением времени, отбора пациентов для лечения, направленного на HER (например, терапия, основанная на трастузумабе), для предсказания ответа на терапию, оценки эффективности лекарства и множества других применений. Тем не менее, не разработано никаких лигандов HER2, меченные для PET или SPECT, которые обладали бы химизмом и демонстрировали бы поведение in vivo, которое подходило бы для клинических приложений.

Встречающийся в природе стафилококковый белок А содержит домены, которые формируют трехспиральную структуру (каркас), которая связывается с фрагментом, кристаллизуемой областью (Fc) иммуноглобулина изотипа G (IgG). Некоторые полипептиды, происходящие из Z-домена белка А, содержат каркас, состоящий из трех α-спиралей, связанных петлями. Некоторые аминокислотные остатки, расположенные на двух из этих спиралей, составляют сайт связывания для области Fc в IgG. Альтернативные связывающие молекулы получают путем замены находящихся на поверхности аминокислотных остатков (13 остатков), расположенных на спиралях 1 и 2, для изменения связывающей способности этих молекул. Один из таких примеров представляет собой молекулы, связывающиеся с HER2, или связующие элементы HER2. Эти связующие элементы HER2 были помечены при помощи радионуклидов, активных для PET или SPECT. Такие связующие элементы, меченные для PET и SPECT, обеспечивают способность измерения картин экспрессии HER2 in vivo у пациентов, и, таким образом, помогают клиницистам и исследователям диагностировать, прогнозировать и лечить ассоциированные с HER2 болезненные состояния.

Связывающиеся с HER2 молекулы аффител, радиоактивно меченные радионуклидом, активным для PET, 18F, оценивали в качестве визуализирующих агентов для злокачественных опухолей, которые сверхэкспрессируют HER2. Связывающиеся с HER2 молекулы аффител, конъюгированные с 99mTc через хелатообразующие агенты, такие как maGGG (меркаптоацетилтриглицил), CGG (цистеин-диглицил), CGGG (SEQ ID No: 6) (цистеин-триглицил) или АА3, также используются для диагностической визуализации. Связывание этих молекул с опухолями-мишенями, экспрессирующими HER2, продемонстрировано у мышей.

В большинстве случаев генерирующую сигнал группу 18F связывают с аффителом посредством тиольной реакционноспособной малеимидной группы. Тиольную реакционноспособную малеимидную группу получают с использованием многостадийного синтеза после включения 18F. Однако эта химия обеспечивает лишь низкий радиохимический выход. Аналогично, конъюгация 99mTc с аффителом представляет собой многостадийный процесс с низким выходом. Кроме того, восстановление Tc и образование комплекса с хелатами требует условий с высоким рН (например, рН 11) и продолжительного времени реакций.

Хотя эффективность 18F меченных молекул аффител in vivo является умеренно хорошей, существуют значительные возможности для ее улучшения. Например, в некоторых исследованиях обнаружено, что поглощение в опухоли составляет только 6,36±1,26% ИД/г (инъецированная доза/г ткани) через 2 часа после инъекции визуализирующего агента. С другой стороны, меченные 99mTc молекулы аффител обладают преобладающим гепатобилиарным клиренсом, который приводит к обильному накоплению радиоактивности в кишечнике, что ограничивает их использование для обнаружения опухолей HER2 и метастазов в брюшной полости.

Таким образом, существует потребность в химии и способах синтеза радиоактивно меченных полипептидов, в которых радиоактивная группировка, такая как 18F, может быть введена на конечной стадии, что, в свою очередь, обеспечит высокие радиохимические выходы. Кроме того, существует потребность в новом, основанном на HER2 визуализирующем агенте для визуализации посредством PET или SPECT, обладающем улучшенными свойствами, в частности связанными с почечным клиренсом и эффектами токсичности.

Краткое описание сущности изобретения

Композиции по изобретению представляют собой новый класс визуализирующих агентов, которые способны специфически связываться с HER2 или его вариантами.

В одном или более чем одном воплощении композиция визуализирующего агента содержит выделенный полипептид, содержащий SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант, конъюгированный с 99mTc через диаминдиоксимовый хелатообразующий агент. Диаминдиоксимовый хелатообразующий агент может содержать Pn216, cPn216, Pn44 или их производные. Выделенный полипептид специфически связывается с HER2 или его вариантами.

В одном или более чем одном воплощении композиция визуализирующего агента содержит выделенный полипептид, содержащий SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант, конъюгированный c 67Ga или 68Ga через хелатообразующий агент NOTA (1,4,7-триазациклононан-N,N'N''-триуксусная кислота). Выделенный полипептид специфически связывается с HER2 или его вариантами.

В одном или более чем одном воплощении композиция визуализирующего агента содержит выделенный полипептид, содержащий SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант, конъюгированный с 18F через линкер. Линкер содержит группу, происходящую из аминокси-группы, азидо-группы или алкиновой группы. Выделенный полипептид специфически связывается с HER2 или его вариантами.

Пример способов по изобретению для приготовления композиции визуализирующего агента включает (1) получение выделенного полипептида, содержащего SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант; и (2) взаимодействие диаминдиоксимового хелатообразующего агента с полипептидом с образованием полипептида, конъюгированного с хелатообразующим агентом. В другом примере способ включает (1) получение выделенного полипептида, содержащего SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант; (2) взаимодействие полипептида с линкером; и (3) взаимодействие линкера с группировкой 18F с образованием конъюгированного с 18F полипептида. Линкер может содержать аминокси-группу, азидо-группу или алкиновую группу.

Графические материалы

Эти и другие особенности, аспекты и преимущества настоящего изобретения станут более понятны при прочтении следующего подробного описания со ссылкой на графические материалы, где:

Фиг.1А и 1Б представляют собой графики поверхностного плазменного резонанса (SPR) связывающей аффинности к человеческому HER2 для двух полипептидов против HER2, Z477 (SEQ ID No: 3) и (Z477)2 (SEQ ID No: 5) соответственно в восьми различных концентрациях.

Фиг.2А и Фиг.2Б представляют собой графики качественной проточной цитометрии С6 (крысиная глиома, контроль) и человеческого антитела против HER2 к SKOV3 (рак яичника человека) соответственно. Фиг.2В демонстрирует столбчатую диаграмму для рецепторов Her2 на клетку для клеточных линий SKOV3 и С6.

Фиг.3 представляет собой столбчатую диаграмму анализов ELISA (твердофазный иммуноферментный анализ) для Her2 в отношении списка опухолей типов SKOV3 2-1, SKOV3 3-1, SKOV3 3-4, в отношении клеток SKOV3, и контроля («холостой» пробы, blank).

Фиг.4 представляет собой гамма-хроматограмму обращенно-фазовой ВЭЖХ (высокоэффективной жидкостной хроматографии) Z00477, меченного 99mTc (SEQ ID No: 3).

Фиг.5А представляет собой гамма-хроматограмму эксклюзионной ВЭЖХ агрегированного 99mTc(CO)3(His6)Z00477 (SEQ ID No: 4) («His6» раскрыт как SEQ ID No: 7) при рН 9. Фиг.5Б представляет собой гамма-хроматограмму эксклюзионной ВЭЖХ не агрегированного меченного 99mTc(CO)3(His6)Z00477 («His6» раскрыт как SEQ ID NO:7) стандарта аффитела.

Фиг.6 представляет собой график профиля биораспределения Z00477 (SEQ ID No: 3) в образцах крови, опухоли, печени, почки и селезенки мышей, несущих опухоль SKOV3, включающий отношение опухоль:кровь, с течением времени.

Фиг.7 представляет собой схему химической структуры линкера Mal-cPN216.

Фиг.8А представляет собой график масс-спектра, полученного посредством времяпролетной масс-спектрометрии с электрораспылительной ионизацией (ESI-TOF-MS) и Фиг.8Б представляет собой график результата деконволюции массы для очищенного Z00477 (SEQ ID No: 3)-cPN216.

Фиг.9 представляет собой хроматограмму гамма-следа для обращенно-фазовой ВЭЖХ для Z02891-cPN216 (SEQ ID No: 2), меченного 99mTc.

Фиг.10 представляет собой график профиля биораспределения Z02891 (SEQ ID No: 2) меченного 99mTc через cPN216 (% ИД, % инъецированной дозы) в образцах крови, печени, почек, селезенки и хвоста мышей, несущих опухоль SKOV3.

Фиг.11 представляет собой график профиля биораспределения Z02891 (SEQ ID No: 2), меченного 99mTc через cPN216 (% ИД, % инъецированной дозы) в образцах опухоли, крови, печени, почек, мочевого пузыря/мочи, хвоста, кишечника и селезенки мышей, несущих опухоль SKOV3.

Фиг.12 представляет собой график профиля биораспределения Z02891 (SEQ ID No: 2) у мышей, несущих опухоль SKOV3, демонстрирующий отношение опухоль:кровь (отношение О:К).

Фиг.13А и 13Б представляют собой схемы химической структуры малеимид-аминокси Вос-защищенных линкеров (Mal-AO-Boc) и малеимид-аминокси (Mal-AO) линкеров. 13А представляет собой химическую структуру трет-бутил 2-(2-(2,5-диоксо-2,5-дигидро-1Н-пиррол-1-ил)этиламино)-2-оксоэтоксикарбамата (Mal-AO-Boc) и 13Б представляет собой химическую структуру 2-(аминоокси)-N-(2-(2,5-диоксо-2,5-дигидро-1Н-пиррол-1-ил)этил)ацетамида гидрохлорида (Mal-AO.HCl).

Фиг.14А представляет собой хроматограмму обращенно-фазовой ВЭЖХ исходного материала Z00342 (SEQ ID No: 1) и 14Б представляет собой хроматограмму обращенно-фазовой ВЭЖХ очищенной композиции Z00342 (SEQ ID No: 1)-AO визуализирующего агента, оба проанализированы при 280 нм.

Фиг.15 представляет собой гамма-хроматограмму обращенно-фазовой ВЭЖХ неочищенных реакционных смесей и очищенных конечных продуктов 18F-фторбензил-Z00342 (SEQ ID No: 1) и 18F-фторбензил-Z02891' (SEQ ID No: 2).

Фиг.16 представляет собой график профиля биораспределения (% ИД, % инъецированной дозы) полипептида Z02891 (SEQ ID No: 2), меченного 18F, у животных, несущих опухоль SKOV3.

Фиг.17 представляет собой график профиля биораспределения полипептида Z02891 (SEQ ID No: 2), меченного 18F (% ИД, % инъецированной дозы), и отношения опухоль:кровь у животных, несущих опухоль SKOV3.

Фиг.18 представляет собой столбчатую диаграмму профиля биораспределения (% ИД, % инъецированной дозы) Z00342 (SEQ ID No: 1), меченного 18F, и Z02891 (SEQ ID No: 2), меченного 18F, в образцах крови, опухоли, печени, почек, селезенки и кости.

Фиг.19 представляет собой схему химической структуры линкера Mal-NOTA.

Фиг.20А представляет собой график масс-спектра, полученного посредством времяпролетной масс-спектрометрии с электрораспылительной ионизацией (ESI-TOF-MS), и 20Б представляет собой график результата деконволюции массы ESI-TOF-MS для Z00477 (SEQ ID No: 3)-NOTA.

Фиг.21 представляет собой график гамма-следа обращенно-фазовой ВЭЖХ для неочищенной реакционной смеси Z00477, меченного 67Ga (SEQ ID No: 3)-NOTA после 1 часа реакции.

Фиг.22 представляет собой график гамма-следа обращенно-фазовой ВЭЖХ очищенного NOTA Z00477, меченного 67Ga (SEQ ID No: 3)-NOTA полипептида.

Подробное описание изобретения

Визуализирующие агенты по изобретению, как правило, содержат выделенный полипептид в соответствии SEQ ID No: 1, SEQ ID No: 2 или их консервативным вариантом, конъюгированный с 18F, 99mTc, 67Ga или 68Ga; и способы приготовления и применения композиций. Выделенный полипептид специфически связывается с HER2 или его вариантом. В одном или более чем одном воплощении последовательность выделенного полипептида имеет по меньшей мере 90% сходства последовательности с любой из SEQ ID No: 1, SEQ ID No: 2 или их консервативным вариантом.

Выделенный полипептид может содержать природные аминокислоты, синтетические аминокислоты или аминокислотные миметики, которые действуют по аналогии со встречающимися в природе аминокислотами. Встречающиеся в природе аминокислоты представляют собой аминокислоты, кодируемые генетическим кодом, а также аминокислоты, которые позже были модифицированы, например, гидроксипролин, γ-карбоксиглутамат, О-фосфосерин, фосфотреонин и фосфотирозин.

Выделенные полипептиды могут быть получены стандартными методами твердофазного синтеза. Альтернативно, полипептиды могут быть получены рекомбинантными методами. Если полипептиды получают рекомбинантными методами, то ДНК, кодирующая полипептиды или их консервативные варианты может быть выделена. ДНК, кодирующая полипептиды или их консервативные варианты, может быть встроена в клонирующий вектор, введена в клетку-хозяина (например, эукариотическую клетку, клетку растения или прокариотическую клетку), и экспрессирована посредством любой системы экспрессии, известной в области техники.

Полипептид может по существу состоять из единичной хиральной формы аминокислотных остатков. Таким образом, полипептиды по изобретению могут по существу состоять из L-аминокислот или D-аминокислот; хотя также можно использовать комбинацию L-аминокислот и D-аминокислот.

Поскольку предложенные здесь полипептиды происходят из Z-домена белка А, остатки на связывающей поверхности могут быть не консервативно замещены или консервативно замещены с сохранением связывающей активности. В некоторых воплощениях замещаемые остатки могут происходить из любой из 20 встречающихся в природе аминокислот или любого их аналога.

Полипептиды могут иметь длину от приблизительно 49 остатков до приблизительно 130 остатков. Специфические полипептидные последовательности перечислены в таблице 1.

Таблица 1
Название Последовательность Длина
Z00342 (SEQ ID No: 1) VENKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK 58
Z02891 (SEQ ID No: 2) AEAKYAKEMRNAYWEIALLPNLTNQQKRAFIRKLYDDPSQSSELLSEAKKLNDSQAPKVDC 61
Z00477 (SEQ ID No: 3) VDNKFNKEMRNAYWEIALLPNLNVAQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPKVDC 61
Z00477-His6 (SEQ ID No: 4) («His6» раскрыт как SEQ ID NO: 7) GSSHHHHHHLQVDNKFNKEMRNAYWEIALLPNLNVAQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPKVDC 72
(Z00477)2 (SEQ ID No: 5) GSSHHHHHHLQVDNKFNKEMRNAYWEIALLPNLNVAQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPKVDNKFNKEMRNAYWEIALLPNLNVAQK 130
RAFIRSLYDDPSQSANLLAEAKKLNDAQAPKVDC

Дополнительные последовательности могут быть добавлены к концам для того чтобы придать выбранную функциональность. Таким образом, дополнительные последовательности могут быть присоединены к одному или обоим концам для облегчения очистки или выделения полипептида, самого по себе или сопряженного с мишенью для связывания (например, посредством добавления His-метки к полипептиду).

Полипептиды, перечисленные в таблице 1, могут быть конъюгированы с 18F через линкер; с 99mTc через диаминдиоксимовый хелатообразующий агент, или с 67Ga или 68Ga через NOTA хелатообразующий агент. В таблице 2 приведена изоэлектрическая точка (pI) этих полипептидов.

Таблица 2
pI MM (молекулярная масса) (кДа)
His6-Z00477 (SEQ ID No: 4) («His6» раскрыт как SEQ ID No: 7) 8,31 8143,11
Z02891(SEQ ID No: 2) 8,10 7029,96
His6-Z00342 («His6» раскрыт как SEQ ID No: 7) 8,14 8318,27

В одном или более чем одном воплощении выделенный полипептид, содержащий SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант, может быть конъюгирован с 18F. 18F может быть соединен с С-концом, с N-концом или с внутренней частью выделенного полипептида.

В одном или более чем одном воплощении 18F может быть конъюгирован с выделенным полипептидом через линкер. Линкер может содержать аминокси-группу, азидо-группу или алкиновую группу. Аминокси-группа линкера может быть присоединена к альдегиду, такому как фторзамещенный альдегид. Азидная группа линкера может быть присоединена к фторзамещенному алкину. Аналогично, алкиновая группа линкера может быть присоединена к фторзамещенному азиду. Линкер может также содержать тиольную реакционноспособную группу. Линкер может содержать группу малеимидо-аминокси, малеимидо-алкин или малеимидо-азид. 18F конъюгированный полипептид может быть получен путем: (1) получения выделенного полипептида, содержащего SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант; (2) взаимодействия полипептида с линкером, который содержит аминокси-группу, азидо-группу или алкиновую группу с образованием полипептида, конъюгированного с линкером; и взаимодействие линкера с группировкой 18F.

В другом воплощении способ может включать: (1) получение выделенного полипептида, содержащего SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант; (2) получение линкера; (3) взаимодействие линкера с группировкой 18F с образованием 18F меченного линкера; и (4) взаимодействие 18F меченного линкера с выделенным полипептидом в соответствии с SEQ ID No: 1, SEQ ID No: 2 или их консервативным вариантом с образованием полипептида, конъюгированного с линкером.

Используя вышеописанные примеры, атом(ы) фтора или радиоактивного фтора, такие как 18F, могут быть введены в полипептиды. Фторзамещенный полипептид образуется, когда фтор-замещенный альдегид взаимодействует с группой аминокси полипептида, конъюгированного с линкером. Аналогично, фторзамещенный полипептид образуется, когда фторзамещенная азидная или алкиновая группа взаимодействует с соответствующий алкиновой или азидной группой полипептида, конъюгированного с линкером. Композиция меченного радиоактивным фтором полипептида или визуализирующего агента образуется, когда замещенный радиоактивным фтором альдегид, азид или алкин взаимодействует с соответствующей аминокси, алкиновой или азидной группой полипептида, конъюгированного с линкером. Дополнительно, каждый из альдегидов, азидов или алкинов может иметь в качестве заместителя радиоактивный фтор (18F) для получения композиций визуализирующего агента, меченного радиоактивным фтором. Способы введения фтора в полипептид также могут быть использованы для приготовления композиции фторированного визуализирующего агента любой длины. Таким образом, в некоторых воплощениях полипептид из композиции визуализирующего агента может содержать, например, от 40 до 130 аминокислотных остатков.

Химия для синтеза полипептида, конъюгированного с линкером, в качестве визуализирующего агента является простой, и одностадийная реакция способов более эффективна по сравнению с ранее известными способами и приводит в результате к более высоким выходам. Эти способы легче осуществить, они являются более быстрыми и реализуются в более мягких, более благоприятных для пользователя условиях. Например, способ мечения полипептида 18F, конъюгированного с линкером (например, 18F-фторбензальдегид) проще, чем способы, известные в области техники. 18F конъюгированный-линкер получают в одну стадию путем прямого нуклеофильного включения 18F в триметиланилиниевый предшественник. 18F-линкер (т.е. 18F-FBA) затем конъюгируют с полипептидом, таким как аффитело. Получение линкера также легче по сравнению с ранее известными в области техники способами. Кроме того, радиоактивно меченные основанные на аминокси полипептиды, конъюгированные с линкером, и семейство полипептидов cPn, конъюгированных с хелатообразующим агентом (например, аффителом), демонстрируют значительно лучшее биораспределение и лучшее поглощение опухолью, а также улучшенный клиренс с меньшим поглощением печенью.

Меченные фтором композиции представляют собой весьма желаемые в диагностических приложениях материалы. Композиции визуализирующего агента, меченного 18F, могут быть визуализированы с использованием признанных методов визуализации, таких как PET.

В еще одном воплощении полипептид может быть конъюгирован с 99mTc через диаминдиоксимовый хелатообразующий агент формулы (1).

где R/, R//, R///, R//// независимо представляют собой Н или С1-10 алкил, С3-10 алкиларил, С2-10 алкоксиалкил, C1-10 гидроксиалкил, С1-10 алкиламин, С1-10 фторалкил, или 2 или более чем 2 группы R вместе с атомами, к которым они присоединены образуют карбоциклическое, гетероциклическое, насыщенное или ненасыщенное кольцо, где R может представлять собой Н, С1-10 алкил, С3-10 алкиларил, С2-10 алкоксиалкил, C1-10 гидроксиалкил, C1-10 алкиламин или С1-10 фторалкил. В одном из воплощений n может варьировать от 0 до 5. Примеры способов получения диаминдиоксимовых хелатообразующих агентов описаны в заявке РСТ, Международной публикации № WO 2004080492 (A1), озаглавленной «Methods of radio fluorination of biologically active vector», и заявке РСТ, Международной публикации № WO 2006067376 (A2), озаглавленной «Radio labelled conjugates of RGD-containing peptides and methods for their preparation via click-chemistry», которые включены здесь посредством ссылки.

99mTc может быть конъюгирован с выделенным полипептидом через диаминдиоксим на N-конце выделенного полипептида. Хелатообразующий агент может представлять собой бифункциональное соединение. В одном воплощении бифункциональное соединение может представлять собой Mal-cPN216. Mal-cPN216 содержит тиол-реакционноспособную малеимидную группу для конъюгации с концевым цистеином полипептида в соответствии с SEQ ID No: 1 или SEQ ID No: 2, и бис-аминоксимовую группу (диаминдиоксимовый хелатообразующий агент) для хелатирования с 99mTc. Mal-cPN216 может иметь формулу (2).

Пептид, конъюгированный с диаминдиоксимовым хелатообразующим агентом, может быть приготовлен путем (1) получения выделенного полипептида, содержащего SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант, (2) взаимодействия диаминдиоксимового хелатообразующего агента с полипептидом с образованием диаминдиоксимового конъюгированного полипептида. Диаминдиоксимовый хелатообразующий агент может быть дополнительно конъюгирован с 99mTc.

В одном или более чем одном воплощении полипептид может быть конъюгирован с 67Ga, или 68Ga через хелатообразующий агент NOTA (1,4,7-триазациклононан-N,N',N''-триуксусную кислоту). Полипептид, конъюгированный с NOTA, может быть приготовлен посредством (1) получения выделенного полипептида, содержащего SEQ ID No: 1, SEQ ID No: 2 или их консервативный вариант, (2) взаимодействия хелатообразующего агента NOTA с полипептидом с образованием конъюгированного с NOTA полипептида. Хелатообразующий агент NOTA может быть дополнительно конъюгирован с 67Ga или 68Ga.

В одном из воплощений, Ga, в частности 67Ga, может быть конъюгирован с выделенным полипептидом через хелатообразующий агент NOTA. Хелатообразующий агент NOTA может быть замещен малеимидной группой, как описано в формуле (3).

Изобретение также включает способы визуализации по меньшей мере части субъекта. В одном воплощении способ включает введение композиции визуализирующего агента субъекту и визуализации субъекта. Субъект может быть визуализирован, например, при помощи диагностического устройства.

Способ дополнительно может включать стадии мониторинга доставки композиции субъекту и постановки диагноза у субъекта, страдающего HER2-ассоциированным болезненным состоянием (например, рака молочной железы). В одном воплощении субъект может представлять собой млекопитающее, например, человека. В другом воплощении субъект может включать клетки или ткани. Ткани могут быть использованы в биопсии. В диагностическом устройстве может использоваться способ визуализации, выбранный из магниторезонансной визуализации, оптической визуализации, оптической когерентной томографии, рентгена, компьютерной томографии, позитронно-эмиссионной томографии или их комбинаций.

Композиции визуализирующего агента могут быть введены людям и другим животным парентерально. Фармацевтические композиции по изобретению для парентеральной инъекции содержат фармацевтически приемлемые стерильные водные или неводные растворы, дисперсии, суспензии или эмульсии, а также стерильные порошки для восстановления в стерильные инъецируемые растворы или дисперсии непосредственно перед применением. Примеры подходящих водных и неводных носителей, разбавителей, растворителей или наполнителей включают воду, этанол, полиолы (такие как глицерин, пропиленгликоль, полиэтиленгликоль и т.п.) и их подходящие смеси, растительные масла (такие как оливковое масло) и инъецируемые органические сложные эфиры, такие как этилолеат. Надлежащая текучесть может поддерживаться, например, использованием покрывающих материалов, таких как лецитин, корректированием размера частиц в дисперсии и использованием поверхностно-активных веществ.

Эти композиции визуализирующего агента также могут содержать адъюванты, такие как консерванты, увлажнители, эмульгаторы и диспергирующие агенты. Предупреждение действия микроорганизмов может обеспечиваться включением различных антибактериальных и противогрибковых агентов, например, парабена, хлорбутанола, фенолсорбиновой кислоты и т.п. Также может быть желательно включение изотонических агентов, таких как сахара, хлорид натрия и т.п. Продолжительная абсорбция инъецируемой фармацевтической формы может быть осуществлена включением агентов, которые замедляют абсорбцию, таких как моностеарат алюминия и желатин.

Композиции визуализирующего агента могут быть диспергированы в физиологически приемлемом носителе для минимизации потенциальной токсичности. Таким образом, визуализирующие агенты могут быть диспергированы в биосовместимом растворе с рН от приблизительно 6 до приблизительно 8. В некоторых воплощениях агент диспергирован в биосовместимом растворе с рН от приблизительно 7 до приблизительно 7,4. В других воплощениях агент диспергирован в биосовместимом растворе с рН приблизительно 7,4.

Композиции визуализирующего агента могут быть комбинированы с другими добавками, которые используют в фармацевтической промышленности для суспендирования или растворения соединений в водной среде, и затем суспензия или раствор могут быть стерилизованы методами, известными в области техники. Композиция визуализирующего агента может быть введена в различных формах и адаптирована для выбранного пути введения. Например, агенты могут быть введены местно (т.е. через ткань или слизистые оболочки), внутривенно, внутримышечно, внутрикожно или подкожно. Формы, подходящие для инъекции, включают стерильные водные растворы или дисперсии и стерильные порошки для приготовления стерильных инъецируемых растворов, дисперсий, липосомальных или эмульсионных композиций. Формы, подходящие для ингаляции, включают агенты, такие как агенты, диспергированные в аэрозоле. Формы, подходящие для местного введения, включают кремы, лосьоны, мази и т.п.

Композиции визуализирующего агента могут быть концентрированы для удобства доставки предпочтительного количества агентов субъекту и упакованы в контейнер в желаемой форме. Агент может быть дозирован в контейнер, в котором он диспергирован в физиологически приемлемом растворе, который для удобства облегчает введение агента в концентрации от 0,1 мг до 50 мг агента на кг массы тела субъекта.

В одном или более чем одном воплощении ткань-мишень может быть визуализирована приблизительно через четыре часа после введения агентов. В альтернативных воплощениях ткань-мишень может быть визуализирована приблизительно через 24 часа после введения агентов субъекту.

Примеры

Следующие примеры приведены только для иллюстрации и их не следует истолковывать как ограничивающие изобретение.

Список онкогенных клеточных линий с приемлемой вероятностью экспрессии HER2 выбирали на основе имеющейся литературы (Bruskin, et. al. Nucl. Med. Biol. 2004: 31: 205; Tran, et. al. Imaging agent composition Chem. 2007: 18: 1956), как описано в таблице 3.

Таблица 3
Клеточная линия Виды Тип Назначение
SKOV3 Человек Рак яичников Кандидат
SKBR3 Человек Рак молочной железы Кандидат
С6 Крыса Глиома Контроль

Все клеточные линии получены из Американской коллекции типовых культур (АТСС) и выращивались в соответствии с рекомендациями. Клетки выращивали до >90% конфлюэнтности перед использованием. Проточную цитометрию (Beckman Coulter Cytomics FC500 MPL) осуществляли на клеточных линиях, перечисленных в таблице 3, с использованием первичных антител против Her2 (R&D Systems, PN MAB1129), и Dako QIFIKIT (PN K0078) для количественного анализа непрямого иммунофлуоресцентного окрашивания. Калибровочные гранулы с 5 различными группами, несущими различные количества молекул Mab, использовали в сочетании с клеточными линиями для определения количества поверхностных рецепторов на клетку. Во всех случаях подходящие по изотипу контроли получали у соответствующих поставщиков.

Прикрепившиеся клетки высвобождали из колб, применяя буфер для клеточной диссоциации (PBS (фосфатно-солевой буферный раствор) + 10 мМ EDTA (этилендиаминтетрауксусная кислота)), вместо трипсина, для того чтобы избежать протеолиза рецепторов клеточной поверхности. Клетки дважды промывали в PBS и ресуспендировали в охлажденном на льду буфере FC (PBS+0,5% BSA (бычий сывороточный альбумин) масс./об.) до концентрации 5-10×106 клеток/мл. 100 мкл аликвоты клеток смешивали с 5 мкг первичного антитела и инкубировали на льду в течение 45 минут. Затем клетки промывали 1 мл охлажденного на льду буфера для проточной цитометрии (FC) (PBS с 2% бычьим сывороточным альбумином), центрифугировали при 300 g в течение 5 мин и ресуспендировали в 0,5 мкл буфера FC. Добавляли 100 мкл фрагмента вторичного антитела (F(ab)2 козьего иммуноглобулина против антител мыши, конъюгированного с FITC (фенилизотиоцианат)) в разведении 1:50 в PBS, и инкубировали на льду и в темноте в течение 45 минут. Затем клетки дважды промывали 1 мл охлажденного на льду буфера FC, центрифугировали при 300 g в течение 5 мин и ресуспендировали в 500 мкл буфера FC. Все окрашенные клетки пропускали через 100-микронный фильтр перед проточной цитометрией для предупреждения засорения проточной кюветы.

Проточную цитометрию осуществляли на Beckman Coulter Cytomics FC500 MPL. Минимум 5×104 событий регистрировали в каждой пробирке. Все анализы были одного цвета с обнаружением FITC в FL1. Данные малоуглового рассеяния (FS) и бокового рассеяния (SS) демонстрировали, что все клеточные популяции были плотно сгруппированы.

Проточную цитометрию использовали для оценки клеток в отношении экспрессии HER2 in vitro (Фиг.2А, 2Б и 2В), причем клетки SKOV3 демонстрировали самый высокий уровень экспрессии HER2 (Фиг.3). Результаты на Фиг.3 были воспроизводимы (n=3).

Линия клеток с самой высокой экспрессией представляла собой SKOV3. Эти клетки инъецировали мышам с нарушением иммунитета в возрасте 6-12 недель и оставляли для роста опухоли. Кривые роста опухоли и доля успешных результатов зависели от количества инокулированных клеток. Оптимальный рост опухоли достигали при инокуляции от трех до четырех миллионов клеток/мышь.

Исследования in vivo осуществляли с самками голых мышей CD-1 (Charles River Labs, Hopkinton, MA) в возрасте от 6 до 15 недель. Мышей содержали в вентилируемой клетке с достаточным количеством корма и воды и стандартным 12-часовым циклом день-ночь. Для получения ксенотрансплантатов животным инъецировали 100 мкл клеток в PBS. Клетки имплантировали подкожно в правую заднюю конечность. Имплантацию осуществляли под изофлурановой анестезией. Для SKOV3 от 3×106 до 4×106 клеток имплантировали каждой мыши. В этих условиях пригодные для использования опухоли (от 100 до 300 мкг) получали в течение от 3 до 4 недель у более чем 80% инъецированных животных.

Опухоли собирали у мышей путем иссечения, и целые опухоли хранили при -20°С до обработки. Опухоли измельчали на льду в 1 мл буфера RIPA (буфер для радиоиммунопреципитационного анализа), дополненного смесью протеазного ингибитора (Santa Cruz Biotech, Santa Cruz, CA #24948) в гомогенизаторе Dounce. Затем гомогенаты инкубировали на льду в течение 30 минут, затем центрифугировали при 10000 g в течение 10 минут в охлажденной центрифуге. Супернатанты собирали и хранили на льду или при 4°С до дальнейшей обработки. Концентрации белка в лизатах определяли с использованием набора для анализа белка ВСА (бицинхониновая кислота) (Pierce Biotechnology 23225). Лизаты разбавляли до стандартной концентрации с получением 20 мкг белка/лунку в микротитрационном планшете. ELISA осуществляли с использованием имеющихся в продаже наборов для анализа человеческого HER2 (R&D Systems, DYC1129) в соответствии с указаниями производителя. Каждый образец анализировали в трех повторностях, и данные представлены в пг HER2/мкг общего белка, ошибки приведены в виде стандартных отклонений.

Целевую экспрессию in vivo измеряли посредством ELISA. Вырезанные опухоли гомогенизировали и анализировали в отношении HER2 с использованием имеющегося в продаже набора для анализа комплементарных пар (R&D systems, DYC1129, Minneapolis, MN). Результаты на Фиг.3 демонстрируют, что клеточная линия SKOV3 позволяет выращивать высокоэкспрессирующуюся опухоль. Контролями для ELISA выступали лизаты клеточных культур отрицательных контрольных линий, используемых для проточной цитометрии. Эти результаты указывают на то, что опухолевые ксенотрансплантаты SKOV3 подходят для in vivo исследования молекул, нацеленных на человеческий HER2.

Все полипептиды получены от Affibody АВ в Швеции. Полипептиды названы в соответствии с их числовыми внутренними кодами, присваиваемыми при разработке, которые начинаются с «Z». В таблице 1 приведена подробная информация об описанных здесь полипептидах. Полипептиды включают полипептид Z00342 (SEQ ID No: 1); полипептид Z02891 (SEQ ID No: 2); полипептид Z00477 (SEQ ID No: 3 и 4) и димер Z00477, т.е. (Z00477)2 (SEQ ID No: 5).

Связывающие взаимодействия между полипептидами и антигеном HER2/neu измеряли in vitro методом поверхностного плазменного резонанса (SPR) на приборе Biacore™ 3000 (GE Healthcare, Piscataway, NJ). Внеклеточный домен антигена Her2/neu получали в виде конъюгата с областью Fc человеческого IgG (Fc-Her2) от R&D Systems (Minneapolis, MN) и ковалентно присоединяли к СМ-5 декстран-замещенному сенсорному чипу (GE Healthcare, Piscataway, NJ), предварительно уравновешенному буфером HBS-EP (0,01М HEPES (N-2-гидроксиэтилпиперазин-N'-2-этансульфоновая кислота) рН 7,4, 0,15 М NaCl, 3 мМ EDTA, 0,005% об./об. поверхностно-активного вещества Р20) при скорости потока 10 мкл/мин и затем активировали с использованием EDC (1,2-дихлорэтана) и NHS. Fc-HER2 (5 мкг/мл) в 10 мМ ацетате натрия (рН 5,5) вводили на активированный сенсорный чип до достижения желаемого уровня иммобилизации (прибл. 3000 резонансных единиц) (2 мин). Остаточные активированные группы на сенсорном чипе блокировали путем введения этаноламина (1М, рН 8,5). Любой нековалентно связанный конъюгат удаляли при помощи повторяющихся (5×) промываний 2,5 М NaCl, 50 мМ NaOH. Второй поток клеток на том же самом сенсорном чипе обрабатывали аналогично за исключением того, что отсутствовала иммобилизация Fc-HER2, для того чтобы выступать в качестве контрольной поверхности для изменений индекса преломления и неспецифических связывающих взаимодействий с сенсорным чипом. Перед кинетическим исследованием связывание аналита-мишени тестировали на обеих поверхностях, и эксперимент со стабильностью поверхности осуществляли для гарантии адекватного удаления связавшегося аналита и регенерации сенсорного чипа после обработки 2,5 М NaCl, 50 мМ NaOH. Сенсограммы SPR анализировали с использованием программного обеспечения BIAevaluation (GE Healthcare, Piscataway, NJ). Надежность кинетической модели определяли путем оценки остатков и стандартной ошибки для каждого из рассчитанных кинетических параметров, «добротности подгонки» («goodness of the fit») (χ2<10), и прямого сравнения моделированных сенсограмм с экспериментальными данными. Измерения SPR регистрировали при восьми концентрациях аналита (0-100 нМ белка), и полученные в результате сенсограммы подгоняли к 1:1 модели связывания Лэнгмюра.

Фиг.1 демонстрирует пример данных поверхностного плазменного резонанса (SPR), полученных для Z00477 (SEQ ID No: 3) и (Z00477)2 (SEQ ID No: 5) при анализе на функционализированных человеческим HER2 поверхностях. Эта взаимосвязь сохраняется для всех полипептидов, для которых известны аффинности (Таблица 2), причем значения для димера Z(477)2 (SEQ ID No: 5) оценивают на основе влияния авидности.

Мечение полипептидов с концевыми последовательностями His6 (SEQ ID No: 7) ядром fac-[99mTc(CO)3]+ осуществляли с использованием модификаций ранее опубликованной процедуры (Waibel, R.; et al., A. Nat. Biotechnol. 1999, 17, 897.). Кратко, Na[99mTcO4] в солевом растворе (4 мКи, 2 мл) добавляли к боркарбонатному набору Isolink® (Alberto, R. et al, J. Am. Chem. Soc. 2001, 123, 3135.). Получающийся в результате раствор нагревали до 95°С в течение 15-20 минут с получением fac-[99mTc(CO)3(H2O)3]+. Часть (2 мКи, 1 мл) раствора удаляли и нейтрализовали до рН приблизительно 7 с использованием 1 н. HCl. Аликвоту 325 мкл удаляли и добавляли к раствору His6-полипептида (SEQ ID No: 7) (40 мкг). Получающийся в результате раствор нагревали в водяной бане при 35-37°С в течение 40 минут. Типичные радиохимические выходы находились в диапазоне от 80 до 95% (определенные при помощи ITLC (мгновенная хроматография в тонком слое)-SG, Biodex, 0,9% NaCl). Неочищенные продукты реакции подвергали хроматографии на колонке NAP-5 (GE Healthcare, 10 мМ PBS) с получением продуктов, имеющих радиохимическую чистоту >99%. Полученные типичные специфические активности составляли 3-4 мкКи/мкг. Полученный в результате раствор затем разбавляли 10 мМ PBS с получением надлежащих концентраций для последующих исследований биораспределения.

ВЭЖХ осуществляли на системе Agilent 1100, оборудованной колонкой Grace-Vydac Peptide/Protein C4 (4,6×250 мм) и детектором радиоактивности Raytest GABI. Растворитель А представлял собой 95:5 вода:MeCN с 0,1% TFA (трифторуксусная кислота), и растворитель Б представлял собой 5:95 вода:MeCN с 0,1% TFA. Градиент был следующим (все изменения были линейными; время/%Б): 0/0, 4/20, 16/60, 20/100, 25/100, 26/0, 31/0.

Каждый полипептид метили трикарбонилтехнециевым ядром с высоким выходом (>90%) перед очисткой. Очистка при помощи NAP-5 хроматографии позволила получить образцы 99mTc-меченых полипептидов с >99% радиохимической чистотой (Таблица 4).

Таблица 4
Соединение Выход неочищенного вещества (%) Выход после выделения (коррекция затухания) (%) NAP-5 RCP (%)
Z00477 (SEQ ID No: 3) 56,9 24,7 (26,9) 99,5

Типичные хроматограммы NAP-5 ВЭЖХ очищенных радиоактивно меченных полипептидов представлены на Фиг.4. Время удерживания радиоактивно меченных частиц по существу не изменялось относительно соответствующего времени удерживания немеченых полипептидов на УФ хроматограмме при 220 нм (за исключением разницы времени удерживания вследствие физического разделения УФ и гамма-детекторов; данные не представлены).

Животные модели, используемые для исследования 99mTc(CO)3(His6)-полипептидов («His6» раскрыт как SEQ ID No: 7).

Исследования in vivo осуществляли на самках голых мышей CD-1 (Charles River Labs, Hopkinton, MA) в возрасте от 6 до 15 недель. Мышей содержали в вентилируемой клетке с достаточным количеством корма и воды и стандартным 12-часовым циклом день-ночь. Для получения ксенотрансплантатов животным инъецировали 100 мкл клеток в PBS. Клетки имплантировали подкожно в правую заднюю конечность. Имплантацию осуществляли под изофлурановой анестезией. Для SKOV3 от 3×106 до 4×106 клеток имплантировали каждой мыши. В этих условиях пригодные для использования опухоли (от 100 до 300 мкг) получали в течение от 3 до 4 недель у более чем 80% инъецированных животных.

Биораспределение

Мышам осуществляли инъекции в хвостовую вену приблизительно 1 мкг 99mTc-меченых полипептидов (приблизительно 3 мкКи/1 мкг). Мышей помещали в выстланные фильтровальной бумагой клетки до умерщвления. Трое мышей умерщвляли в каждый момент времени, и интересующие ткани иссекали и подсчитывали на гамма-счетчике Perkin Elmer Wallac Wizard 1480. Данные собирали для крови, почки, печени, селезенки и места инъекции (хвоста). Мочу из клеток объединяли с мочой из мочевого пузыря и также подсчитывали. Оставшиеся ткани подсчитывали, и сумму для всех тканей с мочой для каждого животного суммировали с получением общей инъецированной дозы. % инъецированной дозы для каждого органа определяли на основе этого общего значения, и органы взвешивали для определения % инъецированной дозы на грамм (% ИД/г). Данные представлены в виде среднего значения для всех трех мышей в момент времени с планками погрешностей, демонстрирующими стандартное отклонение для группы.

99mTc меченный Z00477 (SEQ ID No: 4) полипептид инъецировали мышам SKOV3. Фиг.6 демонстрирует графики этих экспериментов для опухоли и крови. Полипептид Z00477 (SEQ ID No: 4) демонстрирует хорошее поглощение опухолью для экспрессирующих мишень SKOV3 опухолей, причем максимальное значение составляет приблизительно 3% инъецированной дозы на грамм ткани через 30 минут после инъекции (PI), и максимальное отношение опухоль:кровь более чем 8 через 240 минут PI.

Полипептиды демонстрируют моноэкспоненциальный клиренс из крови с периодами полувыведения меньше чем две минуты. Этот клиренс главным образом опосредован печенью и почками. Поглощение полипептида в селезенке было умеренным, и обнаружено умеренно-высокое поглощение в печени, как описано в таблице 5.

Таблица 5
Поглощение Z00477 (SEQ ID No: 3) с His6 (SEQ ID No: 7)концевыми последовательностями (% ИД/г) у мышей, несущих опухоль SKOV3
5 минут 30 минут 120 минут 240 минут
Кровь 7,30±0,32 (n=3) 1,47±0,16 (n=3) 0,56±0,03 (n=3) 0,43±0,03 (n=3)
Опухоль 1,57±0,62 (n=3) 3,06±0,17 (n=3) 3,40±0,87 (n=3) 3,60±1,15 (n=3)
Печень 29,07±0,70 (n=3) 32,19±6,50 (n=3) 39,57±6,29 (n=3) 35,17±3,48 (n=3)
Почка 54,83±9,29 (n=3) 85,89±10,00 (n=3) 97,99±10,45 (n=3) 92,54±7,36 (n=3)
Селезенка 5,57±2,39 (n=3) 3,76±0,23 (n=3) 4,65±2,21 (n=3) 5,36±0,80 (n=3)

Двухвалентные полипептиды демонстрируют более высокую аффинность по сравнению с соответствующими мономерами, прежде всего вследствие эффекта авидности. Тем не менее, их более крупный размер может препятствовать проникновению в опухоль. Для полипептидов HER2 имеются двухвалентные формы каждого из четырех высокоаффинных полипептидов. Димер Z00477 (SEQ ID No: 3), (Z00477)2 (SEQ ID No: 5), был радиоактивно меченным и его использовали для четырехчасового эксперимента биораспределения у мышей, несущих опухоль SKOV3.

В противном случае моновалентные и двухвалентные полипептиды демонстрируют близкие характеристики биораспределения, и периоды полувыведения из крови обнаружены для обеих форм в течение одно-двухминутного диапазона. Эти результаты ясно указывают на то, что как мономерные, так и двухвалентные полипептиды могут быть нацелены на HER2 in vivo.

Для введения 99mTc хелатообразующего агента cPN216 (Фиг.7) синтезировали бифункциональное соединение Mal-cPN216, содержащее тиол-реакционноспособную малеимидную группу для конъюгации с концевым цистеином полипептида и аминоксимовой группой для хелатирования 99mTc.

cPN216-амин получен от GE Healthcare. N-β-малеимидопропионовая кислота приобретена в Pierce Technologies (Rockford, IL). N-метилморфолин, (бензотриазол-1-илокси)трипирролидинофосфоний гексафторфосфат (PyBoP), дитиотреитол (DTT), бикарбонат аммония и безводный DMF (диметилформамид) приобретены в Aldrich (Milwaukee, WI). PBS буфер (1×, рН 7,4) получен от Invitrogen (Carlsbad, CA). Ацетонитрил квалификации «для ВЭЖХ» (CH3CN), трифторуксусную кислоту квалификации «для ВЭЖХ» (TFA) и воду Millipore 18 мОм использовали для очисток посредством ВЭЖХ.

К охлажденному на льду раствору N-β-малеимидопропионовой кислоты (108 мг, 0,64 ммоль), cPN216-амина (200 мг, 0,58 ммоль) и PyBoP (333 мг, 0,64 ммоль) в безводном DMF (диметилформамид) при 0°С добавляли 0,4 М N-метилморфолин в DMF (128 мкл, 1,16 ммоль). Ледяную баню удаляли после 2 часов и смесь перемешивали при комнатной температуре в течение ночи, а затем подвергали очистке на ВЭЖХ. Продукт получали в виде белого порошка (230 мг, выход 80%). 1H-ЯМР (ядерный магнитный резонанс) (400 МГц, ДМСО (диметилсульфоксид)-d6): δ 1.35 (m, 2Н), 1.43 (s, 12H), 1.56 (m, 5H), 1.85 (s, 6H), 2.33 (dd, J1=8 Гц, J2=4 Гц, 2H), 2.78 (m, 4H), 3.04 (m, 2H), 3.61 (dd, J1=8 Гц, J2=4 Гц, 2H), 7.02 (s, 2H), 8.02 (s, 1H), 8.68 (s, 4H), 11.26 (s, 2H); m/z (отношение массы к заряду) = 495,2 для [М+Н]+ (C24H43N6O5, рассчитанная ММ = 495,3).

Полипептид разводили свежедегазированным буфером PBS (1×, рН 7,4) до концентрации приблизительно 1 мг/мл. Дисульфидную связь в полипептиде восстанавливали путем добавления раствора DTT в свежедегазированном буфере PBS (1x, рН 7,4). Конечная концентрация DTT составляла 20 мМ. Реакционную смесь перемешивали на вортексе (was vortexed) в течение 2 часов и пропускали через обессоливающую центрифужную колонку Zeba (Pierce Technologies), предварительно уравновешенную дегазированным буфером PBS (1x, рН 7,4) для удаления избытка реагента DTT. Элюированные молекулы восстановленного полипептида собирали и добавляли бифункциональное соединение Mal-cPN216 (20 эквивалентов на эквивалент полипептида) в виде раствора в ДМСО, и смесь перемешивали на вортексе при комнатной температуре в течение 3 часов и замораживали жидким азотом. Реакционную смесь хранили в течение ночи, а затем подвергали очистке посредством обращенно-фазовой ВЭЖХ (Фиг.8А и 8Б).

Очистку на ВЭЖХ осуществляли на колонке MiCHROM Magic C18AQ 5 µ 200A (MiChrom Bioresources, Auburn, CA). Растворитель A: H2O (c 0,1% муравьиной кислотой), растворитель Б: CH3CN (с 0,1% муравьиной кислотой). Градиент: 5-100% Б в течение 30 мин.

Фракции, содержащие желаемый продукт, объединяли и нейтрализовали с использованием 100 мМ раствора бикарбоната аммония, и растворители удаляли лиофилизацией с получением композиции желаемого визуализирующего агента в виде белого твердого вещества (выход 41%).

LC-MS (жидкостная хроматография/масс-спектрометрия) анализ очищенного продукта подтвердил присутствие желаемого продукта, и ММ свидетельствовала о том, что только одна метка cPN216 была добавлена в полипептидные конструкции (Z00477 (SEQ ID No: 3)-cPN216: рассчитанная MM: 7429 Да, обнаруженная: 7429 Да; Z02891 (SEQ ID No: 2)-cPN216: рассчитанная MM: 7524 Да, обнаруженная: 7524 Да).

Во флакон объемом 20 мл добавляли 10,00 мл дистиллированной, деионизированной воды. Газообразный азот барботировали через этот раствор в течение приблизительно 30 минут до добавления NaHCO3 (450 мг, 5,36×10-3 моль), Na2CO3 (60 мг, 5,66×10-4 моль) и пара-аминобензоата натрия (20 мг, 1,26×10-4 моль). Все реагенты независимо взвешивали и добавляли во флакон, содержащий воду. Хлорид олова (1,6 мг, 7,09×10-6 моль) и MDP (мурамилдипептид) (2,5 мг, 1,42×10-5 моль) взвешивали вместе в 1 мензурку и затем переносили (с 1 последующей промывкой) путем быстрого суспендирования в приблизительно 1 мл смеси карбонатного буфера. 10 мкл аликвоты отбирали и переносили в потоке азота в силанизированные флаконы, немедленно замораживали и поддерживали в ванне с жидким азотом до лиофилизации. Каждый флакон частично закрывали каучуковой мембраной и помещали в поддон лиофилизатора на ночь. Флаконы закрывали под вакуумом, извлекали из лиофилизатора, фиксировали алюминиевыми крышками, повторно герметизировали безводным азотом и хранили в морозильнике до последующего использования.

Синтез радиоактивно меченного полипептида осуществляли с использованием самостоятельно приготавливаемой композиции одностадийного набора (Chelakit A+), содержащего лиофилизированную смесь хлористого олова в качестве восстановителя для технеция, метилендифосфоновой кислоты, пара-аминобензоата в качестве акцептора свободных радикалов и бикарбоната натрия/карбоната натрия (рН 9,2) в качестве буфера. 20 мкл 2 мкг/мкл раствора полипептида в солевом растворе быстро добавляли в Chelakit, а затем немедленно Na99mTcO4 (0,8 мКи, 29,6 МБк) в 0,080 мл солевого раствора (0,15М NaCl), полученного от Cardinal Health (Albany, NY). Смесь однократно встряхивали и оставляли при температуре окружающей среды на 20 мин. После завершения реакции радиохимический выход неочищенного вещества определяли при помощи ITLC (Таблица 6 ниже, на основании ITLC-SG, Biodex, 0,9% NaCl).

Таблица 6
Соединение Неочищенный продукт реакции (%) Очищенный продукт реакции (%) Выход реакции (%) скорректированный на угасание/(нескорректированный)
Z00477 (SEQ ID No: 3) 49,2 98,6 53,9 (13,1)
Z02891 (SEQ ID No: 2) 71,6 97,5 46,9 (43,8)

Объем реакционной смеси увеличивали до 0,45 мл с 0,35 мл 150 мМ стерильного NaCl, и конечный продукт очищали при помощи эксклюзионной хроматографии (NAP5, GE Healthcare, заполненной 10 мМ PBS). Неочищенную реакционную смесь наносили на колонку NAP5, оставляли входить в слой геля и конечный очищенный продукт выделяли после элюции 0,8 мл 10 мМ PBS. Конечную активность измеряли в калибраторе стандартной дозы (CRC-15R, Capintec, Ramsey, NJ). Радиохимический выход (Таблица 6) и чистоту определяли при помощи анализа ITLC (>98,5%), С4 RP-ВЭЖХ (обращено-фазовая высокоэффективная жидкостная хроматография) (Фиг.9) и эксклюзионной ВЭЖХ. Конечный продукт (10-15 мкКи/мкг, 0,2-0,5 мкКи/мкл (0,37 МБк/мкг, 7,4 МБк/мл)) использовали немедленно для исследований биораспределения.

Условия ВЭЖХ, используемые для данного эксперимента, были следующими: С4 RP-ВЭЖХ способ 1: растворитель А: 95/5 H2O/CH3CN (с 0,05% TFA), растворитель Б: 95/5 CH3CN/ddH2O (дистиллированная, деионизированная вода) с 0,05% TFA. Градиентная элюция: 0 мин 0% Б, 4 мин 20% Б, 16 мин 60% Б, 20 мин 100% Б, 25 мин 100% Б, 26 мин 0% Б, 31 мин 0% Б.

С4 RP-ВЭЖХ способ 2: растворитель А: 0,06% NH3 в воде, растворитель Б: CH3CN. Градиентная элюция: 0 мин 0% Б, 4 мин 20% Б, 16 мин 60% Б, 20 мин 100% Б, 25 мин 100% Б, 26 мин 0% Б, 31 мин 0% Б.

Анализ путем RP-ВЭЖХ осуществляли на HP Agilent 1100 с G1311A QuatPump, автоинжектором G1313A со шприцем 100 мкл и установленным капилляром 2,0 мл, колонкой Grace Vydac - protein C4 (S/N E050929-2-1, 4,6 мм×150 мм), нагревателем колонок G1316A, G1315A DAD (диодно-матричным детектором) и гамма-детектором Ramon Star- GABI.

Эксклюзионная ВЭЖХ: растворитель: 1×(10 мМ) PBS (Gibco, Invitrogen, рН 7,4, содержащий CaCl2 и MgCl2). Изократическая элюция в течение 30 мин. Анализ осуществляли, применяя: модуль управления растворителями Perkin Elmer SEC-4 Solvent Environmental control, насос Series 410 LC, модуль управления образцами ISS 200 Advanced LC и диодно-матричный детектор Series 200. Гамма-детектор Raytest GABI с проточной ячейкой Socket 8103 0111 pinhole (0,7 мм внутренний диаметр с объемом 250 мкл) подключали через сетевой интерфейс для хроматографии Perkin Elmer NCI 900. Используемая колонка представляла собой Superdex 75 10/300 GL High Performance SEC (GE Healthcare, код: 17-5174-01, ID №0639059).

Рабочий рН наборов Chelakits, используемых для включения 99mTc в хелат cPN216 (рН=9,2) практически соответствовал рассчитанной pl для полипептида Z00477 (SEQ ID No: 3). Мечение в этих условиях проводили для того, чтобы вызвать агрегацию в конечном продукте (Фиг.5А и 5Б). Агрегацию подтвердили при помощи эксклюзионной ВЭЖХ и по обнаруженному в исследованиях биораспределения увеличенному времени нахождения в крови и поглощения в печени. Посредством изменения изоэлектрической точки полипептида, 99mTc успешно включался в конструкцию Z02891 (SEQ ID No: 2). Эксклюзионная ВЭЖХ подтвердила присутствие частиц с подходящей молекулярной массой, и исследования биораспределения продемонстрировали захват меченых атомов в опухолевые ксенотрансплантаты.

Исследования in vivo осуществляли с самками голых мышей CD-1 (Charles River Labs, Hopkinton, MA) в возрасте от 6 до 15 недель. Мышей содержали в вентилируемой клетке с достаточным количеством корма и воды и стандартным 12 часовым циклом день-ночь. Для получения ксенотрансплантатов животным инъецировали 100 мкл клеток в PBS. Клетки имплантировали подкожно в правую заднюю конечность. Имплантацию осуществляли под изофлурановой анестезией. Для SKOV3 от 3×106 до 4×106 клеток имплантировали каждой мыши. В этих условиях пригодные для использования опухоли (от 100 до 300 мкг) получали в течение от 3 до 4 недель у более чем 80% инъецированных животных.

Мышам осуществляли инъекции в хвостовую вену приблизительно 1 мкг 99mTc-меченых полипептидов (приблизительно 10 мкКи/1 мкг). Мышей помещали в выстланные фильтровальной бумагой клетки до умерщвления. Трех мышей умерщвляли в каждый момент времени и интересующие ткани иссекали и подсчитывали на гамма-счетчике Perkin Elmer Wallac Wizard 1480. Данные собирали для крови, почки, печени, селезенки и области инъекции (хвоста). Мочу из клеток объединяли с мочой из мочевого пузыря и также подсчитывали. Оставшиеся ткани подсчитывали, и сумму для всех тканей с мочой для каждого животного суммировали с получением общей инъецированной дозы. % инъецированной дозы для каждого органа определяли на основе этой общей величины, и органы взвешивали для определения % инъецированной дозы на грамм (% ИД/г). Данные представлены в виде среднего значения для всех четырех-пяти мышей в этот момент времени с планками погрешностей, демонстрирующими стандартное отклонение для группы. Четыре момента времени регистрировали в течение четырех часов (5, 30, 120 и 240 минут после инъекции).

Полипептид Z02891 (SEQ ID No: 2)-cPN216-99mTc демонстрирует сильное поглощение опухолью для экспрессирующих мишень SKOV3 опухолей со значением 7,11±1,69% (n=5) инъецированной дозы на грамм ткани через 30 минут после инъекции (PI), которое остается достаточно постоянным в процессе исследования до 240 мин PI (после инъекции). Отношения опухоль:кровь составляли 2, 5, и 5 через 30, 120, и 240 мин после инъекции соответственно. Фиг.10, 11 и 12 демонстрируют кривые для опухоли, крови и отношения опухоль:кровь (О:К) для этих экспериментов.

Полипептиды демонстрируют моноэкспоненциальный клиренс из крови с периодами полувыведения меньше чем две минуты. Этот клиренс главным образом опосредован почками с 10,58±2,96 (n=5) ИД (инъецированной дозы)/орган через 240 мин после инъекции (PI). Активность секретируется главным образом в мочу. В процессе исследования поглощение полипептида в селезенке было от умеренного до высокого вследствие возможной агрегации, и обнаружено умеренное поглощение в печени, например, 12% ИД/орган (эквивалент величины у мыши для % ИД/г).

Результаты биораспределения для Z02891 (SEQ ID No: 2)-cPN216-99mTc

Таблица 7
Поглощение Z02891 (SEQ ID No: 2) cPN216 (% ИД/г) у мышей, несущих опухоль SKOV3
5 минут 30 минут 120 минут 240 минут
Кровь 8,69±0,99 (n=5) 3,32±0,48 (n=5) 1,33±0,05 (n=5) 1,05±0,09 (n=5)
Опухоль 3,19±1,78 (n=4) 7,11±1,69 (n=5) 7,18±3,33 (n=5) 5,07±3,47 (n=5)
Печень 9,87±0,81 (n=5) 11,07±1,06 (n=5) 8,33±0,50 (n=5) 9,38±0,69 (n=5)
Почка 67,61±9,24 (n=5) 74,15±4,17 (n=5) 37,14±3,48 (n=5) 29,67±10,87 (n=5)
Селезенка 7,07±1,84 (n=5) 4,51±1,25 (n=5) 3,91±0,44 (n=5) 2,85±0,62 (n=5)

Полипептиды Z00477 (SEQ ID No. 4), Z00342 (SEQ ID No. 1) и Z02891 (SEQ ID No: 2)-цистеин функционализировали аминокси-группами через сконструированный С-концевой цистеин. Определенная чистота получаемых полипептидных молекул составила >95% в соответствии с высокоэффективной жидкостной хроматографией (ВЭЖХ).

Для включения 18F в полипептидные молекулы синтезировали бифункциональный линкер Mal-AO, содержащий две ортогональные группы: тиол-реакционноспособную малеимидную группу для конъюгации с конструированным цистеином и альдегид-реакционноспособную аминокси-группу (фиг.13А и 13Б). Этот линкер получали взаимодействием N-(2-аминоэтил)малеимида с 2-(трет-бутоксикарбониламиноокси)-уксусной кислотой с использованием условий связывания, опосредованных 1-этил-3-[3-диметиламинопропил]карбодиимидом (EDC), с получением Вос-защищенной формы линкера. Защитную группу Вое затем удаляли путем кислотного гидролиза с получением конечного продукта Mal-AO с количественным выходом. Конечный продукт использовали непосредственно без дополнительной очистки.

Дихлорметан, 2-(трет-бутоксикарбониламиноокси)-уксусную кислоту, триэтиламин, соль N-(2-аминоэтил)малеимид трифторуксусной кислоты (TFA), N-гидроксибензотриазол гидрат (НОВТ), 1-этил-3-[3-диметиламинопропил]карбодиимид (EDC), дитиотреитол (DTT) и все другие стандартные реагенты для синтеза приобретены в Sigma-Aldrich Chemical Co. (St. Louis, МО). Все химические соединения использовали без дополнительной очистки. Буфер PBS (1x, рН 7,4) получен от Invitrogen (Carlsbad, CA). Для очисток использовали этилацетат, гексаны, ацетонитрил (CH3CN), трифторуксусную кислоту (TFA) квалификации «для ВЭЖХ» и воду Millipore 18 мОм.

К раствору 2-(трет-бутоксикарбониламиноокси)уксусной кислоты (382 мг, 2 ммоль) в безводном дихлорметане (20 мл) последовательно добавляли триэтиламин (307 мкл, 2,2 ммоль), соль N-(2-аминоэтил)малеимид-ТРА (508 мг, 2 ммоль), НОВТ (306 мг, 2 ммоль) и EDC (420 мг, 2,2 ммоль). После перемешивания в течение 24 часов при комнатной температуре реакционную смесь разбавляли этилацетатом (50 мл) и промывали насыщенным раствором бикарбоната натрия (3×30 мл), водой (30 мл) и солевым раствором (30 мл). Органический слой сушили над безводным сульфатом магния и фильтровали. Фильтрат концентрировали до бледно-желтого твердого вещества, которое очищали путем колоночной хроматографии (70% этилацетат в гексанах) с получением продукта в виде белого порошка (500 мг, выход 80%). 1H-ЯМР (400 МГц, CDCl3): δ 1.50 (s, 9 H), 3.55 (tt, J1=6,0 Гц, J2=6,5 Гц, 2 Н), 3.77 (dd, J=7,6 Гц, 2 Н), 4.30 (s, 2H), 6.3 (s, 2H).

Раствор 9,3 мг Mal-AO-Boc в 1 мл 3М HCl в метаноле перемешивали при комнатной температуре в течение 18 часов. Растворители удаляли в вакууме с получением Mal-AO в виде светло-желтого твердого вещества (выход 80%). 1H-ЯМР (400 МГц, ДМСО-d6): δ 3.27 CH2 (t, J=4,0 Гц, 2H), 3.49 CH2 (t, J=4,0 Гц, 2Н), 4.39 СН2О (s, 2H), 7.00 CH=CH (s, 2H); m/z=214.07 для [M+H]+ (C8H12N3O4, рассчитанная ММ = 214,11).

Полипептид разводили свежедегазированным буфером PBS (1x, рН 7,4) до концентрации приблизительно 1 мг/мл. Дисульфидную связь в полипептиде восстанавливали путем добавления раствора дитиотреитола (DTT) в свежедегазированном буфере PBS (1x, рН 7,4). Конечная концентрация DTT составляла 20 мМ. Реакционную смесь перемешивали на вортексе в течение 2 часов и элюировали через обессоливающую центрифужную колонку Zeba (Pierce Technologies), предварительно уравновешенную дегазированным буфером PBS для удаления избытка реагента DTT. Восстановленный полипептид собирали и добавляли бифункциональное соединение Mal-AO (15 эквивалентов на эквивалент полипептида) в виде раствора в ДМСО. После перемешивания на вортексе при комнатной температуре в течение ночи реакционную смесь очищали при помощи высокоэффективной жидкостной хроматографии (ВЭЖХ) (Фиг.14А и 14Б).

Очистку посредством ВЭЖХ осуществляли на колонке MiCHROM Magic C18AQ 5µ 200А (MiChrom Bioresources, Auburn, CA). Растворитель А: H2O (с 0,1% муравьиной кислотой), растворитель Б: CH3CN (с 0,1% муравьиной кислотой). Градиент: 5-100% Б в течение 30 мин. Фракции, содержащие желаемый продукт, объединяли и нейтрализовали 100 мМ раствором бикарбоната аммония и растворители удаляли путем лиофилизации с получением аминокси-модифицированного полипептида в виде белого твердого вещества.

Анализ путем ESI-TOF-MS (времяпролетной масс-спектрометрии с электрораспылительной ионизацией) подтвердил присутствие желаемого продукта с ожидаемыми молекулярными массами (рассчитанная ММ: 6964 Да, 8531 Да и 7243 Да, обнаруженная: 6963 Да, 8532 Да и 7244 Да для Z00477 (SEQ ID No: 4)-ONH2, Z00342 (SEQ ID No: 1)-ONH2 и Z02891 (SEQ ID No: 2)-ONH2 соответственно).

Способы: все реакции осуществляли в атмосфере азота или во флаконе с завинчивающейся крышкой, продуваемом азотом до использования. Kryptofix 222 (Aldrich) и К2СО3 (EMD Science) приобретали и использовали по получению. Ацетонитрил квалификации «Optima™» использовали в качестве растворителя для ВЭЖХ и реакционного растворителя.

K18F (40 мКи·мл-1 (1480 МБк·мл-1) в очищенной воде) получали от IBA Molecular (Albany, NY) и PETNET Solutions (Albany, NY) и его использовали по получению. [18F-] фторид сначала иммобилизировали на анионообменном картридже Chromafix 30-PS-HC03 (АВХ, Radeberg, Germany), затем элюировали в сосуд для высыхания с 1 мл смеси 4:1 ацетонитрил:дистиллированная, деионизированная H2O (ddH2O), содержащей Kryptofix K222 (376 г·моль-1, 8 мг, 2,13×10-5 моль) и карбонат калия (138,2 г·моль-1, 2,1 мг, 1,52×10-5 моль). Растворитель удаляли в частичном вакууме и потоке азота с осторожным нагреванием (приблизительно 45°С) (приблизительно 15 мин). Флакон-источник и анионообменный картридж затем промывали 0,5 мл ацетонитрила, содержащего К222 (8 мг), и реакционную смесь вновь высушивали в частичном вакууме при осторожном нагревании (приблизительно 10 мин). В реакционный сосуд повторно нагнетали азот и азеотропное высушивание повторяли еще раз с дополнительными 0,5 мл ацетонитрила. 4-формил-N,N,N-триметиланилиниум трифлат (313,30 г·моль-1, 3,1 мг, 9,89×10-6 моль) разводили в 0,35 мл безводного ДМСО (Acros) и добавляли непосредственно в реакционный сосуд, содержащий K18F·К222, К2СО3. Реакционную смесь нагревали до 90°С в течение 15 мин и немедленно охлаждали и гасили 3 мл ddH2O. Эту смесь затем пропускали через катионообменный картридж (Waters SepPak Light Accell Plus CM), разбавляли до 10 мл с использованием ddH2O и наносили на колонку С18 SepPak (Waters SepPak Plus С18) для обращенно-фазовой хроматографии. SepPak промывали 10 мл ddH2O, затем продували 30 мл воздуха. [18F]4-фторбензальдегид (18FBA) элюировали в 1,0 мл метанола.

Отдельно, во флакон с высоким выходом (2 мл, National Scientific) загружали Z00477-(SEQ ID No: 3)-ONH2 (0,35-0,5 мг), Z00342-(SEQ ID No: 1)-ONH2 (0,35-0,5 мг) или Z02891-(SEQ ID No: 2)-ONH2 (0,35-0,5 мг). Твердое вещество суспендировали в 25 мкл ddH2O и 8 мкл трифторуксусной кислоты. 25 мкл 18FBA в метаноле (смотри выше) переносили в реакционный флакон. Сосуд закрывали, обжимали, помещали в нагревающий блок и выдерживали при 60°С в течение 15 минут; в этот момент небольшую аликвоту (<5 мкл) извлекали для анализа путем аналитической ВЭЖХ. 450 мкл ddH2O с 0,1% TFA использовали для разбавления раствора до приблизительно 500 мкл в препарате для очистки с использованием полупрепаративной ВЭЖХ. 18FB-Полипептид выделяли и очищали при помощи полупрепаративной ВЭЖХ. Фракцию ВЭЖХ, содержащую продукт (0,113 мКи/4,18 МБк) разбавляли 5:1 с использованием ddH2O и затем иммобилизировали на tC18 Plus Sep Pak (Waters). Sep Pak сначала промывали 5 мл ddH2O, затем 30 мл воздуха. 18FB-Полипептид выделяли в минимальном количестве этанола сначала путем элюирования мертвого объема (приблизит. 0,5 мл) с последующим сбором от 250 до 300 мкл элюента в отдельную колбу. RP-ВЭЖХ анализ осуществляли на выделенном продукте для того, чтобы определить радиохимическую и химическую чистоту. Как правило, 10 мкл 0,1 мкКи/мкл раствора вводили для анализа после приготовления. Радиохимические выходы после выделения указаны в таблице 8, и они скорректированы на угасание после добавления полипептида к 18FBA и радиохимической чистоте >99%. Альтернативно, 18F-меченые полипептиды выделяли посредством NAP5 эксклюзионной хроматографии разбавлением реакционной смеси до приблизительно 0,5 мл с использованием 10 мМ PBS и наносили на гель. 18F-меченые полипептиды выделяли путем элюции колонки с использованием 0,8 мл 10 мМ PBS и использовали без дополнительной модификации. Эти результаты проиллюстрированы в таблице 8 и на фиг.15.

Таблица 8
Соединение Выход после выделения (скорректирован на угасание) (%) ВЭЖХ RCP (%)
Z00477 (SEQ ID No: 4) 0,6%/1,2% 95%
Z00342 (SEQ ID No: 1) 8,2% (10,7%) >99%
Z02891 (SEQ ID No: 2) 6,2% (7,6%) >99%

Используемые условия аналитической ВЭЖХ были следующими: анализ осуществляли на HP Agilent 1100 с G1311A QuatPump, автоинжектором G1313A со шприцем 100 мкл и установленным капилляром 2,0 мл, колонкой Phenomenex Gemini С 18 (4,6 mm × 150 мм), 5µ, 100Å (S/N 420477-10), нагревателем колонок G1316A, G1315A DAD и гамма-детектором Ramon Star - GABI. 95:5 ddH2O:CH3CN с 0,05% TFA, растворитель Б: CH3CN с 0,05% TFA. Градиентная элюция (1,0 мл мин-1): 0 мин 0% Б, 1 мин 15% Б, 21 мин 50% Б, 22 мин 100% Б, 26 мин 100% Б, 27 мин 0% Б, 32 мин 0% Б, или градиентная элюция (1,2 мл мин-1): 0 мин 0% Б, 1 мин 15% Б, 10 мин 31% Б, 10,5 мин 100% Б, 13,5 мин 100% Б, 14 мин 0% Б, 17 мин 0% Б.

Используемые условия полупрепаративной ВЭЖХ были следующими: Очистку осуществляли на Jasco LC с 4-канальным дегазатором DG-2080-54, динамическим смесителем МХ-2080-32 и двумя препаративными насосами PU-2086 Plus, автоинжектором AS-2055 Plus Intelligent с установленным набором для введения большого объема, колонкой Phenomenex 5µ Luna C18(2) 100Å, 250×10 мм, 5µ с предколонкой (S/N 295860-1, P/N OOG-4252-NO), MD-2055 PDA и аналоговым измерителем скорости потока Carroll & Ramsey Associates Model 105S, присоединенным к твердофазному фотодиодному гамма-детектору SiPIN. Градиентная элюция: 0 мин 5% Б, 32 мин 20% Б, 43 мин 95% Б, 46 мин 95% Б, 49 мин 5% Б, растворитель A: ddH2O:CH3CN с 0,05% TFA, растворитель Б: CH3CN с 0,05% TFA.

Исследования in vivo осуществляли с самками голых мышей CD-1 (Charles River Labs, Hopkinton, MA) в возрасте от 6 до 15 недель. Мышей содержали в вентилируемой клетке с достаточным количеством корма и воды и стандартным 12 часовым циклом день-ночь. Для получения ксенотрансплантатов животным инъецировали 100 мкл клеток в PBS. Клетки имплантировали подкожно в правую заднюю конечность. Имплантацию осуществляли под изофлурановой анестезией. Для SKOV3 от 3×106 до 4×106 клеток имплантировали каждой мыши. В этих условиях пригодные для использования опухоли (от 100 до 300 мкг) получали в течение от 3 до 4 недель у более чем 80% инъецированных животных.

Мышам осуществляли инъекции в хвостовую вену приблизительно 1 мкг 99mF-меченых полипептидов (приблизительно 4 мкКи/1 мкг). Мышей помещали в выстланные фильтровальной бумагой клетки до умерщвления. Трех мышей умерщвляли в каждый момент времени и интересующие ткани иссекали и подсчитывали на гамма-счетчике Perkin Elmer Wallac Wizard 1480. Данные собирали для крови, почки, печени, селезенки и области инъекции (хвоста). Мочу из клеток объединяли с мочой из мочевого пузыря и также подсчитывали. Оставшиеся ткани подсчитывали и сумму для всех тканей с мочой для каждого животного суммировали с получением общей инъецированной дозы. Процент инъецированной дозы для каждого органа определяли на основе этой общей величины и органы взвешивали для определения процента инъецированной дозы на грамм (% ИД/г). Данные представлены в виде среднего значения для всех трех мышей в этот момент времени с планками погрешностей, демонстрирующими стандартное отклонение для группы.

Полипептиды исследовали в отношении биораспределения в моделях ксенотрансплантатов опухолевых клеток SKOV3. Четыре момента времени регистрировали в течение четырех часов (5, 30, 120 и 240 минут после инъекции). Данные полного биораспределения включены в таблицу 9 (% ИД/г Z02891 (SEQ ID No: 2) - 18F-фторбензил оксим у мышей, несущих опухоль SKOV3) и таблицу 10 (% ИД/г Z00342 (SEQ ID No: 1) 18F-фторбензил оксим у мышей, несущих опухоль SKOV3). Фиг.16, 17 и 18 демонстрируют графики для опухоли, крови, отношения опухоль:кровь и кривые клиренса для этих тестов.

Полипептид Z02891 (SEQ ID No: 2) 18F-фторбензил оксим демонстрирует сильное поглощение опухолью для экспрессирующих мишень опухолей SKOV3, со значением 17,47±2,89 (n=3) инъецированной дозы на грамм ткани через 240 минут после инъекции (PI). Отношения опухоль:кровь составляли приблизительно 3, 34 и 128 через 30, 120 и 240 мин после инъекции соответственно. Полипептид Z00342 (SEQ ID No: 1) 18F-фторбензил оксим демонстрирует сильное поглощение в опухолях, экспрессирующих мишень SKOV3 со значением 12,45±2,52 (n=3) инъецированной дозы на грамм ткани через 240 минут PI. Отношения опухоль:кровь составляли приблизительно 3, 32 и 53 через 30, 120 и 240 мин после инъекции соответственно.

Для полипептидов показан моноэкспоненциальный клиренс из крови с периодами полувыведения меньше чем две минуты. Такой клиренс для Z02891 (SEQ ID No: 2) главным образом опосредован почками с 0,95±0,07 (n=3) ИД/орган через 240 мин PI. Активность секретируется главным образом в мочу. Поглощение полипептида в селезенке было минимальным, и обнаружено низкое поглощение в печени, прибл. 1,8% ИД/орган (эквивалент величины у мыши для % ИД/г) в процессе исследования (четыре часа после инъекции).

Таблица 9
Поглощение Z02891 (SEQ ID No: 2) 13F-фторбензил оксима (% ИД/г) у мышей, несущих опухоль SKOV-3
5 минут 30 минут 120 минут 240 минут
Кровь 9,23±0,68 (n=3) 2,91±0,23 (n=3) 0,40±0,07 (n=3) 0,14±0,02 (n=3)
Опухоль 2,39±1,13 (n=3) 8,91±2,09 (n=3) 13,47±3,61 (n=3) 17,47±2,89 (n=3)
Печень 4,68±0,45 (n=3) 3,85±0,95 (n=3) 1,57±0,42 (n=3) 1,59±0,83 (n=3)
Почка 72,42±15,61 (n=3) 35,02±5,76 (n=3) 5,22±0,65 (n=3) 2,49±0,17 (n=3)
Селезенка 3,04±1,15 (n=3) 1,46±0,05 (n=3) 0,37±0,01 (n=3) 0,26±0,04 (n=3)
Таблица 10
Поглощение Z00342 (SEQ ID No: 1) 18F-фторбензил оксима (% ИД/г) у мышей, несущих опухоль SKOV-3
5 минут 30 минут 120 минут 240 минут
Кровь 7,38±0,72 (n=3) 1,76±0,09 (n=3) 0,33±0,08 (n=3) 0,87±0,98 (n=3)
Опухоль 2,54±0,00 (n=2) 4,97±3,14 (n=3) 10,30±1,08 (n=3) 12,45±2,52 (n=3)
Печень 8,29±0,41 (n=3) 6,94±0,92 (n=3) 2,54±1,44 (n=3) 1,41±0,35 (n=3)
Почка 78,93±2,93 (n=3) 30,94±4,93 (n=3) 10,75±2,17 (n=3) 4,91±0,63 (n=3)
Селезенка 3,85±0,51 (n=3) 1,77±0,34 (n=3) 0,47±0,08 (n=3) 0,23±0,05 (n=3)

Все реакции осуществляли в атмосфере азота или во флаконе с завинчивающейся крышкой, продуваемом азотом. Ацетонитрил квалификации «Optima™» использовали в качестве растворителя для ВЭЖХ и реакционного растворителя.

[123I]4-Йодбензальдегид (123I ВА) добавляли во флакон с высоким выходом (2 мл, National Scientific), содержащий полипептид-ONH2 (Z02891, SEQ ID No: 2), 0,35-0,5 мг). Реакции осуществляли посредством растворения полипептида в 25 мкл ddH2O и добавления 8 мкл трифторуксусной кислоты, а затем добавления 123IIBA в метаноле. Сосуд закрывали, обжимали, помещали в нагревающий блок и выдерживали при 60°С в течение 15 минут; извлекали небольшую аликвоту (<5 мкл) для анализа посредством аналитической ВЭЖХ для оценки состояния реакции. Реакционную смесь разбавляли до минимум 1:1 смесь с!с1Н20:ацетонитрил, содержащей 0,1% TFA в препарате для полупрепаративной очистки при помощи ВЭЖХ. 123IB-Полипептид выделяли и очищали при помощи полупрепаративной ВЭЖХ или NAP5 эксклюзионной хроматографии. Фракцию ВЭЖХ, содержащую продукт, дополнительно разбавляли (5:1) ddH2O и затем иммобилизировали на tC18 Plus Sep Pak (Waters). Промывка SepPak сначала 5 мл ddH2O, затем продувание 30 мл воздуха позволили получить 123IB-полипептид в минимальном количестве этанола сначала путем элюирования мертвого объема (приблизит. 0,5 мл) с последующим сбором от 250 до 300 мкл элюента в отдельную колбу. Анализ посредством RP-ВЭЖХ осуществляли на выделенном продукте для установления радиохимической и химической чистоты.

Полипептид Z00477 (SEQ ID No: 3) метили Ga, а именно 67Ga, после того, как хелатообразующий агент NOTA (1,4,7-триазациклононан-N,N',N''-триуксусная кислота) конъюгировали с полипептидом (Фиг.19).

Биоконъюгацию Mal-NOTA с молекулами полипептида осуществляли следующим образом. Полипептид разводили свежедегазированным буфером PBS (1×, рН 7,4) до концентрации приблизительно 1 мг/мл. Дисульфидную связь в полипептиде восстанавливали путем добавления раствора DTT в свежедегазированном буфере PBS (1x, рН 7,4). Конечная концентрация DTT составляла 20 мМ. Реакционную смесь перемешивали на вортексе в течение 2 часов и пропускали через обессоливающую центрифужную колонку Zeba (Pierce Technologies), предварительно уравновешенную дегазированным буфером PBS (1x, рН 7,4) для удаления избытка реагента DTT. Элюированные молекулы восстановленного полипептида собирали и добавляли бифункциональное соединение mal-NOTA (15 эквивалентов на эквивалент полипептида) в виде раствора в ДМСО и смесь перемешивали на вортексе при комнатной температуре. Реакцию оставляли протекать в течение ночи для гарантии полного превращения молекул полипептида.

Очистку посредством ВЭЖХ осуществляли на колонке MiCHROM Magic C18AQ 5µ 200А (MiChrom Bioresources, Auburn, CA). Растворитель А: Н2О (с 0,1% муравьиной кислотой), растворитель Б: CH3CN (с 0,1% муравьиной кислотой). Градиент: 5-100% Б в течение 30 мин (Фиг.20А).

Фракции, содержащие желаемый продукт, объединяли и нейтрализовали 100 мМ раствором бикарбоната аммония и растворители удаляли лиофилизацией с получением конъюгированного полипептида в виде белого твердого вещества.

Анализ посредством LC-MS очищенного продукта подтвердил присутствие желаемого продукта, и ММ свидетельствовала о том, что только один хелатообразующий агент NOTA добавлен в конструкцию полипептида (рассчитанная ММ: 7504 Да, обнаруженная: 7506 Да для Z00477 (SEQ ID No: 3)-NOTA). (Фиг.20Б).

Радиоактивное мечение затем осуществляли следующим образом: 25 мкл раствора HEPES (63 мМ) исходно добавляли во флакон с завинчивающейся крышкой, а затем 10 мкл 67GaCl3 (GE Healthcare) в 40,5 МБк 0,04М HCl. 30 мкг (ММ=7506, 4,0×10-9 моль) NOTA Z00477 (SEQ ID No: 3) в 30 мкл H2O затем добавляли в реакционную смесь с получением конечной концентрации NOTA Z00477 (SEQ ID No: 3) 61 мкМ с рН 3,5-4,0. Реакционный флакон закрывали и реакцию поддерживали при температуре окружающей среды. Анализ неочищенной реакционной смеси посредством обращенно-фазовой ВЭЖХ установил, что радиохимическая чистота 37Ga-NOTA Z00477 (SEQ ID No: 3) составляет 95% в соответствии с ВЭЖХ после 2 часов при комнатной температуре (Фиг.21). 37Ga-NOTA Z00477 (SEQ ID No: 3) очищали при помощи ВЭЖХ после времени реакции 1 сутки. 22 МБк 67Ga-NOTA Z00477 (SEQ ID No: 3) вводили в ВЭЖХ для очистки. 15 МБк 67Ga меченного продукта получали в результате очистки (радиохимический выход = 68%). Растворители для ВЭЖХ удаляли в вакууме с получением раствора с приблизительным объемом 0,5 мл. Затем добавляли приблизительно 1,45 мл физиологического раствора, забуференного фосфатом, с получением конечного раствора с рН 6-6,5 и радиоактивной концентрацией 7,7 МБк/мл. Обнаружено, что стабильность очищенного приготовленного 67Ga-NOTA Z00477 (SEQ ID No: 3) составляет по меньшей мере 2 ч при комнатной температуре. (RCP = 96% в соответствии с ВЭЖХ) (Фиг.22).

Используемые условия аналитической ВЭЖХ были следующими: колонка для ВЭЖХ Grace Vydac C4 Protein 5 микрон, 300Å, 4,6×250 мм. Растворитель А = 95/5 H2O/MeCN в 0,05% трифторуксусной кислоте (TFA), растворитель Б = 95/5 CH3CN/H2O в 0,05% TFA. Градиент ВЭЖХ (Мин/%Б): 0/0, 4/20, 16/60, 20/100,25/100,26/0.

Используемые условия полупрепаративной ВЭЖХ были следующими: колонка Grace Vydac C4 Protein 5 микрон, 300Å, 4,6×250 мм. Растворитель А = 95/5 H2O/MeCN в 0,05% трифторуксусной кислоте (TFA). Растворитель Б = 95/5 CH3CN/H2O в 0,05% TFA. Градиент ВЭЖХ (Мин/%Б): 0/0, 4/20, 16/60, 20/100, 25/100, 26/0.

Несмотря на то, что здесь проиллюстрированы и описаны только некоторые особенности изобретения, множество модификаций и изменений будут понятны специалистам в данной области техники. Таким образом, должно быть понятно, что прилагаемая формула изобретения, как предполагается, охватывает все такие модификации и изменения, которые находятся в действительной сущности изобретения.

1. Агент для визуализации экспрессии HER2 (рецептор человеческого эпидермального фактора роста 2 типа), представляющий собой выделенный полипептид, содержащий SEQ ID No: 1 или SEQ ID No: 2, конъюгированный с 99mTc через диаминдиоксимовый хелатообразующий агент Pn216, cPn216 или Pn44, соединенный с С-концевым цистеином выделенного полипептида посредством тиольной реакционноспособной группы; где выделенный полипептид специфически связывается с HER2.

2. Агент для визуализации по п. 1, где 99mTc конъюгирован с выделенным полипептидом через cPn216 хелатообразующий агент.

3. Способ визуализации экспрессии HER2 в по меньшей мере части субъекта, включающий:
введение агента для визуализации по п. 1 субъекту и
визуализацию по меньшей мере части субъекта при помощи диагностического устройства.

4. Способ по п. 3, дополнительно включающий стадии:
мониторинга доставки агента для визуализации по п. 1 субъекту и
постановки диагноза субъекту, страдающему ассоциированным с HER2 болезненным состоянием.

5. Способ приготовления агента для визуализации по п. 1, включающий:
(1) получение выделенного полипептида, содержащего SEQ ID No: 1 или SEQ ID No: 2;
(2) взаимодействие диаминдиоксимового хелатообразующего агента Pn216, cPn21 или Pn44 с С-концевым цистеином полипептида посредством тиольной реакционноспособной группы с образованием полипептида, конъюгированного с хелатообразующим агентом, где диаминдиоксимовый хелатообразующий агент конъюгирован с 99mTc.



 

Похожие патенты:

Изобретение относится к медицине, а именно к фармакологии, и описывает способ определения связывания радиофармпрепарата на основе ципрофлоксацина, меченного 99mTc с бактериями, заключающийся в следующем.

Изобретение относится к области медицины, а именно к способу выявления костных метастазов при почечно-клеточной карциноме (RCC), включающему введение нуждающемуся в этом субъекту эффективного количества 124I-меченного антитела против карбоангидразы-IX или его антигенсвязывающего фрагмента, выполнение визуализации с помощью позитронно-эмиссионной томографии (PTE) для измерения уровня радиации в указанном субъекте и определение костных метастазов.

Изобретение относится к области биохимии и молекулярной биологии. .

Изобретение относится к медицине и может быть использовано для определения сигнальных лимфатических узлов у больных РМЖ. .
Изобретение относится к области медицины, а именно к дерматологии. .

Изобретение относится к медицине, а именно к фтизиопедиатрии. .

Изобретение относится к медицине, а именно пульмонологии. .

Изобретение относится к области биотехнологии и может быть использовано в медицине. .

Изобретение относится к области аналитической химии, в частности радиоаналитической химии, и может быть использовано для определения серы в различных жидких органических системах, в том числе в нефти и продуктах ее переработки.

Изобретение относится к биотехнологии. .

Изобретение относится к области генной инженерии и биотехнологии и может быть использовано в медицине и фармацевтической промышленности. .

Изобретение относится к медицинской биотехнологии и предназначено для выделения и очистки эпидермального фактора роста человека (Ч - ЭФР). .

Изобретение относится к твердофазному способу получения нонапептидов формулы I-III: R - A r g 1 - L y s 2 - L y s 3 - T y r 4 - L y s 5 - T y r 6 - A r g 7 - X a a 8 - L y s 9 - N H 2 , где R = Н, Хаа = L-Arg (I);R = Me, Хаа = L-Arg (II); R = H, Хаа = D-Axg (III).

Изобретение относится к промежуточному соединению формулы (I) для синтеза каспофунгина в котором R1 представляет собой C(=O)NH2, CN или CH2NR3R4; R2 представляет собой CN, CO2R5, C(=O)NR6R7 или фенил; R3 и R4 независимо друг от друга являются атомами водорода; R5 представляет собой атом водорода, линейную или разветвленную C1-6 алкильную группу, С3-8 циклоалкильную группу или фенил; R6 и R7 независимо друг от друга являются атомами водорода, линейными или разветвленными C1-6 алкильными группами, возможно замещенными амино группами, С3-8 циклоалкильными группами или фенилом; или R6 и R7 вместе с атомом азота формируют гетероцикл, кольцо которого включает пять атомов.

Изобретение относится к области биотехнологии, конкретно к модифицированному тамавидину, и может быть использовано для детекции связанной с биотином субстанции. Получают модифицированный биотин-связывающий белок на основе тамавидина с последовательностью SEQ ID NO: 2, который содержит до 7 мутаций и при этом остаток аспарагина в 115 положении заменен на цистеин.

Изобретение относится к области биохимии. Описано изобретение, включающее способ получения антитела против IGF-1R при помощи катионной хроматографии.

Настоящее изобретение относится к биотехнологии. Предложен способ очистки коагуляционного фактора IX (FIX).

Группа изобретений относится к способам синтеза гликопептида, имеющего сиалированную сахарную цепь. Путем реакции этерификации осуществляют связывание смолы, имеющей гидроксильную группу с аминокислотой, у которой азот аминогруппы защищен Вос-группой.
Наверх