Коллекция и способы ее применения



Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения
Коллекция и способы ее применения

 

C40B50/00 -
C40B50/00 -
C40B40/10 -
C40B40/10 -
C40B40/08 -
C40B40/08 -

Владельцы патента RU 2603080:

МорфоСис АГ (DE)

Изобретение относится к области биотехнологии. Описана коллекция пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей, включающих, в частности, белковые последовательности эмбрионального типа, которые предварительно отобраны по функциональным свойствам, относящимся к пригодности к разработке, где коллекции можно применять для выбора в отношении любого антигена, применяя, например, фаговый дисплей. Предложенное изобретение может быть использовано в медицине. 6 н. и 58 з.п. ф-лы, 73 ил., 15 табл., 11 пр.

 

ПЕРЕКРЕСТНАЯ ССЫЛКА

Данная заявка на патент заявляет приоритет по предварительной заявке на патент США порядковый номер 61/494452, зарегистрированной 8 июня 2011 года, и предварительной заявке на патент США порядковый номер 61/415367, зарегистрированной 19 ноября 2010 года, которые включены в качестве ссылки во всей их полноте.

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Настоящая заявка содержит перечень последовательностей, который представили на рассмотрение в формате ASCII посредством EFS-Web, и который включен в данный документ посредством ссылки во всей его полноте. Указанная ASCII копия, созданная 15 февраля 2011 года, названа MS130US.txt и составляет 229568 байт в размере.

ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

Достижения в области фармацевтических разработок, особенно в области терапевтических антител, быстро делают возможным и/или улучшают лечение многих заболеваний. Данные достижения, путем достижения новых целевых пространств и обеспечения новых механизмов действия, все больше улучшают качество жизни пациентов, даже с самыми тяжелыми и сложными заболеваниями. Одной из проблем для системы здравоохранения в целом и пациентов, в частности, является то, что расходы на новые лекарственные средства, доступные благодаря данным фармацевтическим достижениям, также быстро возрастают. Высокие затраты являются результатом капиталовложений, необходимых для разработки фармацевтических препаратов, особенно антител, которые в настоящее время превышают один миллиард долларов на продаваемый продукт. Высокий риск неудачи в разработке и слишком долгие сроки разработки делают такие капиталовложения неизбежными. Может потребоваться более пятнадцати лет с момента идентификации потенциального терапевтического антитела до достижения им рынка и возможности принести пользу пациентам. Каждый этап разработки, от идентификации, доклинического, клинического этапов, до выхода на рынок пронизан проблемами и рисками. Фармацевтические компании постоянно работают над снижением расходов разработки за счет уменьшения сроков и рисков неудачи с целью быстрой доставки наиболее эффективных лекарственных средств в руки пациентов.

Следующее описание изобретения предусматривает ценное достижение, которое позволяет быстрее идентифицировать оптимальные терапевтические антитела для лечения любого заболевания. Возможные варианты терапевтических антител должны удовлетворять ряду критериев разработки с целью достигнуть рынка, таких как, долговременная стабильность, низкая способность к агрегации и высокие результаты экспрессии. Раскрытое достижение повышает вероятность и скорость идентификации антител, которые могут удовлетворить всем строгим критериям разработки с самого начала. Полученное в результате антитело будет менее дорогим в производстве, и будет эффективным и безопасным при лечении многих заболеваний.

Хорошо известным способом идентификации терапевтических антител является применение технологии фагового дисплея. Фаговый дисплей использует вирусоподобные частицы, которые выращены в бактерии, для отображения антител. Одним из преимуществ данной технологии является то, что применяемые библиотеки являются огромными, до 1×1011 антител, которые можно быстро тестировать на связывание с любой мишенью, относящейся к любому заболеванию. Смотри, например, Knappik et al., (2000), "Fully synthetic human combinatorial antibody libraries (HuCAL) based on modular consensus frameworks and CDRs randomized with trinucleotides," J. Mol. Biol. 11; 296(1):57-86, и патент США №6300064, которые оба включены в качестве ссылки во всей их полноте. Преимуществом работы с такими большими количествами является то, что результат скрининга против мишени может привести к сотням антител, которые связываются с терапевтической мишенью, все из которых могут быть терапевтически актуальны. Проблема, однако, состоит в том, что часто только несколько из данных антител подлежат разработке, что означает, что они могут удовлетворять всем строгим критериям, требуемым для достижения рынка.

С целью создания новой коллекции фагового дисплея для сокращения сроков идентификации и уменьшения рисков, коллекция должна включать антитела, обладающие свойствами, которые необходимы для отбора и клинической разработки, и которые приведут к безопасному и эффективному лечению пациентов. Такие свойства включают: 1) высокие показатели фагового дисплея, так что каждое антитело коллекции можно тестировать против интересующей мишени; 2) высокие уровни экспрессии в обоих Fab и IgG1 формах, так что антитело или его фрагмент может воспроизводиться эффективно в необходимом количестве; 3) высокую термическую стабильность в обоих Fab и IgG1 формах для обеспечения структурной и функциональной целостности молекул, доставляемых пациентам; 4) высокую стабильность в сыворотке крови и Fab, и IgG1 форм, так что антитело показывает увеличенный период полувыведения и пролонгированное действие; 5) высокое содержание мономера (% мономера), как определяется с помощью эксклюзионной хроматографии (SEC), и в Fab, и в IgG1 формах, так как это означает низкую способность к агрегации; 6) высокую изоэлектрическую точку (pi) формы IgG1; 7) высокую термическую стабильность и в Fab, и в IgG формах до и после воздействия кислоты, 8) низкую мутность Fab или IgG1 форм до и после воздействия кислоты; 9) стабильный радиус молекулы и % полидисперсности до и после воздействия кислоты, 10) низкий риск иммуногенности, тем самым повышая безопасность и/или 11) большое разнообразие, так что одну коллекцию можно применять для идентификации многих антител против любой терапевтической мишени.

Коллекцию, которая существенным образом имитирует иммунную систему человека, следует считать очень ценным, или даже оптимальным решением. Иммунная система человека состоит из антител, кодируемых генами эмбрионального типа. Антитела, в частности, состоят из вариабельного участка тяжелой цепи и вариабельных участков легких цепей. Существует приблизительно 50 генов эмбрионального типа вариабельного участка тяжелой цепи и приблизительно 50 генов эмбрионального типа вариабельного участка легкой цепи, в сочетании обеспечивая около 2500 комбинаций различных пар вариабельных участков тяжелой и легкой цепи. Как полагают, у человека получат все 2500 этих комбинаций. Установлено, однако, что определенные вариабельные участки тяжелых цепей, вариабельные участки легких цепей и/или комбинации (пары) вариабельных участков тяжелых и легких цепей присутствуют на более высоком уровне, чем другие. Высказали предположение, что должна существовать какая-либо причина того, что некоторые присутствуют в большей степени, чем другие, и если так, то присутствующие в высшей степени гены эмбрионального типа могут обладать благоприятствующими функциональными свойствами. Таким образом, один из способов получения коллекции антител, обладающих благоприятствующими функциональными свойствами, заключается в создании коллекции, включающей часто встречающийся вариабельный участок тяжелой цепи, вариабельный участок легкой цепи, и/или пары вариабельных участков тяжелой цепи и легкой цепи, присутствующих в человеческом иммунном репертуаре.

В добавление, последовательности генов эмбрионального типа, присутствующие в организме человека, как полагают, обладают очень низкой иммуногенностью по очевидным причинам, поэтому данные последовательности можно имитировать в рекомбинантных антителах с целью снижения риска иммуногенности.

Предпринимались подходы к оценке пар генов эмбрионального типа вариабельных участков тяжелой и легкой цепей, распространенных в человеческом иммунном репертуаре. Смотри de Wildt et al., Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire, J Mol Biol. 22; 285(3):895-901 (January 1999), которая включена в качестве ссылки в полном объеме. Вильдт (Wildt) и соавторы взяли образцы крови у человеческих доноров, отсортировали IgG+ В-клетки, которые подверглись соматической гипермутации, амплифицировали кДНК с помощью ПЦР, секвенировали каждую последовательность кДНК, и привели каждую последовательность в соответствие с известными человеческими генами эмбрионального типа вариабельного домена. Вильдт (Wildt) и соавторы наблюдали, что лишь несколько генов эмбрионального типа доминируют в иммунном репертуаре, и что часто повторяемые сегменты генов тяжелой и легкой цепей часто являются спаренными.

Также предпринимались попытки поддержания пар вариабельного домена тяжелой и легкой цепи отдельных В клеток. Например, раскрыли библиотеки вариабельного домена "родственных пар" ("cognate pairs"). Смотри Meijer et al., Isolation of human antibody repertoires with preservation of the natural heavy and light chain pairing, J Mol Biol., 358(3):764-72 (May 5 2006); и WO 2005042774, которые оба включены в качестве ссылки во всей их полноте. Библиотеки, в соответствии с методами, описанными у Мейджер (Meijer) и соавторов, создали из отдельных В клеток от иммунизированного хозяина. Как правило, В-клетки сортируются по FACS так, что отбирают CD38HI В-клетки, которые представляют соматически гипермутированные клетки, их кДНК амплифицируют с помощью ПЦР, и продукты гена антитела вставляют в Fab векторы для отбора. Такие библиотеки родственных пар не лишены своих ограничений. Например, хозяева, предоставляющие В-клетки, обычно являются иммунизированными; и отсортированные популяции В клеток являются гипермутированными, таким образом, библиотеки, полученные в результате, смещены по направлению к конкретному иммуногену.

Дополнительно, предпринимались попытки использования выраженного вариабельного участка тяжелой цепи или вариабельного участка легкой цепи для создания коллекции. Например, в Shi et al., "De Novo Selection of High-Affinity Antibodies from Synthetic Fab Libraries Displayed on Phage as pIX Fusion Proteins; J Mol Biol., 397(2):3 85-96 (March 26, 2010) и соответствующей заявке на патент WO 2009085462; и WO 2006014498, которые включены в качестве ссылки во всей их полноте. Таким образом, белковые последовательности эмбрионального типа вариабельного участка тяжелой цепи или вариабельного участка легкой цепи включили в библиотеки на основе их частоты использования в человеческом иммунном репертуаре.

Также предпринимались дополнительные попытки, которые включают специфическую пару эмбрионального типа в коллекцию. Например, WO 1999020749, который включен в качестве ссылки во всей его полноте, описывает коллекцию, где ее элементы содержат тяжелые цепи, обладающие канонической структурой гипервариабельной петли, кодируемые сегментом гена человеческой эмбрионального типа тяжелой цепи DP-47 (IGHV3-23), и/или каркасные участки, кодируемые геном эмбрионального типа, и/или легкие цепи, обладающие канонической структурой гипервариабельной петли, кодируемые сегментом гена человеческой эмбрионального типа легкой цепи 02/012 (IGKV1-39/1D-39), и/или каркасные участки, кодируемые геном эмбрионального типа.

Дополнительные подходы создали библиотеки непосредственно из или происходящие от В-клеток. Например, Glanville et al. Precise Determination of the Diversity of a Combinatorial Antibody Library Gives Insight into the Human Immunoglobulin Repertoire, Proc Natl Acad Sci 1; 106(48):20216-21 (December 2009), которая включена в качестве ссылки во всей полноте, и которая описывает коллекцию антител, построенную из разновидностей 654 репертуаров иммуноглобулинов М (IgM) человеческого донора. В частности, кДНК V-гена тяжелой и легкой цепей от 654 человеческих доноров отдельно ПЦР-амплифицировали (разделяя пару вариабельных участков тяжелой и легкой цепи), и домены тяжелой и легкой цепей затем повторно связали случайным образом. WO 2003052416, который включен в качестве ссылки во всей его полноте, также описывает выделение В-клеток от хозяина, показывающего выраженный ответ на интересующий патоген, в результате либо инфекции микроорганизмом. либо лечения вакциной. В WO 2003052416, кДНК, кодирующую область CDR3 вариабельных участков, секвенировали, и сконструировали фрагменты антител, включающие в себя доминирующие CDR3. WO 2009100896, который включен в качестве ссылки во всей его полноте, описывает выделение В-клеток от иммунизированного хозяина, где кДНК, кодирующие вариабельные участки тяжелой и легкой цепей, секвенировали и определили относительное содержание неспаренных последовательностей вариабельных участков тяжелых и вариабельных участков легких цепей. В WO 2009100896, синтезировали библиотеки, включающие случайным образом рекомбинированные вариабельные участки тяжелой и легкой цепей, где антитела являлись специфичными для одного иммуногена. Краткое изложение данных и дополнительных подходов можно найти в in Fuh et al., Synthetic antibodies as therapeutics, Expert Opin Biol Ther., 7(1):73-87 (January 2007), которая включена в виде ссылки во всей полноте.

Следовательно, существует высокая потребность в коллекции антител или их фрагментов, которые включают пары генов вариабельных участков тяжелых и генов вариабельных участков легких цепей, присутствующих в человеческом иммунном репертуаре, которые обладают благоприятствующими биофизическими свойствами, относящимися к разработке, и в то же время, исключая пары, которые существуют в природе, но не обладают такими биофизическими свойствами. Данные и другие потребности удовлетворяются настоящим изобретением.

КРАТКОЕ ИЗЛОЖЕНИЕ

Настоящее изобретение предусматривает ценное решение проблемы эффективной идентификации антител или фрагментов антител к любому антигену, которые подходят для разработки и являются безопасными и эффективными для пациентов. В самом общем смысле, авторы настоящего изобретения начали с идеи, что коллекция антител, которая имитирует иммунную систему человека в основных направлениях, может являться выгодной. С одной стороны, авторы настоящего изобретения решили имитировать иммунную систему человека путем включения оптимальных последовательностей генов эмбрионального типа или их частей из человеческого иммунного репертуара в антитела. Таким образом, в некоторых вариантах осуществления антитела коллекции содержат части, например, каркасные участки, которые принадлежат к эмбриональному типу, в последовательности. Применение последовательностей эмбрионального типа должно значительно уменьшить риск иммуногенности рекомбинантных антител для терапевтического применения у пациентов.

В дополнение, авторы настоящего изобретения работали со своей гипотезой, что пары генов эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, широко распространенные в человеческом иммунном репертуаре, вероятно, обладают благоприятными биофизическими свойствами, что ведет к более эффективной клинической разработке и повышению безопасности и эффективности полученных антитела для пациентов. В качестве исходных данных, каждая В-клетка кодирует одно антитело, и каждое антитело содержит вариабельный участок тяжелой цепи и вариабельный участок легкой цепи. Каждый из вариабельного участка тяжелой цепи и вариабельных участков легких цепей антитела можно согласовать с последовательностями эмбрионального типа с целью определения происхождения антитела, то есть каким геном эмбрионального типа кодируются вариабельный участок тяжелой цепи и вариабельный участок легкой цепи. Таким образом, для каждого антитела вариабельный участок тяжелой цепи и вариабельный участок легкой цепи включают ген эмбрионального типа или белковую пару эмбрионального типа, например, VH3-23 в паре с VK1-5.

С целью доказать гипотезу, что выраженные пары генов эмбрионального типа, вероятно, обладают благоприятствующими биофизическими свойствами, первым шагом явилось определение пар генов эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, выраженных в человеческом иммунном репертуаре. Это достигалось путем экстенсивного поиска общедоступной литературы и отбора образцов В-клеток от человеческого хозяина. В качестве следующего шага, эти данные объединили, проанализировали, и пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, присутствующие в человеческом иммунном репертуаре, ранжировали с точки зрения их распространенности. Из этих данных стало ясно, что определенные пары генов эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи присутствовали чаще, чем другие в человеческом иммунном репертуаре.

В качестве следующего шага следовало определить, какие белковые пары эмбрионального типа предназначены для тестирования на функциональные свойства, относящиеся к разработке, так как существует 2500 пар в человеческом иммунном репертуаре, и тестирование каждой из них не является предпочтительным. Должен существовать один способ для тестирования белковых пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые встречаются наиболее заметно в человеческом иммунном репертуаре, например, смотри таблицу 6. Можно, например, выбрать основные четыреста пар для тестирования, или выбрать пары генов эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, присутствующие на уровне или выше определенного порогового числа. Данный подход потребует синтез и тестирование очень большого количества белковых последовательностей пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи; следовательно, такой подход может оказаться не очень эффективным.

В качестве альтернативного подхода, авторы настоящего изобретения выбрали подмножество пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые являются репрезентативными, точно воспроизводят или охватывают большинство выраженных пар человеческого иммунного репертуара. Данный подход основывался, в частности, на том наблюдении, что небольшое число генов (непарных) эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи являются доминирующими в человеческом иммунном репертуаре. Вилдт и соавторы на 895-896 описывают данное явление. Вилдт и соавторы также утверждают, что широко распространенные сегменты генов тяжелой и легкой цепи часто находятся в паре, и наблюдали, что половина пар, отобранных в качестве пробы, соответствовали только пяти парам эмбрионального типа. Таким образом, небольшое число выраженных генов (непарных) эмбрионального типа тяжелой и легкой цепей можно объединить для создания группы пар тяжелой и легкой цепей, которые являются репрезентативными для человеческого иммунного репертуара.

Данный подход предприняли следующим образом. Данные, демонстрирующие сцепленные VH/VL пары, смотри, например, таблицу 6, и данные, идентифицирующие присутствие несцепленных VH или VL цепей, смотри, например, пример 3 и таблицу 5, проанализировали для определения генов (непарных) эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи, которые выражены в человеческом иммунном репертуаре.

В качестве следующего шага выраженные белковые последовательности (непарные) эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи оценили для определения их биофизических свойств, относящиеся к разработке, смотри пример 4. Белковые последовательности эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи оценили in silico по следующим свойства: (i) длина определяющей комплементарность области (CDR), (ii) изоэлектрическая точка (pi) (предпочтительная изоэлектрическая точка составляет 7,5 или выше, так как она должна обеспечить стабильность в нейтральном или слабокислом буфере состава), (iii) потенциальные сайты для потенциальных посттрансляционных сайтов модификации (РТМ) (в частности, N-связанные сайты гликозилирования (NxS или NxT) или химических модификаций, таких как Asp расщепление (часто DP или DQ), (iv). Asp изомеризация (DS, DG), (v) деамидирование (NS, NG), которое может происходить in vivo (в сыворотке крови) или при хранении в буфере состава, и приводить к потере связывания антигена, (vi) присутствие метионина в CDR (может быть предрасположен к окислению при контакте с растворителем), (vii) присутствие непарного цистеина (образует дисульфидные связи с любым другим непарным цистеином, таким образом, приводя к сшиванию белков и/или понижению уровней экспрессии), (viii) отклонения от эмбрионального типа, (ix) присутствие возможных Т-клеточных эпитопов и (x) теоретическая способность к агрегации.

В качестве следующего шага белковые последовательности эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи, обладающие in silico биофизическими характеристиками, комбинировали с формированием пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи. Как показано в таблице 5 и на фигурах 2-3, в основном, ведущие 20 VH, ведущие 8 Vλ и 12 ведущих Vk отобрали для синтеза, комбинации и последующего функционального анализа. Последовательности генов эмбрионального типа синтезировали, а затем комбинировали в целях получения 400 белковых пар эмбрионального типа (20VH Х 20VL), которые являются репрезентативными, точно воспроизводят или охватывают большинство выраженных пар из человеческого иммунного репертуара, как показано в таблице 6. Данное осуществили путем синтезирования генов эмбрионального типа вариабельных участков тяжелой и легкой цепей, комбинирования их в пары, экспрессирования пар в виде белка (белковые пары эмбрионального типа) и тестирование каждой пары для определения их биофизических свойств. Тестировали следующие свойства: (i) относительный уровень отображения на фаге формы Fab, (ii), относительный уровень экспрессии формы Fab, например, в E.coli, (iii) термическую стабильность формы Fab, (iv) стабильность в бычьей или мышиной сыворотке формы Fab; (v) относительный уровень экспрессии формы IgG1 и (vi), стабильность в бычьей сыворотке в IgG1 форме.

Тестирование 400 белковых пар эмбрионального типа на отображение, экспрессию, термическую стабильность и стабильность в сыворотке выступало в качестве предварительного фильтра для удаления белковых пар эмбрионального типа, которые, хотя они существуют в природе, не обладают биофизическими свойствами, которые, как считают, благоприятствуют терапевтической разработке. Цель состояла в том, чтобы выбрать подгруппу белковых пар эмбрионального типа, обладающих благоприятными характеристиками пригодности к разработке, и в то же время поддерживающих высокий уровень разнообразия в пределах коллекции, так что коллекцию можно применять для идентификации подходящих для разработки кандидатов против любого антигена. Таблица 12 показывает 60 жирным шрифтом и подчеркнутых белковых пар эмбрионального типа, которые удовлетворяли пороговым величинам варианта осуществления описания данного изобретения. Таблицу 12 ранее раскрыли в WO 2010/136598 (MorphoSys AG), которая притязает на приоритет по 61/182350 и 61/299401, которые все включены в качестве ссылки во всей их полноте.

Из 400 протестированных белковых пар эмбрионального типа (результаты представлены в таблице 12), 95 отобрали для дальнейшего тестирования. Из 95 белковых пар эмбрионального типа, отобранных для дальнейшего тестирования, некоторые выбрали потому, что они удовлетворяли предыдущим критериям, и являлось желательным дополнительно их протестировать. Другие выбрали, несмотря на несоответствие определенным пороговым значениям, так что данные пары могли переоцениваться. 95 белковых пар эмбрионального типа, показанных на фигурах 16-24, синтезировали, экспрессировали, очистили и затем тестировали в формах Fab и IgG1 по следующим показателям: а) экспрессия очищенного Fab в мг/л, b) содержание мономера очищенного Fab (% мономера), с) термостабильность очищенного Fab, d) экспрессия очищенного IgG1 в мг/л, е) содержание мономера очищенного IgG1 (% мономера), f) термостабильность очищенного IgG1, g) изоэлектрическая точка IgG1 и h) стресс-тестирование IgG1 с воздействием кислоты, включая дифференциальную сканирующую флуорометрию (DSF), абсорбцию, динамическое рассеяние света и окрашивание частиц.

В одном варианте осуществления следующие белковые пары идентифицировали как обладающие превосходной функциональной активностью, связанную с пригодностью к разработке (данные показано на фигурах 16-24): VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO-210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:; VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)/VL1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252). В частности, в данном варианте осуществления белковые пары эмбрионального типа (54) обладали значениями, равными или превышающими следующие пороговые значения для каждого критерия: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1), по меньшей мере, 2,5 мг/л, b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1), по меньшей мере, 30,0 мг/л, с) термостабильность очищенного Fab (описываемая в примере 9.1.2), по меньшей мере, 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2), по меньшей мере, 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3), по меньшей мере, 98%; и f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3), по меньшей мере, 99%. Таким образом, коллекции, включающие любое количество данных пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, можно применять для идентификации пригодных для разработки антител или их фрагментов к любому антигену.

По сравнению с таблицей 32 WO 2010/136598, таблица 32 показывает только 21 из 54 пар как обладающих определенными различными функциональными свойствами.

Варианты осуществления настоящего изобретения включают коллекции, которые содержат подмножество белковых пар эмбрионального типа выше (36 из 54), обладающих превосходной функциональной активностью, связанной с пригодностью к разработке. В одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, где антитела или их функциональные фрагменты содержат пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные области пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK:1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252). В данном варианте осуществления подмножество (36) белковых пар эмбрионального типа выбрали из 54 белковых пар эмбрионального типа, основываясь на данных стресс-тестирования. Данные стресс-тестирования идентифицировали с применением способов, описанных в примерах 9.2.5 (a-d), данных, показанных на фигурах 19-24, примере 9.2.6 (a-d), данных, показанных на рисунках 19-54 и примере 9.2.7, оценки, показанной на рисунках 55-60. Стресс-тестирование оценило 95 белковых пар эмбрионального типа формы IgG1 с целью определения их способности противостоять воздействию кислот и встряхиванию со стеклянными шариками. Способность антитела противостоять воздействию кислот является все более важным фактором, по мере того как шаг инактивации вируса является стандартным в технологии производства и выделения целевого продукта (DSP) согласно стандартам химических свойств, процесса производства и контроля качества (CMC). Способность антител или фрагментов антител противостоять напряжению сдвига является полезным критерием, так как невозможно избежать шагов фильтрации во время обработки, и напряжение сдвига происходит во время введения через иглу шприца или эластичные катетеры.

Приведенная выше коллекция подмножества, (36) белковых пар эмбрионального типа варианта осуществления выбрали, так как они обладают дополнительными превосходными функциональными свойствами, относящимися к пригодности к разработке, так как они показали более сильную устойчивость к стрессу кислотой и взбалтыванием, чем другие пары из 54. 36 белковых пар эмбрионального типа, выбранных в данном варианте осуществления, обладали значениями на уровне или выше следующих пороговых значений для каждого критерия: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1), по меньшей мере, 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1), по меньшей мере, 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2), по меньшей мере, 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2), по меньшей мере, 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3), по меньшей мере, 98%; f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3), по меньшей мере, 99%; и g) кумулятивная оценка стресс-тестирования (описываемая в примере 9.2.7), по меньшей мере, 1225.

По сравнению с таблицей 32 WO 2010/136598, таблица 32 показывает только 14 из 36 пар, как обладающие определенными отличными функциональными свойствами. Кроме того, WO 2010/136598 не раскрывает специфические комбинации 36 пар. В другом варианте осуществления пороговые значения для каждого критерия выбрали следующим образом: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1), по меньшей мере, 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1), по меньшей мере, 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2), по меньшей мере, 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2), по меньшей мере, 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3), по меньшей мере, 99%; f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3), по меньшей мере, 99%; g) изоэлектрическая точка очищенного IgG1 (описываемая в примере 9.2.4), по меньшей мере. 8,3; и h) кумулятивная оценка стресс-тестирования (описываемая в примере 9.2.7), по меньшей мере, 1225. В данном варианте осуществления коллекция включает (33 пары): VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

По сравнению с таблицей 32 WO 2010/136598, таблица 32 показывает только 14 из 33 пар, как обладающие определенными отличными функциональными свойствами. Кроме того, WO 2010/136598 не раскрывает специфическую комбинацию 33 пар.

В дополнительном варианте осуществления пары добавили к коллекции, несмотря на то, что сами пары не отвечали всем пороговым значениям в каждом критерии, но их добавили к коллекции в целях повышения разнообразия. В одном варианте осуществления коллекция дополнительно содержит: VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); и VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256). В данном варианте осуществления коллекция содержит (36 пар): VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238): VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Такие коллекции преодолевают многие из проблем предшествующего уровня техники. Например, коллекции, полученные из В-клеток, включают пары VH/VL, которые не обладают благоприятными биофизическими свойствами, так как VH и VL пары, присутствующие в такой коллекции, идентичны парам, присутствующим в образце В-клеток. Если отбирается достаточно широкий образец В-клеток, будет присутствовать каждая из комбинаций спаривания из примерно 50 VH и 50 VL класса (2500). Обширное тестирование VH и VL пар в настоящем описании изобретения показывает, что многие из пар генов эмбрионального типа VH и VL (белковых пар эмбрионального типа), которые существуют в природе, не обладают свойствами, которые позволили бы их разработку в клинике. Поэтому такие библиотеки В-клеток включают многие VH и VL пары, которые вероятно не пригодны к разработке. Таким образом, может являться желательным создание библиотеки большого разнообразия, включающей VH и VL пары, обладающие выгодными функциональными свойствами, но с подходом коллекции В-клеток, данное не является возможным.

Например, одним из аспектов настоящего изобретения является коллекция из антител или функциональных фрагментов, содержащих белковые пары эмбрионального типа вариабельных участков тяжелой и легкой цепей, обладающих выгодными свойствами, которые увеличивают пригодность к разработке, но исключая пары генов эмбрионального типа вариабельных участков тяжелой и легкой цепей, которые не обладают такими свойствами, даже если они заметно выражены в человеческом иммунном репертуаре. Таким образом, коллекцию разработали для исключения комбинаций или пар вариабельных участков тяжелой и легкой цепей, которые встречаются в природе (из 2500 пар), которые не обладают выгодными функциональными свойствами. Например, VH4-34 часто встречается в человеческом иммунном репертуаре, как показано в таблице 5, но известно также, что антитела, полученные от данного гена эмбрионального типа тяжелой цепи, могут являться цитотоксическими В-клетками, таким образом, антитела, полученные от этого гена можно исключить из разработки коллекции. Смотри Bhat et al., Rapid cytotoxicity of human В lymphocytes induced by VH4-34 (VH4.21) gene-encoded monoclonal antibodies, Clin Exp Immunol., 105(1):183-90 (July 1996).

ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ

На Фигуре 1 показаны сайты рестрикции, выбранные для включения в С-конец сигнальных последовательностей phoA и ompA E.coli, как подробно описывается в примере 1, и включает сайты рестрикции вокруг CDR 3 и их соответственные ориентации. Данная фигура при отображении сигнальных последовательностей E.coli, также представляет C-концевые сайты рестрикции, выбранные для включения в лидерные последовательности человеческой тяжелой цепи и каппа цепи для применения в экспрессии IgG1, что также подробно описывается в примере 1.

На Фигуре 2 показаны 20 генов эмбрионального типа VH, выбранных для синтеза, комбинации и определения функциональных характеристик, которые подробно описываются в примере 4. Фигура также демонстрирует результаты in silico анализа каждого гена эмбрионального типа, где pi представляет изоэлектрическую точку, РТМ являются потенциальными сайтами посттрансляционных модификаций в области, определяющей комплементарность, описываемыми в данном документе, NxS/T являются N-связанными сайтами гликозилирования, и Met в CDR являются метионинами.

На Фигуре 3 показаны 8 Vλ и 12 Vk генов эмбрионального типа, выбранных для синтеза, комбинации и определения функциональных характеристик, которые подробно описываются в примере 4. Фигура также демонстрирует результаты in silico анализа каждого гена эмбрионального типа, где pi представляет изоэлектрическую точку, РТМ являются потенциальными сайтами посттрансляционных модификаций в области, определяющей комплементарность, описываемыми в данном документе, NxS/T являются N-связанными сайтами гликозилирования, и Met в CDR являются метионинами. На данной фигуре VL означает Vλ.

На Фигуре 4 показаны пары VH/Vk объединенных данных из примеров 2.1 и примера 2.2. Числовые записи представляют количество каждой VH/Vk генной пары эмбрионального типа из отдельной В-клетки, идентифицированной в объединенных данных. Ось Y показывает VH гены эмбрионального типа, ранжированные сверху (самый распространенный) VH3-23 вниз (менее распространенный) VH3-20 с точки зрения частоты экспрессии в объединенных данных. Ось Х показывает Vk гены эмбрионального типа, ранжированные слева (самый распространенный) IGKV3-20 направо (менее распространенный) IGKV1D-17 с точки зрения частоты экспрессии в объединенных данных. Число 1358 является количеством отобранных образцов В-клеток.

На Фигуре 5 показаны пары VH/Vλ объединенных данных из примеров 2.1 и примера 2.2. Числовые записи представляют количество каждой VH/Vλ генной пары эмбрионального типа из отдельной В-клетки, идентифицированной в объединенных данных. Ось Y показывает VH гены эмбрионального типа, ранжированные сверху (самый распространенный) VH3-23 вниз (менее распространенный) VH3-20 с точки зрения частоты экспрессии в объединенных данных. Ось Х показывает Vλ гены эмбрионального типа, ранжированные слева (самый распространенный) IGLV2-14 направо (менее распространенный) IGLV4-60 с точки зрения частоты экспрессии в объединенных данных. Число 779 является количеством отобранных образцов В-клеток.

На Фигурах 6А-С показаны аминокислотные последовательности, кодируемые генами эмбрионального типа VH (SEQ ID NO:63-118, соответственно, в порядке появления), которые описаны в Tomlinson et al. (1992), "The Repertoire of Human Germline Vh Sequences Reveals about Fifty Groups of Vh Segments with Different Hypervariable Loop" J. Mol. Biol. 227, 776-798; Matsuda et al. (1998), "The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus" J Exp Med 188(11):2151-62; и LeFranc MP (2001) "Nomenclature of the human immunoglobulin heavy (IGH) genes". Exp Clin Immunogenet. 18(2):100-16.

На Фигурах 7А-С показаны аминокислотные последовательности, кодируемые генами эмбрионального типа Vk (SEQ ID NO:119-164, соответственно, в порядке появления), которые описаны в Schable and Zachau (1993), "The variable genes of the human immunoglobulin kappa locus," Biol. Chem Hoppe Seyler. 374(11):1001-22; Brensing-Kuppers et al. (1997), "The human immunoglobulin kappa locus on yeast artificial chromosomes (YACs)" Gene. 191(2):173-81; Kawasaki et al. (2001), "Evolutionary dynamics of the human immunoglobulin kappa locus and the germline repertoire of the Vkappa genes" Eur J Immunol 31(4):1017-28; и Lefranc MP (2001) "Nomenclature of the human immunoglobulin kappa (IGK) genes" Exp Clin Immunogenet., 18, 161-174.

На Фигурах 8А-В показаны аминокислотные последовательности, кодируемые генами эмбрионального типа Vλ (SEQ ID NO:165-202, соответственно, в порядке появления), которые описаны в Kawasaki et al., (1997) "One-Megabase Sequence Analysis of the Human immunoglobulin lambda Gene Locus" Genome Research 7(3):250-61; Frippiat et al., (1995) "Organization of the human immunoglobulin lambda light-chain locus on chromosome 22q11.2" Hum. Mol. Genet., 4, 983-991; и LeFranc MP (2001) "Nomenclature of the human immunoglobulin lambda (IGL) genes. Exp Clin Immunogenet.; 18:242-254.

На Фигуре 9 показан pJPd1 трицистронный фаговый дисплейный вектор.

На Фигуре 10 показан pJPx1 вектор экспрессии Fab.

На Фигуре 11 показан pMx11 (pMORPHX11) вектор экспрессии Fab.

На Фигуре 12 показан pMORPH30 дисплейный вектор Fab.

На Фигуре 13 показан pJP_h_IgG1f вектор экспрессии вариабельного участка тяжелой цепи IgG1.

На Фигуре 14 показан pJP_h_Ig_kappa вектор экспрессии вариабельного участка k легкой цепи IgG.

На Фигуре 15 показан pJP_h_Ig_lambda2 вектор экспрессии вариабельного участка λ легкой цепи IgG.

На Фигуре 16 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует продуктивность экспрессии очищенного Fab в мг/л (культура), содержание мономера очищенного Fab (% мономера), термостабильность очищенного Fab в °С, продуктивность экспрессии очищенного IgG1 в мг/л (клеточная культура), содержание мономера очищенного IgG1 (% мономера), термостабильность очищенного IgG1 в °С (показанный переход является переходом вариабельных доменов, переход Fc-доменов не показан) и изоэлектрическую точку IgG1 тестированных белковых пар эмбрионального типа под номерами 1-32. Эти данные определили с применением методов, описанных в примере 9.1.1-9.1.3 и 9.2.1-9.2.4. На данной фигуре VL означает Vλ.

На Фигуре 17 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует продуктивность экспрессии очищенного Fab в мг/л (культура), содержание мономера очищенного Fab (% мономера), термостабильность очищенного Fab в °С, продуктивность экспрессии очищенного IgG1 в мг/л (клеточная культура), содержание мономера очищенного IgG1 (% мономера), термостабильность очищенного IgG1 в°С (показанный переход является переходом вариабельных доменов, переход Fc-доменов не показан) и изоэлектрическую точку IgG1 тестированных белковых пар эмбрионального типа под номерами 33-64. Эти данные определили с применением методов, описанных в примере 9.1.1-9.1.3 и 9.2.1-9.2.4. На данной фигуре VL означает Vλ.

На Фигуре 18 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует продуктивность экспрессии очищенного Fab в мг (очищенный Fab) /л (культура), содержание мономера очищенного Fab (% мономера), термостабильность очищенного Fab в °С, продуктивность экспрессии очищенного IgG1 в мг (очищенный IgG1) /л (клеточная культура), содержание мономера очищенною IgG1 (% мономера), термостабильность очищенного IgG1 в °С (показанный переход является переходом вариабельных доменов, переход Fc-доменов не показан) и изоэлектрическую точку IgG1 тестированных белковых пар эмбрионального типа под номерами 33-64. Эти данные определили с применением методов, описанных в примере 9.1.1-9.1.3 и 9.2.1-9.2.4. На данной фигуре VL означает Vλ.

На Фигуре 19 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует термостабильность в °С (кажущаяся Tm) до и после воздействия кислоты (данная кажущаяся Tm соответствует разворачиванию вариабельных доменов, средняя точка разворачивания Fc-доменов не показана), которую определили с применением дифференциальной сканирующей флуорометрии, как описано в примере 9.2.5 (а), относительное изменение мутности на основе УФ-поглощения до и во время воздействия кислоты, и после нейтрализации, как описано в примере 9.2.5 (b). Приведенные данные являются данными тестируемых белковых пар эмбрионального типа под номерами 1-32. На данной фигуре VL означает Vλ.

На Фигуре 20 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует радиус частиц (нм) до и после воздействия кислоты и полидисперсность до и после воздействия кислоты, как описано в примере 9.2.5 (с), окрашивание частиц до и после кислоты, как описано в примере 9.2.5 (d), a также кумулятивную оценку, как описано в примере 9.2.7. Приведенные данные являются данными тестируемых белковых пар эмбрионального типа под номерами 1-32. На данной фигуре VL означает Vλ.

На Фигуре 21 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует термостабильность в °С (кажущаяся Tm) до и после воздействия кислоты (данная кажущаяся Tm соответствует разворачиванию вариабельных доменов, средняя точка разворачивания Fc-доменов не показана), которую определили с применением дифференциальной сканирующей флуорометрии, как описано в примере 9.2.5 (а), относительное изменение мутности на основе УФ-поглощения до и во время воздействия кислоты, и после нейтрализации, как описано в примере 9.2.5 (b). Приведенные данные являются данными тестируемых белковых пар эмбрионального типа под номерами 33-64. На данной фигуре VL означает Vλ.

На Фигуре 22 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует радиус частиц (нм) до и после воздействия кислоты и полидисперсность до и после воздействия кислоты, как описано в примере 9.2.5 (с), окрашивание частиц до и после кислоты, как описано в примере 9.2.5 (d), а также кумулятивную оценку, как описано в примере 9.2.7. Приведенные данные являются данными тестируемых белковых пар эмбрионального типа под номерами 33-64. На данной фигуре VL означает Vλ.

На Фигуре 23 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует термостабильность в °С (кажущаяся Tm) до и после воздействия кислоты (данная кажущаяся Tm соответствует разворачиванию вариабельных доменов, средняя точка разворачивания Fc-доменов не показана), которую определили с применением дифференциальной сканирующей флуорометрии, как описано в примере 9.2.5 (а), относительное изменение мутности на основе УФ-поглощения до и во время воздействия кислоты, и после нейтрализации, как описано в примере 9.2.5 (b). Приведенные данные являются данными тестируемых белковых пар эмбрионального типа под номерами 65-95. На данной фигуре VL означает Vλ.

На Фигуре 24 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует радиус частиц (нм) до и после воздействия кислоты и полидисперсность до и после воздействия кислоты, как описано в примере 9.2.5 (с), окрашивание частиц до и после кислоты, как описано в примере 9.2.5 (d), а также кумулятивную оценку, как описано в примере 9.2.7. Приведенные данные являются данными тестируемых белковых пар эмбрионального типа под номерами 65-95. На данной фигуре VL означает Vλ.

На Фигуре 25 показаны белковые последовательности эмбрионального типа VH (SEQ ID NO:204-216, соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:217-229, соответственно, в порядке появления) областей каркаса 1 и HCDR1 определенных вариабельных участков тяжелых цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Показанные гены эмбрионального типа являются теми же, что показаны на фигуре 6, но включают только VH гены эмбрионального типа, выбранные для вариантов осуществления коллекции.

На Фигуре 26 показаны белковые последовательности эмбрионального типа VH (SEQ ID NO:204-216 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:217-229 (продолжение), соответственно, в порядке появления) областей каркаса 2 и HCDR2 определенных вариабельных участков тяжелых цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для E.coli экспрессии, избегая редких человеческих кодонов. Продемонстрированные гены эмбрионального типа являются теми же, что показаны на фигуре 6, но включают только VH гены эмбрионального типа, выбранные для вариантов осуществления коллекции.

На Фигуре 27 показаны белковые последовательности эмбрионального типа VH (SEQ ID NO:204-216 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:217-229 (продолжение), соответственно, в порядке появления) каркасной области 3 определенных вариабельных участков тяжелых цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Продемонстрированные гены эмбрионального типа являются теми же, что показаны на фигуре 6, но включают только VH гены эмбрионального типа, выбранные для вариантов осуществления коллекции.

На Фигуре 28 показаны белковые последовательности эмбрионального типа Vk (SEQ ID NO:230-239, соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:240-249, соответственно, в порядке появления) каркасных областей 1 и LCDR 1 определенных вариабельных участков легких цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Показанные гены эмбрионального типа являются теми же, что показаны на фигуре 7, но включают только Vk гены эмбрионального типа, выбранные для вариантов осуществления коллекции.

На Фигуре 29 показаны белковые последовательности эмбрионального типа Vk (SEQ ID NO:230-239 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:240-249 (продолжение), соответственно, в порядке появления) каркасных областей 2 и LCDR 2 определенных вариабельных участков легких цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Продемонстрированные гены эмбрионального типа являются теми же, что показаны на фигуре 7, но включают только Vk гены эмбрионального типа, выбранные для вариантов осуществления коллекции.

На Фигуре 30 показаны белковые последовательности эмбрионального типа Vk (SEQ ID NO:230-239 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO 240-249 (продолжение), соответственно, в порядке появления) каркасной области 3 определенных вариабельных участков легких цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Продемонстрированные гены эмбрионального типа являются теми же, что показаны на фигуре 7, но включают только Vk гены эмбрионального типа, выбранные для вариантов осуществления коллекции.

На Фигуре 31 показаны белковые последовательности эмбрионального типа Vλ (SEQ ID NO:250-257, соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:258-265, соответственно, в порядке появления) каркасных областей 1 и LCDR 1 определенных вариабельных участков легких цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Продемонстрированные гены эмбрионального типа являются теми же, что показаны на фигуре 8, но включают только Vλ гены эмбрионального типа, выбранные для вариантов осуществления коллекции. На данной фигуре VL означает Vλ.

На Фигуре 32 показаны белковые последовательности эмбрионального типа Vλ (SEQ ID NO:250-257 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:258-265 (продолжение), соответственно, в порядке появления) каркасных областей 2 и LCDR 2 определенных вариабельных участков легких цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Продемонстрированные гены эмбрионального типа являются теми же, что показаны на фигуре 8, но включают только Vλ гены эмбрионального типа, выбранные для вариантов осуществления коллекции. На данной фигуре VL означает Vλ.

На Фигуре 33 показаны белковые последовательности эмбрионального типа Vλ (SEQ ID NO:250-257 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:258-265 (продолжение), соответственно, в порядке появления) каркасной области 3 определенных вариабельных участков легких цепей. Аминокислотные последовательности являются белковыми последовательностями эмбрионального типа, которые определены в данном документе. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Продемонстрированные гены эмбрионального типа являются теми же, что показаны на фигуре 8, но включают только Vλ гены эмбрионального типа, выбранные для вариантов осуществления коллекции. На данной фигуре VL означает Vλ.

На Фигуре 34 показаны белковые последовательности эмбрионального типа VH (SEQ ID NO:266-278, соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:279-291, соответственно, в порядке появления) каркасных областей 1 и HCDR1 определенных вариабельных участков тяжелых цепей. Аминокислотные последовательности модифицировали в пределах HCDR1 для удаления потенциальных сайтов посттрансляционной модификации (РТМ). Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии Е.coli, избегая редких человеческих кодонов. Аминокислоты, которые модифицировали в HCDR1, подчеркнуты, а соответствующая ДНК, кодирующая каждую позицию, выделена жирным шрифтом и подчеркнута.

На Фигуре 35 показаны белковые последовательности эмбрионального типа VH (SEQ ID NO:266-278 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:279-291 (продолжение), соответственно, в порядке появления) каркасных областей 2 и HCDR2 определенных вариабельных участков тяжелых цепей. Аминокислотные последовательности модифицировали в пределах HCDR2 для удаления потенциальных сайтов посттрансляционной модификации (РТМ). Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. Аминокислоты, которые модифицировали в HCDR2, подчеркнуты, а соответствующая ДНК, кодирующая каждую позицию, выделена жирным шрифтом и подчеркнута.

На Фигуре 36 показаны белковые последовательности эмбрионального типа VH (SEQ ID NO:266-278 (продолжение), соответственно, в порядке появления) и последовательности ДНК (SEQ ID NO:279-291 (продолжение), соответственно, в порядке появления) каркасной области 3 определенных вариабельных участков тяжелых цепей. Аминокислотные последовательности являются аминокислотными последовательностями эмбрионального типа, так как потенциальные сайты посттрансляционной модификации не удаляли в пределах каркасных участков. Кодоны последовательностей ДНК оптимизировали с помощью GeneArt для экспрессии E.coli, избегая редких человеческих кодонов. VH1-69*01 и VH3-23 могут также содержать нуклеотиды CGT в позиции 94.

На Фигуре 37 показаны репрезентативные антитела или фрагменты антител, специфичные для Dkk3, идентифицированные из суб-коллекций VH3-23/VK1-39 и VH3-23/VL3-1, описываемые в примере 11. Данная фигура демонстрирует суб-коллекцию, из которой идентифицировали каждое антитело или фрагмент, антиген, длину CDR-H3 и CDR-L3, термостабильность и аффинность Fab, pi, продуктивность экспрессии (мг/л), термостабильность и содержание мономера (% мономера) IgG1, определяемое с помощью SEC. На данной фигуре VL означает Vλ.

На Фигуре 38 показаны репрезентативные антитела или фрагменты антител, специфичные для ErbB4/Her4_Fc, идентифицированные из суб-коллекций VH3-23/VK1-39 и VH3-23/VL3-1, описываемые в примере 11. Данная фигура демонстрирует суб-коллекцию, из которой идентифицировали каждое антитело или фрагмент, антиген, длину CDR-Н3-и CDR-L3, термостабильность и аффинность Fab, pi, продуктивность экспрессии (мг/л), термостабильность и содержание мономера (% мономера) IgG1, определяемое с помощью SEC. На данной фигуре VL означает Vλ.

На Фигуре 39 показана эффективная температура плавления выбранных Fab, определяемая дифференциальной сканирующей флуориметрией (DSF), описываемая в примере 9.1.2. Каждая точка представляет один уникальный Fab. Клетки (квадраты) показывают контрольные Fab, описываемые в примере 9. Полосы показывают медианное значение. Контроль представляет антитело, протестированное на функциональные свойства в примере 9, которое содержит области FR эмбрионального типа и CDR1 и 2 соответствующей белковой пары эмбрионального типа и CDR3 из Эверт и соавт. В примере 11 получили выбранные Fab, которые отличаются по последовательности от контрольного антитела только в CDR3. Образование плотных кластеров здесь показывает, что продукт коллекции, означающий выбранные антитела или фрагменты против DKK3 или ErbB4/Her4_Fc антигена, поддерживают превосходные функциональные свойства представителей образца коллекции.

На Фигуре 40 показаны аминокислотные последовательности (SEQ ID NO:293, 295, 297 и 301, соответственно, в порядке появления) и последовательности нуклеиновых кислот с оптимизированными кодонами (SEQ ID NO:292, 294, 296, 298, 299, 300, 302 и 303, соответственно, в порядке появления), кодирующие FR4 участки, из коллекций по настоящему изобретению.

На Фигурах 41А и В показаны аминокислотная последовательность (SEQ ID NO:305) и последовательность нуклеиновой кислоты с оптимизированными кодонами (SEQ ID NO:304), кодирующие константный домен тяжелой цепи IgG1f, из коллекций по настоящему изобретению. Показанные последовательности нуклеиновых кислот имеют оптимизированные кодоны.

На Фигуре 42 показана аминокислотная последовательность (SEQ ID NO:307) и последовательность нуклеиновой кислоты с оптимизированными кодонами (SEQ ID NO:306), кодирующие константный домен тяжелой цепи Fab из коллекций по настоящему изобретению.

На Фигуре 43 показаны аминокислотные последовательности (SEQ ID NO:309 и 311. соответственно, в порядке появления) и последовательности нуклеиновых кислот с оптимизированными кодонами (SEQ ID NO:308 и 310, соответственно, в порядке появления), кодирующие константные домены легкой каппа-цепи IgG1f и Fab из коллекций по настоящему изобретению.

На Фигуре 44 показаны аминокислотные последовательности (SEQ ID NO:313 и 315, соответственно, в порядке появления) и последовательности нуклеиновых кислот с оптимизированными кодонами (SEQ ID NO:312 и 314, соответственно, в порядке появления), кодирующие константные домены легкой лямбда-цепи IgG1f и Fab из коллекций по настоящему изобретению.

На Фигуре 45 показаны значения изоэлектрической точки (pi) выбранных IgG, описываемые в примере 9.2.4. Каждая точка представляет один уникальный IgG. Клетки показывают контрольные IgG, описываемые в примере 9. Полосы показывают медианное значение. Контроль представляет антитело, протестированное на функциональные свойства в примере 9, которое содержит области FR эмбрионального типа и CDR1 и 2 соответствующей белковой пары эмбрионального типа и CDR3 из Эверт и соавт. В примере 11 получили выбранные IgG, которые отличаются по последовательности от контрольного антитела только в CDR3. Образование плотных кластеров здесь показывает, что продукт коллекции, означающий выбранные антитела или фрагменты против DKK3 или ErbB4/Her4_Fc антигена, поддерживают превосходные функциональные свойства представителей образца коллекции.

На Фигуре 46 показаны средние точки разворачивания выбранных IgG, определяемые дифференциальной сканирующей флуориметрией (DSF), описываемые в примере 9.2.2. Каждая точка представляет один уникальный IgG. Прямоугольники показывают контрольные IgG, описываемые в примере 9. Полосы показывают медианное значение. Контроль представляет антитело, протестированное на функциональные свойства в примере 9, которое содержит области FR эмбрионального типа и CDR1 и 2 соответствующей белковой пары эмбрионального типа и CDR3 из Эверт и соавт. В примере 11 получили выбранные IgG, которые отличаются по последовательности от контрольного антитела только в CDR3. Образование плотных кластеров здесь показывает, что продукт коллекции, означающий выбранные антитела или фрагменты против DKK3 или ErbB4/Her4_Fc антигена, поддерживают превосходные функциональные свойства представителей образца коллекции.

На Фигуре 47 показана продуктивность экспрессии выбранных IgG, определяемый УФ-спектрофотометрией, описываемый в примере 9.2.1. Каждая точка представляет один уникальный IgG. Прямоугольники показывают контрольные IgG, описываемые в примере 9. Полосы показывают медианное значение. Контроль представляет антитело, протестированное на функциональные свойства в примере 9, которое содержит области FR эмбрионального типа и CDR1 и 2 соответствующей белковой пары эмбрионального типа и CDR3 из Эверт и соавт. В примере 11 получили выбранные IgG, которые отличаются по последовательности от контрольного антитела только в CDR3. Образование плотных кластеров здесь показывает, что продукт коллекции, означающий выбранные антитела или фрагменты против DKK3 или ErbB4/Her4_Fc антигена, поддерживает превосходные функциональные свойства представителей образца коллекции.

На Фигуре 48 показано содержание мономера выбранных IgG, определяемое эксклюзионной хроматографией (SEC), описываемое в примере 9.2.3. Каждая точка представляет один уникальный IgG. Прямоугольники показывают контрольные IgG, описываемые в примере 9. Полосы показывают медианное значение. Контроль представляет антитело, протестированное на функциональные свойства в примере 9, которое содержит области FR эмбрионального типа и CDR1 и 2 соответствующей белковой пары эмбрионального типа и CDR3 из Эверт и соавт. В примере 11 получили выбранные IgG, которые отличаются по последовательности от контрольного антитела только в CDR3. Образование плотных кластеров здесь показывает, что продукт коллекции, означающий выбранные антитела или фрагменты против DKK3 или ErbB4/Her4_Fc антигена, поддерживают превосходные функциональные свойства представителей образца коллекции. На данной фигуре VL означает Vλ.

На Фигуре 49 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует относительное изменение мутности, основанное на УФ-поглощении до и во время встряхивания со стеклянными шариками, описываемое в примере 9.2.6 (а). Приведенные данные являются данными протестированных белковых пар эмбрионального типа под номерами 1-32. На данной фигуре VL означает Vλ.

На Фигуре 50 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует термостабильность в °С (кажущаяся Tm), после встряхивания со стеклянными шариками (данная кажущаяся Tm соответствует разворачиванию вариабельных доменов, средняя точка разворачивания Fc доменов не показана), которую определили с применением дифференциальной сканирующей флуорометрии, как описано в примере 9.2.6 (b), демонстрирует радиус частиц (нм) после встряхивания со стеклянными шариками, полидисперсность после встряхивания со стеклянными шариками, как описано в примере 9.2.6 (с), и окрашивание частиц до и после встряхивания со стеклянными шариками, как описано в примере 9.2.6 (d). Приведенные данные являются данными протестированных белковых пар эмбрионального типа под номерами 1-32. На данной фигуре VL означает Vλ.

На Фигуре 51 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует относительное изменение мутности. основанное на УФ-поглощении до и во время стресс-тестирования, описываемое в примере 9.2.6 (а). Приведенные данные являются данными протестированных белковых пар эмбрионального типа под номерами 33-64. На данной фигуре VL означает Vλ.

На Фигуре 52 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует термостабильность в °С (кажущаяся Tm), после встряхивания со стеклянными шариками (данная кажущаяся Tm соответствует разворачиванию вариабельных доменов, средняя точка разворачивания Fc доменов не показана), которую определили с применением дифференциальной сканирующей флуорометрии, как описано в примере 9.2.6 (b), демонстрирует радиус частиц (нм) после встряхивания со стеклянными шариками, полидисперсность после встряхивания со стеклянными шариками, как описано в примере 9.2.6 (с), и окрашивание частиц до и после встряхивания со стеклянными шариками, как описано в примере 9.2.6 (d). Приведенные данные являются данными протестированных белковых пар эмбрионального типа под номерами 33-64. На данной фигуре VL означает Vλ.

На Фигуре 53 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует относительное изменение мутности, основанное на УФ-поглощении до и во время стресс-тестирования, описываемое в примере 9.2.6 (а). Приведенные данные являются данными протестированных белковых пар эмбрионального типа под номерами 65-95. На данной фигуре VL означает Vλ.

На Фигуре 54 95 белковых пар эмбрионального типа дополнительно тестированных, как описано в примере 9, данная фигура демонстрирует термостабильность в °С (кажущаяся Tm), после встряхивания со стеклянными шариками (данная кажущаяся Tm соответствует разворачиванию вариабельных доменов, средняя точка разворачивания Fc доменов не показана), которую определили с применением дифференциальной сканирующей флуорометрии, как описано в примере 9.2.6 (b), демонстрирует радиус частиц (нм) после встряхивания со стеклянными шариками, полидисперсность после встряхивания со стеклянными шариками, как описано в примере 9.2.6 (с), и окрашивание частиц до и после встряхивания со стеклянными шариками, как описано в примере 9.2.6 (d). Приведенные данные являются данными протестированных белковых пар эмбрионального типа под номерами 65-95. На данной фигуре VL означает Vλ.

На Фигуре 55, описываемой в примере 9.2.7, для каждого из экспериментов стресс-тестирования, проведенных в примерах 9.2.5-9.2.6, определили точные значения, и для каждого точного значения предусмотрели соответствующую оценку. Данная фигура показывает оценку либо 0, 25, 75, либо 100, данную каждому значению в экспериментах, выполненных в примере 9.2.5, тестирование кислотой. Приведенные оценки являются оценками протестированных белковых пар эмбрионального типа под номерами 1-32. На данной фигуре VL означает Vλ.

На Фигуре 56, описываемой в примере 9.2.7, для каждого из экспериментов стресс-тестирования, проведенных в примерах 9.2.5-9.2.6, определили точные значения, и для каждого точного значения предусмотрели соответствующую оценку. Данная фигура показывает оценку либо 0, 25, 75, либо 100, данную каждому значению в экспериментах, выполненных в примере 9.2.6, встряхивание со стеклянными шариками. В дополнение, данная фигура демонстрирует кумулятивную оценку, которую вычислили путем сложения оценок тестов, проведенных в примерах 9.2.5-9.2.6. Приведенные оценки являются оценками протестированных белковых пар эмбрионального типа под номерами 1-32. На данной фигуре VL означает Vλ.

На Фигуре 57, описываемой в примере 9.2.7, для каждого из экспериментов стресс-тестирования, проведенных в примерах 9.2.5-9.2.6, определили точные значения, и для каждого точного значения предусмотрели соответствующую оценку. Данная фигура показывает оценку либо 0, 25, 75, либо 100, данную каждому значению в экспериментах, выполненных в примере 9.2.5, тестирование кислотой. Приведенные оценки являются оценками протестированных белковых пар эмбрионального типа под номерами 33-64. На данной фигуре VL означает Vλ.

На Фигуре 58, описываемой в примере 9.2.7, для каждого из экспериментов стресс-тестирования, проведенных в примерах 9.2.5-9.2.6, определили точные значения, и для каждого точного значения предусмотрели соответствующую оценку. Данная фигура показывает оценку либо 0, 25, 75, либо 100, данную каждому значению в экспериментах, выполненных в примере 9.2.6, встряхивание со стеклянными шариками. В дополнение, данная фигура демонстрирует кумулятивную оценку, которую вычислили путем сложения оценок-тестов, проведенных в примерах 9.2.5-9.2.6. Приведенные оценки являются оценками протестированных белковых пар эмбрионального типа под номерами 33-64. На данной фигуре VL означает Vλ.

На Фигуре 59, описываемой в примере 9.2.7, для каждого из экспериментов стресс-тестирования, проведенных в примерах 9.2.5-9.2.6, определили точные значения, и для каждого точного значения предусмотрели соответствующую оценку. Данная фигура показывает оценку либо 0, 25, 75, либо 100, данную каждому значению в экспериментах, выполненных в примере 9.2.5, тестирование кислотой. Приведенные оценки являются оценками протестированных белковых пар эмбрионального типа под номерами 65-95. На данной фигуре VL означает Vλ.

На Фигуре 60, описываемой в примере 9.2.7, для каждого из экспериментов стресс-тестирования, проведенных в примерах 9.2.5-9.2.6, определили точные значения, и для каждого точного значения предусмотрели соответствующую оценку. Данная фигура показывает оценку либо 0, 25, 75, либо 100, данную каждому значению в экспериментах, выполненных в примере 9.2.6, встряхивание со стеклянными шариками. В дополнение, данная фигура демонстрирует кумулятивную оценку, которую вычислили путем сложения оценок тестов, проведенных в примерах 9.2.5-9.2.6. Приведенные оценки являются оценками протестированных белковых пар эмбрионального типа под номерами 65-95. На данной фигуре VL означает Vλ.

На Фигурах 61 A-D белковые пары эмбрионального типа вариантов осуществления настоящего изобретения воспроизвели на фаге и подобрали к Frizzled-4 Fc, GFP или слиянию erbB4/Her4_Fc. Данная фигура демонстрирует использованные суб-коллекции, антигены, к которым подобранны, ряд проверенных клонов, ELISA положительные попадания и ряд уникальных антител. На данной фигуре VL означает Vλ.

Фигура 62 А-С демонстрирует IgG из суб-коллекции, подобранные к rhErbB4/Her4_Fc слиянию, rhFZD-4 Fc слиянию и eGFP, описываемые в примере 11. Данные фигуры демонстрируют суб-коллекцию, из которой идентифицировали каждое антитело, антиген, длину CDR-Н3 и CDR-L3, IgG1 pi, продуктивность экспрессии IgG1 (мг/л), термостабильность и содержание мономера IgG1 (% мономера), определенное с помощью SEC. На данной фигуре VL означает Vλ.

ПОДРОБНОЕ ОПИСАНИЕ

Определения

Для облегчения понимания настоящего изобретения предусмотрены следующие определения и иллюстрации.

"База данных или программоноситель", применяемое в данном документе, относится к любому формату для хранения данных о последовательности и, следовательно, любой коллекции информации, такой как файл базы данных, таблицы поиска, таблицы Excel или тому подобное. В определенных вариантах осуществления база данных хранится в электронной форме, такой как считываемое компьютером запоминающее устройство. Таковое включает носитель, такой как сервер, клиент, жесткий диск, CD, DVD, персональный цифровой секретарь, такой как Palm Pilot, лента, zip-диск, встроенное ПЗУ компьютера (постоянное запоминающее устройство) или Интернет или всемирная информационная сеть. Другие носители для хранения файлов доступные компьютеру будут очевидны для специалиста в данной области.

"In silico" относится к манипуляциям, анализу или конструкциям, выполняемым на компьютере, но также могут аналогично выполняться на бумаге или в уме.

Термин "антитело", применяемый в данном документе, включает целые антитела. Антитела могут являться поликлональными, аффинно очищенными поликлональными, моноклональными, человеческими, мышиными или грызунов, химерными, верблюжьими или гуманизированными антителами. Антитела могут принадлежать к любому из классов антител, таких как IgG, IgG1, IgG2, IgG3, IgG4, IgA (включая человеческие подклассы IgA1 и IgA2), IgD, IgE или IgM. "Антитело" является белком, который содержит по меньшей мере две тяжелые (Н) цепи и две легкие (L) цепи, соединенные дисульфидными связями.

Термин "фрагмент" антитела или "функциональный фрагмент", применяемый в данном документе, включает любой антигенсвязывающий фрагмент, такой как Fab, F(ab′)2, Fab′, Fv, scFv, одиночные цепи, которые включают Fc-часть, нанотела и другие антителоподобные структуры, обладающие остовом, отличным от вариабельных каркасных участков. Термин "функциональный фрагмент" включает, но без ограничений, любую часть антитела, которая сохраняет способность связываться с представляющим интерес антигеном.

Применяемый в данном документе термин "аффинность" относится к силе взаимодействия между антителом и антигеном на антигенных сайтах. В пределах каждого антигенного сайта, вариабельный участок антитела взаимодействует посредством нековалентных сил с антигеном на множестве сайтов; чем больше взаимодействий, тем сильнее аффинность. Применяемый в данном документе термин "высокая аффинность" антитела или его функционального фрагмента, такого как антитело IgG, относится к антителу, обладающему KD 10-8 М или менее, 10-9 М или менее, или 10-10 М или менее, или 10-11 М или менее или 10-12 М или менее для антигена-мишени. Однако "высокоаффинное" связывание может отличаться для других изотипов антител. Например, "высокоаффинное" связывание для изотипа IgM относится к антителу, обладающему KD 10-7 М или менее или 10-8 М или менее.

Термин "Kassoc" или "Ka", применяемый в данном документе, предназначен для обозначения константы скорости ассоциации конкретного взаимодействия антитело-антиген. тогда как термин "Kdis" или "Kd", применяемый в данном документе, предназначен для обозначения константы скорости диссоциации конкретного взаимодействия антитело-антиген. Термин "KD", применяемый в данном документе, предназначен для обозначения равновесной константы диссоциации, которая получается из отношения Kd к Ka (т.е. Kd/Ka) и выражается в виде молярной концентрации (М). Значения KD антител можно определить с применением способов, хорошо известных в данной области. Способом определения KD антитела является применение поверхностного плазменного резонанса или применение биосенсорной системы, такой как система Biacore ®.

Термин "химерное антитело" означает молекулу антитела, в которой (а) константный участок или его часть изменена, заменена или рекомбинирована таким образом, что сайт связывания антигена (вариабельный участок) связан с константным участком другого или измененного класса, эффекторной функции и/или вида.

Термин "изотип" относится к классу антител (например, IgM, IgE, IgG, такие как IgG1, IgG2 или IgG4), который обусловлен генами константного участка тяжелой цепи. Изотип также включает модифицированные версии одного из данных классов, где произвели модификации для изменения функции Fc, например, для повышения или снижения эффекторных функций или связывания с Fc-рецепторами.

Термин "эмбриональный тип" означает последовательность нуклеиновой кислоты, кодирующую антитела или их функциональные фрагменты, которая передается от родителей к потомству.

Термин "белковая последовательность эмбрионального типа" или "аминокислотная последовательность эмбрионального типа" означает а) аминокислотную последовательность вариабельного участка антитела или его функционального фрагмента, кодируемую геном эмбрионального типа; b) аминокислотную последовательность, кодируемую модифицированной последовательностью нуклеиновых кислот, кодирующей вариабельный участок антитела или его функционального фрагмента, обладающий такой же аминокислотной последовательностью, как вариабельный участок антитела или его функционального фрагмента, кодируемый геном эмбрионального типа, где последовательность нуклеиновой кислоты модифицирована, например, путем оптимизации кодона, добавления желаемых сайтов рестрикции, оптимизированного содержания GC, удаления нежелательных сайтов сплайсинга мРНК или удаление мотивов нестабильности мРНК, или с) аминокислотную последовательность, кодируемую геном эмбрионального типа, но с незначительными мутациями в аминокислотной последовательности, как например, с целью удаления нежелательного цистеина или введения желаемого сайта рестрикции, например, Bbsl, или которые являются результатом ошибок в синтезе, амплификации или клонировании. Примеры "белковых последовательностей эмбрионального типа" или "аминокислотных последовательностей эмбрионального типа" показаны на фигурах 6-8 и 25-33. К тому же, "белковая последовательность эмбрионального типа" или "аминокислотная последовательность эмбрионального типа" включает конструкции, такие как полученные в примере 5, которые включают:

а) для VH: лидерная последовательность (модифицированный phoA, включающий сайт NheI RE, как показано в таблице 1); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт BssHII RE (GCGCGC), как показано на фигуре 1); CDR-H3 (WGGDGFYAMDY) (SEQ ID NO:1) антитела 4D5, применяемый в Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и JH4 FR4 (включающий сайт XhoI RE (CTCGAG), как показано на фигуре 1);

b) для Vk: лидерная последовательность (ompA, включающий сайт NdeIRE как показано в таблице 2); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт Bbsl RE (GAAGAC), как показано на фигуре 1); каппа-подобный CDR-L3 (QQHYTTPPT) (SEQ ID NO:2) в соответствии с Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и Jkl FR4 (включающий сайт KpnI/Acc65I (GGTACC), как показано на фигуре 1); и

c) для Vλ: лидерная последовательность (ompA, включающий сайт NdeIRE как показано в таблице 2); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт Bbsl RE (GAAGAC), как показано на фигуре 1); лямбда-подобный CDR-L3 (QSYDSSLSGVV) (SEQ ID NO:3) в соответствии с Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и JI2/3 FR4 (включающий сайт узнавания KpnI/Acc65I (KpnI/Acc65I RE site) (GGTACC), как показано на фигуре 1).

"Белковые последовательности эмбрионального типа" или "аминокислотные последовательности эмбрионального типа" антител, кодированные генами эмбрионального типа, раскрыты в следующих публикациях, для VH: Tomlinson et al., (1992), "The Repertoire of Human Germline Vh Sequences Reveals about Fifty Groups of Vh Segments with Different Hypervariable Loop" J. Mol. Biol. 227, 776-798; Matsuda et al. (1998), "The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus" J Exp Med 188(11):2151-62; и LeFranc MP (2001) "Nomenclature of the human immunoglobulin heavy (IGH) genes." Exp Clin Immunogenet. 18(2):100-16; для Vλ: Kawasaki et al., (1997) "One-Megabase Sequence Analysis of the Human immunoglobulin lambda Gene Locus" Genome Research 7(3):250-61; Frippiat et al., (1995) "Organization of the human immunoglobulin lambda light-chain locus on chromosome 22q11.2" Hum. Mol. Genet., 4, 983-991; и LeFranc MP (2001) "Nomenclature of the human immunoglobulin lambda (IGL) genes. Exp Clin Immunogenet.; 18:242-254; и для Vk: Schable and Zachau (1993), "The variable genes of the human immunoglobulin kappa locus," Biol. Chem Hoppe Seyler. 374(11):1001-22; Brensing-Kuppers et al. (1997), "The human immunoglobulin kappa locus on yeast artificial chromosomes (YACs)" Gene. 191(2):173-81; Kawasaki et al. (2001), "Evolutionary dynamics of the human immunoglobulin kappa locus and the germline repertoire of the Vkappa genes" Eur J Immunol 31(4):1017-28; и Lefranc MP (2001) "Nomenclature of the human immunoglobulin kappa (IGK) genes" Exp Clin Immunogenet., 18, 161-174, которые все включены в данный документ в качестве ссылки во всей их полноте.

В частях спецификации, например на фигуре 5, номенклатурой генов эмбрионального типа вариабельного домена, применяемой в настоящей заявке, является IMGT, как описано в публикациях Лефранка и соавторов (LeFranc et al.), цитированных в предыдущем абзаце. Относительно номенклатуры, "VH" и "IGHV" означают вариабельный домен тяжелой цепи, где нумерацией генов является IMGT; "VL", "Vλ" и "IGLV" означают вариабельный домен легкой лямбда-цепи, где нумерацией генов является IMGT и "Vk", "VK" и "IGKV" означают вариабельный домен легкой каппа-цепи, где нумерацией генов является IMGT. Альтернативно, "VL" можно применять для обозначения вариабельного участка легкой цепи, включая Vk и Vλ.

Термин "последовательность гена эмбрионального типа" означает а) последовательность нуклеиновой кислоты гена эмбрионального типа, кодирующую вариабельный участок антитела или его функционального фрагмента, или b) модифицированную последовательность нуклеиновой кислоты, кодирующую вариабельный участок антитела или его функционального фрагмента, обладающий той же аминокислотной последовательность, как вариабельный участок антитела, кодируемого геном эмбрионального типа, где последовательность нуклеиновой кислоты модифицирована, например, путем оптимизации кодонов, добавления желаемых сайтов рестрикции, оптимизированного содержания GC, удаления нежелательных сайтов сплайсинга или удаления мотивов мРНК нестабильности.

Термин "пара(ы) генов эмбрионального типа" означает пару последовательное гей нуклеиновых кислот и их соответствующие гены эмбрионального типа, кодирующие вариабельный участок тяжелой цепи и вариабельный участок легкой цепи антитела или его функционального фрагмента. Например, парой генов эмбрионального типа может являться VH3-23/Vk1-5, где антитело, кодируемое VH3-23/Vk1-5, содержит вариабельный участок тяжелой цепи или его часть, кодируемый геном эмбрионального типа VH3-23, и вариабельный участок легкой цепи или его часть, кодируемый геном эмбрионального типа VK1-5.

Термин "белковая пара эмбрионального типа" означает антитело или его функциональный фрагмент, где вариабельный участок тяжелой цепи или его часть и вариабельный участок легкой цепи или его часть, а) каждый из которых кодируется специфическим геном эмбрионального типа, или b) каждый из которых кодируется модифицированной последовательностью нуклеиновых кислот, кодирующей вариабельный участок антитела или его функционального фрагмента с той же аминокислотной последовательностью, что и вариабельный участок антитела, кодируемый специфическим геном эмбрионального типа, где последовательность нуклеиновой кислоты модифицирована. например, путем оптимизации кодонов, добавления желаемых сайтов рестрикции, оптимизированного содержания GC, удаления нежелательных сайтов сплайсинга мРНК или удаления мотивов мРНК нестабильности или с) каждый из которых содержит аминокислотную последовательность, кодируемую геном эмбрионального типа, но с точечной мутацией в аминокислотной последовательности, как, например, с целью удаления нежелательного цистеина или введения желаемых сайтов рестрикции, например, Bbsl, или которая является результатом ошибок в синтезе, амплификации или клонировании. Например, белковой парой эмбрионального типа может являться антитело или его функциональный фрагмент, кодируемый VH3-23/Vk1-5, где антитело содержит вариабельный участок тяжелой цепи или его часть, кодируемый геном эмбрионального типа VH3-23 и вариабельный участок легкой цепи или его часть, кодируемый геном эмбрионального типа Vk1-5. "Белковая пара эмбрионального типа" включает конструкции, такие как полученные в примере 5, которые включают:

a) для VH: лидерная последовательность (модифицированный phoA, включающий сайт NheI RE, как показано в таблице 1); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт BssHII RE (GCGCGC), как показано на фигуре 1); CDR-H3 (WGGDGFYAMDY) (SEQ ID NO:1) антитела 4D5, применяемый в Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и JH4 FR4 (включающий сайт XhoI RE (CTCGAG), как показано на фигуре 1);

b) для Vk: лидерная последовательность (ompA, включающий сайт NdeIRE, как показано в таблице 2); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт Bbsl RE (GAAGAC), как показано на фигуре 1); каппа-подобный CDR-L3 (QQHYTTPPT) (SEQ ID NO:2) в соответствии с Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и Jk1 FR4 (включающий сайт Kpnl/Acc651 (GGTACC), как показано на фигуре 1); и

с) для Vλ: лидерная последовательность (ompA, включающий сайт NdeIRE как показано в таблице 2); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт Bbsl RE (GAAGAC), как показано на фигуре 1); лямбда-подобный CDR-L3 (QSYDSSLSGVV) (SEQ ID NO:3) в соответствии с Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и JI2/3 FR4 (включающий сайт Kpnl/Acc651 RE (GGTACC), как показано на фигуре 1).

Термин "пара вариабельного участка тяжелой цепи и вариабельного участка легкой цепи" или "VH/VL пара" означает комбинацию одного вариабельного участка тяжелой цепи и одного вариабельного участка легкой цепи. Антитело и функциональный фрагмент, например Fab, содержат по меньшей мере один вариабельный участок тяжелой цепи, связанный с вариабельным участком легкой цепи, которые образуют антигенсвязывающий участок. Примером пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи является антитело или его функциональный фрагмент, или его часть, которые включают аминокислотные последовательности эмбрионального типа из VH3-23/VK1-5 или кодируемые генами эмбрионального типа VH3-23/VK1-5, где антитело содержит вариабельный участок тяжелой цепи или его часть, содержащую аминокислотные последовательности эмбрионального типа из VH3-23, или, кодируемые геном эмбрионального типа VH3-23, и вариабельный участок легкой цепи или его часть, содержащую аминокислотные последовательности эмбрионального типа из VK1-5, или кодируемые геном эмбрионального типа VK1-5.

Термин "по существу все" означает по меньшей мере 90%. Например, по существу все из антител или функциональных фрагментов включают каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие аминокислотные последовательности эмбрионального типа белковой пары эмбрионального типа, обладающие определенными свойствами, означает, что по меньшей мере 90% антител или фрагментов включают каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие аминокислотные последовательности эмбрионального типа белковой пары эмбрионального типа, обладающие такими свойствами.

Последовательности JH4 для вариабельного участка тяжелой цепи, Jk1 для вариабельного участка k-легкой цепи и Jλ2/3 для вариабельного участка λ-легкой цепи описаны в следующих публикациях: Scaviner et al., (1999)," Protein displays of the human immunoglobulin heavy, kappa and lambda variable and joining regions" Exp Clin Immunogenet. 16(4):234-40; for JH: Ravetch et al., (1981), "Structure of the human immunoglobulin mu locus: characterization of embryonic and rearranged J and D genes." Cell 27 (3 pt 2): 583-91; for JK: Hieter et al. (1982), "Evolution of human immunoglobulin kappa J region genes." J Biol Chem 257(3):1516-22; for JL: Kawasaki et al., (1997) "One-Megabase Sequence Analysis of the Human immunoglobulin lambda Gene Locus" Genome Research 7(3):250-61, которые все включены в данный документ в качестве ссылки во всей их полноте. Аминокислотной последовательностью JH4 является (YFDYWGQGTLVTVSS) (SEQ ID NO:4); аминокислотной последовательностью Jk1 является (WTFGQGTKVEIK) (SEQ ID NO:5); аминокислотной последовательностью Jλ2/3 является (VVFGGGTKLTVL) (SEQ ID NO:6).

Термин "вариабельный домен/участок/(VH или VL)" означает участок иммуноглобулина, который содержит один или более Ig доменов, кодируемых, по существу, любой из VL (включая Vk и Vλ), VH, JL (включая Jk и Jλ), JH нуклеиновых кислот, которые образуют генетические локусы легкой цепи (включая k и λ) и тяжелой цепи иммуноглобулина соответственно. Вариабельный участок легкой или тяжелой цепи (VL и VH) состоит из "каркаса" или "FR" участка, разделенного тремя гипервариабельными участками, называемыми "определяющими комплементарность областями" или "CDR". Размер каркасного участка и CDR определяли с применением, по меньшей мере, следующих условных обозначений: смотри Kabat, 1991, J. Immunol., 147, 915-920; Chothia & Lesk. 1987. J Mol. Biol. 196:901-917; Chothia et al., 1989, Nature 342:877-883; Al-Lazikani et al., 1997, J. Mol. Biol. 273:927-948); смотри также http://www.bioc.uzh.ch/antibody/Numbering/NumFrame.html (который демонстрирует известные системы нумерации аминокислот антитела и расположение CDR и каркасных участков) и примененные на фигурах 25-36.

Термин "каркасный участок" означает часть вариабельного домена, который служит каркасом для антигенсвязывающих петель. Примеры каркасных участков включают в себя FR1, FR2, FR3 и FR4 либо вариабельного участка тяжелой, либо вариабельного участка легкой цепей.

Термин "определяющая комплементарность область" или "CDR" означает антигенсвязывающие петли антитела. Каждый из двух вариабельных доменов фрагмента Fv антитела содержит три CDR. Определяющие комплементарность области включают CDR1, CDR2 и CDR3 либо вариабельного участка тяжелой, либо вариабельного участка легкой цепей.

Термин "человеческий иммунный репертуар" означает репертуар нуклеиновых кислот, выделенный из В-клеток иммунной системы человека. Репертуар может являться репертуаром индивидуума или популяции, и может исходить от не подвергавшихся воздействию В-клеток и/или "обученных" антигеном В-клеток. Настоящее изобретение идет на определение иммунного репертуара от одного индивидуума, при условии получения достаточного количества В-клеток. Предпочтительно иммунный репертуар получают от множества индивидуумов с целью избежать деформаций выборки. Пример человеческого иммунного репертуара описан в примерах 2-3.

"Антиген" и "иммуноген" определяют как любую молекулу, которая специфически связана антителом.

Термин "специфичные к антигену/иммуногену" означает специфическую связь между антителом и соответствующей молекулой. Специфичность можно определить способами, описанными в примере 11, такими как твердофазный ELISA и/или Biacore.

"Диверсификация CDR" или "диверсифицированные CDR" получают путем изменения аминокислотной композиции в пределах CDR. Диверсифицированные CDR можно найти в коллекции антител или фрагментов, обладающих одним или несколькими одинаковыми каркасными участками, например каркасными участками эмбрионального типа, где антитела или фрагменты обладают CDR3, содержащими различные аминокислотные последовательности. Диверсификации CDR можно достичь любыми способами, известными специалистам в данной области, включая способы, описанные в следующем: WO 9708320, патент США №6300064, который включен в качестве ссылки в полном объеме; WO 2008053275, патент США 12/158181, который включен в качестве ссылки в полном объеме; WO 07056441, патент США 60/806602, который включен в качестве ссылки в полном объеме; WO 2009036379, патент США 60/993785, который включен в качестве ссылки в полном объеме; WO 2009114815, 12/922153, который включен в качестве ссылки в полном объеме; WO 020617071, патент США 12/762051, который включен в качестве ссылки в полном объеме. CDR общеизвестны как иммуноген связывающие области, поэтому обладание коллекциями, включающими элементы, которые представляют широкое разнообразие в пределах CDR, особенно CDR3, увеличивает вероятность того, что коллекция будет включать антитела или их фрагменты, обладающие специфичностью и оптимальными свойствами для любого иммуногена.

Термин "вариант" означает антитело или его фрагмент, обладающий иной аминокислотной последовательностью, чем другое антитело или его фрагмент. Термин "вариант" включает антитела или их фрагменты, которые по существу идентичны по последовательности в каркасных участках, но имеют разные аминокислотные последовательности в участки CDR, например, CDR3. Варианты пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи обладают по существу той же аминокислотной последовательностью, в пределах каркасных участков, но обладают разными аминокислотными последовательностями в пределах участки CDR3.

Термин "синтез" или "синтезированный" означает синтез генов, где последовательности нуклеиновых кислот синтезируются в физическую ДНК, содержащую полинуклеотиды. Стандартный синтез ДНК включает однонуклеотидный синтез, где генерируются одноцепочечные олигонуклеотиды, а затем перекрывающиеся олигонуклеотиды замыкают (лигируют) с применением ПЦР-подобной сборки. Компании, такие как, Sloning (Пухгайм, Германия), Geneart (Регенсбург, Германия), DNA2.0 (Менло-Парк, Калифорния, США), Entelechon (Регенсбург, Германия) и GenScript (Пискатауэй, Нью-Джерси, США), обеспечивают технологии синтеза генов. Sloning, например, использует набор готовых двухцепочечных нуклеотидных триплетов.

Термин "синтетический" описывает молекулу, которая получена за пределами человеческого тела путем синтеза или синтезирована, например, ДНК. Термин "синтетический" также описывает белок, например антитело или фрагмент, который транслируется с синтетической молекулы ДНК.

Термин "коллекция" или "библиотека" означает, по меньшей мере, два элемента. Термин "элемент" включает, но без ограничений, нуклеиновые кислоты, кодирующие антитела или их фрагменты или сами антитела или их фрагменты.

Термин "нуклеиновая кислота" применяется в данном документе взаимозаменяемо с термином "полинуклеотид" или "ДНК" и относится к дезоксирибонуклеотидам или рибонуклеотидам и их полимерам в одноцепочечной или двухцепочечной форме. Данный термин охватывает нуклеиновые кислоты, содержащие известные аналоги нуклеотидов или модифицированные остатки скелета или связей, которые являются синтетическими, природными и неприродными, которые обладают сходными свойствами связывания, как эталонная нуклеиновая кислота. Примеры таких аналогов включают, без ограничения, фосфоротиоаты, фосфорамидаты, метилфосфонаты, хиральные метилфосфонаты, 2-O-метилрибонуклеотиды и пептид-нуклеиновые кислоты (ПНК).

Если не указано иное, специфическая последовательность нуклеиновой кислоты также косвенно охватывает ее консервативно модифицированные варианты (например, замены вырожденных кодонов) и комплементарные последовательности, а также подробно указанную последовательность. В частности, как подробно описано ниже, замены вырожденных кодонов можно достичь путем генерирования последовательностей, в которых третье положение одного или более выбранных (или всех) кодонов замещено остатками смешанных оснований и/или дезоксиинозиновыми остатками (Batzer et al., Nucleic Acid Res 19:5081, 1991; Ohtsuka et al., J. Biol. Chem. 260:2605-2608, 1985; and Rossolini et al., Mol. Cell. Probes 8:91-98, 1994).

Применяемый в данном документе термин "с оптимизированным кодоном" или "оптимизация кодона" означает, что нуклеотидную последовательность изменили так, что она включает в себя кодоны, предпочтительные в определенной системе производства, например клетке или организме. Оптимизированная нуклеотидная последовательность сконструирована для сохранения аминокислотной последовательности, первоначально кодируемой исходной нуклеотидной последовательностью. В дополнение, нуклеотидную последовательность можно сконструировать так, чтобы она полностью или в максимально возможной степени являлась свободной от ингибирующих мотивов, сайтов сплайсинга мРНК, мотивов мРНК нестабильности и нежелательных сайтов рестрикции. Ее также можно оптимизировать по GC содержанию, желаемым сайтам рестрикции и другим параметрам. Последовательности можно оптимизировать для экспрессии в различных хозяевах, включая бактериальные или эукариотические клетки, в частности клетки млекопитающих. Аминокислотные последовательности, кодируемые оптимизированными нуклеотидными последовательностями, также могут упоминаться как оптимизированные.

Термин "аминокислота" относится к природным и синтетическим аминокислотам, а также аналогам аминокислот и миметикам аминокислот, которые функционируют аналогично встречающимся в природе аминокислотам. Природными аминокислотами являются аминокислоты, кодируемые генетическим кодом, а также те аминокислоты, которые позже модифицировали, например гидроксипролин, γ-карбоксиглутамат и O-фосфосерин. Аналоги аминокислот относятся к соединениям, которые обладают такой же основной химической структурой, что и природная аминокислота, то есть альфа-углерод, связанный с водородом, карбоксильная группа, аминогруппа и R группа, например, гомосерин, норлейцин, метионинсульфоксид, метионинметилсульфоний. Такие аналоги обладают модифицированными R группами (например, норлейцин) или модифицированным пептидным скелетом, но сохраняют ту же основную химическую структуру, что и природная аминокислота. Миметики аминокислот относятся к химическим соединениям, которые обладают структурой, отличной от общей химической структуры аминокислоты, но которые функционируют аналогично встречающейся в природе аминокислоте.

Термины "полипептид" и "белок" применяются взаимозаменяемо в данном документе для обозначения полимера аминокислотных остатков.

Термины "идентичный" в контексте двух или более нуклеиновых кислот или полипептидных последовательностей, относятся к двум или более последовательностям или подпоследовательностям, которые являются одинаковыми.

Термин "вектор" относится к полинуклеотидной молекуле, способной транспортировать другой полинуклеотид, с которым она связана. Предпочтительными векторами являются те, которые способны к автономной репликации и/или экспрессии нуклеиновых кислот, с которыми они связаны. Векторы, способные регулировать экспрессию нуклеиновых кислот, с которыми они функционально связаны, упоминаются в данном документе как "векторы экспрессии". Одним типом вектора является "плазмида", которая относится к кольцевой двухцепочечной петле ДНК, в которую могут вшиваться дополнительные сегменты ДНК. Другим типом вектора является вирусный вектор, где дополнительные сегменты ДНК могут вшиваться в вирусный геном. Определенные векторы способны к автономной репликации в клетке-хозяине, в которую они введены (например, бактериальные векторы, обладающие бактериальным репликатором, и векторы млекопитающих). Другие векторы могут интегрироваться в геном клетки-хозяина при введении в клетку-хозяина, и, таким образом, реплицируются вместе с геномом хозяина. Более того, определенные векторы способны направлять экспрессию генов, с которыми они функционально связаны. Такие векторы называют в данном документе "рекомбинантные векторы экспрессии" (или просто "векторы экспрессии"). В целом, векторы экспрессии, используемые в технологии рекомбинантной ДНК, часто находятся формы плазмид. Векторы могут являться совместимыми с прокариотическими или эукариотическими клетками. В настоящем описании термины "плазмида" и "вектор" могут применяться взаимозаменяемо, поскольку плазмида является наиболее широко используемой формой вектора. Однако настоящее изобретение подразумевает включение других форм векторов экспрессии, таких как вирусные векторы (например, дефектные по репликации ретровирусы, аденовирусы и адено-ассоциированные вирусы), которые выполняют эквивалентные функции.

Векторы обычно включают прокариотический репликон, который может включать прокариотический промотор, способный регулировать экспрессию (транскрипцию и трансляцию) VH- и/или VL-кодирующих гомологов в бактериальной клетке-хозяине, такой как кишечная палочка (Escherichia coli), трансформированной посредством этого. В дополнение, векторы включают векторы экспрессии IgG для применения в клетках млекопитающих, например, смотри фигуры 13-15. Промотор представляет собой элемент контроля экспрессии, образованный последовательностью ДНК, которая дает возможность связывания РНК-полимеразы и осуществления транскрипции. Промоторные последовательности, совместимые с бактериальными хозяевами, обычно доставляют в плазмидных векторах, содержащих сайты рестрикции для удобства вставки сегмента ДНК. Примеры таких векторных плазмид включают pUC8, pUC9, pBR322 и pBR329, pPL и рКК223, доступные в продаже.

"Дисплейный вектор" включает в себя ДНК последовательность, обладающую способностью направлять репликацию и поддержание рекомбинантной молекулы ДНК экстрахромосомно в клетке-хозяине, такой как бактериальная клетка-хозяин, трансформированная посредством этого. Такие последовательности ДНК хорошо известны в данной области. Дисплейные векторы могут являться, например, фаговыми векторами или фагмидными векторами, происходящими из класса fd, M13 или fl нитевидных бактериофагов. Такие векторы способны облегчать воспроизведение белка, включая, например, связывающий белок или его фрагменты, на поверхности нитевидного бактериофага. Дисплейные векторы, пригодные для воспроизведения на фаге, рибосомах, ДНК, бактериальных клетках или эукариотических клетках, например, дрожжей или клеток млекопитающих, также известны в данной области, например, как вирусные векторы или векторы, кодирующие химерные белки.

Термин "рекомбинантная клетка-хозяин" (или просто "клетка-хозяин") относится к клетке, в которую ввели рекомбинантный вектор экспрессии. Следует понимать, что такие термины предназначены для обозначения не только конкретной клетки-субъекта, но и потомства такой клетки. Поскольку определенные модификации могут иметь место в последующих поколениях вследствие мутации или воздействий окружающей среды, такое потомство может фактически не являться идентичным родительской клетке, но все еще включается в рамки термина "клетка-хозяин", применяемого в данном документе. Типичные клетки-хозяева являются прокариотическими (такие как, бактериальные, включая, но без ограничений, E.coli) или эукариотическими (включая дрожжи, клетки млекопитающих и другие). Бактериальные клетки являются предпочтительными прокариотическими клетками-хозяевами и обычно представляют собой штамм кишечной палочки (E.coli), такой как, например, штамм E.coli DH5, доступный из Bethesda Research Laboratories, Inc, Бетесда (Мэриленд). Предпочтительные эукариотические клетки-хозяева включают дрожжи и кле1ки млекопитающих, в том числе мышиные и грызунов, предпочтительно клетки позвоночных, таких как от мыши, крысы, обезьяны или линии клеток человека, например клетки HKB11, клетки PERC.6 или клетки СНО (клетки яичников китайских хомячков).

Введение векторов в клетки-хозяева можно осуществлять путем ряда способов трансформации или трансфекции, известных специалистам в данной области, включая осаждение фосфата кальция, электропорацию, микроинъекции, липосомное слияние, слияние теней эритроцитов, слияние протопластов, вирусную инфекцию и тому подобное. Производство моноклональных полноразмерных антител, Fab фрагментов, Fv фрагментов и scFv фрагментов является хорошо известным.

Трансформация соответствующих клеток-хозяев рекомбинантной молекулой ДНК осуществляется способами, которые обычно зависят от типа применяемого вектора и клеток. В отношении трансформации прокариотических клеток-хозяев, смотри, например, Cohen et al., Proceedings National Academy of Science, USA, Vol.69, P.2110 (1972); и Maniatis et al., Molecular Cloning, a Laboratory Manual, Cold spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1982). В отношении трансформации клеток позвоночных ретровирусными векторами, содержащими рекомбинантные ДНК, смотри, например, Sorge et al., Mol. Cell. Biol., 4:1730-1737 (1984); Graham et al., Virol., 52:456 (1973); и Wigler et al., Proceedings National Academy of Sciences, USA, Vol.76, P.1373-1376 (1979).

eGFP (усиленный зеленый флуоресцентный белок) обладает следующей аминокислотной последовательностью:

MSGSHHHHHHG TMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKDI. Подчеркнутые и выделенные курсивом аминокислоты представляют собой гистидиновую метку, а только подчеркнутые аминокислоты представляют собой добавление последовательности узнавания рестриктазой.

Коллекции антител или их фрагментов

Настоящее описание сущности изобретения предполагает возможность коллекций антител или их функциональных фрагментов и нуклеиновых кислот, кодирующих такие антитела или фрагменты, которые могут применяться для идентификации терапевтических антител против любой мишени, где антитела или фрагменты являются пригодными к разработке в клинике, безопасными и эффективными у пациентов. В качестве исходных данных авторы настоящего изобретения предположили, что пары генов эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, широко распространенные в человеческом иммунном репертуаре (такие как VH3-23/VK1-5), вероятно обладают благоприятными биофизическими свойствами, которые приведут к более эффективной разработке и повышению безопасности и эффективности полученных антител для пациентов. Такие благоприятные биофизические свойства могут включать: а) высокий относительный уровень воспроизведения формы Fab, b) высокий относительный продуктивность экспрессии Fab; с) температурную стабильность и в Fab, и в IgG форме, d) стабильность в бычьей/мышиной сыворотке и Fab, и IgG форм; е) высокий продуктивность экспрессии IgG1, е) содержание мономера при SEC (% мономера) и в Fab, и в IgG форме; и/или f) высокая изоэлектрическая точка IgG1 (pi).

Каждая В-клетка кодирует одно антитело, и каждое антитело содержит вариабельный участок тяжелой цепи и вариабельный участок легкой цепи. Каждый из вариабельного участка тяжелой цепи и вариабельных участков легких цепей антитела можно согласовать с генной последовательностью эмбрионального типа (или белковой последовательностью эмбрионального типа) с целью определения происхождения антитела, то есть из какого гена эмбрионального типа получили вариабельный участок тяжелой цепи и вариабельный участок легкой цепи. Таким образом, для каждого антитела можно сказать, что вариабельный участок тяжелой цепи и вариабельный участок легкой цепи включают генную пару эмбрионального типа или белковую пару эмбрионального типа, например, VH3-23 в паре с VK1-5.

С целью доказательства гипотезы о том, что белковые пары, широко распространенные в человеческом иммунном репертуаре, вероятно, обладают благоприятными биофизическими свойствами, первый шаг заключался в определении генных пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи (белковых пар эмбрионального типа), присутствующих в человеческом иммунном репертуаре. В некоторых аспектах эти данные получены из общедоступной литературы или базы данных и от выборки В-клеток.

Следующие статьи выявили и детально проанализировали: Wardemann H. et al. (2003) Science 301, 1374-1377 и любые вспомогательные таблицы; Yurasov S. et al. (2005) J. Exp. Med. 201, 703-712 и любые вспомогательные таблицы; Tsuiji М. et al. (2006) J. Exp. Med. 203, 393-401 и любые вспомогательные таблицы; Yurasov S. et al. (2006) J. Exp. Med. 203, 2255-2262 и любые вспомогательные таблицы. Tiller Т. et al. (2007) Immunity 26, 205-213 и любые вспомогательные таблицы, и Mietzner В. et al. (2008) PNAS 105, 9727-9732 и любые вспомогательные таблицы, все из которых включены в качестве ссылки во всей их полноте.

Альтернативно, поиск можно проводить в базах данных, таких как NCBI, с применением Ig-Blast. По состоянию на 2005 база данных содержала по меньшей мере 25000 перестроенных последовательностей антител человека в формате FASTA. Из 22500 записей 13235 представляли последовательности VH, 1506 представляли Vk и 2259 представляли Vλ.

В целом, в соответствующей общедоступной литературе и базах данных следовали следующим способам: В-клетки изолировали от человеческих доноров, В-клетки сортировали с целью определения их стадии развития или дифференциации, получали и амплифицировали кДНК, представляющие ДНК, кодирующие антитела из каждой В-клетки, секвенировали кДНК, кДНК, кодирующие вариабельный участок тяжелой цепи и вариабельные участки легких цепей, согласовали с известными генными последовательностями эмбрионального типа и определили пару генов эмбрионального типа из каждой В-клетки.

В некоторых вариантах осуществления эти данные получили из выборки и изолирования В-клеток человека, которые включали способ, аналогичный тому, который применялся в литературе. В данных аспектах способ получения коллекции синтетических антител или их функциональных фрагментов включает этап получения данных, включающих генные пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, присутствующие в человеческом иммунном репертуаре; где шаг получения включает этапы: аа) изолирование В-клеток человека из образца; ab) получение кДНК из В-клеток; ас) ПЦР-амплификацию кДНК из В-клеток; ad) секвенирование продуктов ПЦР; и ае) идентификацию генов эмбрионального типа продуктов ПЦР. Оба набора данных предусматривали генные пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые присутствуют в человеческом иммунном репертуаре.

Применяя данные о последовательности антитела, специалист в данной области может определить семейства эмбрионального типа и/или гены каждого из VH, Vk, Vλ вариабельного домена. Применяя данный подход, специалист в данной области может легко определить выраженность каждого семейства эмбрионального типа и/или гена VH и VL и/или семейства эмбрионального типа и/или гена каждой доменной пары VH и VL.

Необработанные данные, полученные из литературы и из В-клеток, собрали, проанализировали и ранжировали генные пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, присутствующих в человеческом иммунном репертуаре, по количеству каждого из них. Из этих данных стало ясно, что определенные генные пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи присутствуют чаще, чем другие в человеческом иммунном репертуаре. Такие выраженные пары, как ожидалось, обладают превосходными биофизическими свойствами.

В качестве следующего шага являлось необходимым определить, какие белковые пары эмбрионального типа следует тестировать на функциональные свойства, относящиеся к пригодности к разработке, так как в человеческом иммунном репертуаре существует ~2500 пар. Одним из путей может являться тестирование белковых пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые встречаются наиболее выражено в человеческом иммунном репертуаре, например, смотри таблицу 6. Можно, например, выбрать ведущие четыреста пар для тестирования, или выбрать белковые пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, присутствующие в количестве, выше определенного порогового. Данный подход, однако, потребовал бы синтез и тестирование большого числа последовательностей белковых пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи; поэтому такой подход являлся бы не очень эффективным.

В качестве альтернативного подхода, авторы настоящего изобретения выбрали подмножество пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые являются репрезентативными, точно воспроизводят или охватывают большинство выраженных пар человеческого иммунного репертуара. Данный подход основан, в частности, на том наблюдении, что небольшое число генов эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи являются доминирующими в человеческом иммунном репертуаре. Вилдт и соавт. (Wildt et al.) на 895-896 описывает данное явление. Вилдт и соавт. (Wildt et al.) также утверждает, что часто экспрессированные генные сегменты тяжелой и легкой цепи зачастую находятся в паре, и наблюдал, что половина образцов пар соответствует только пяти парам эмбрионального типа. Таким образом, небольшое количество выраженных генов (непарных) эмбрионального типа тяжелой и легкой цепи могут комбинироваться с образованием группы пар, которые являются репрезентативными для человеческого иммунного репертуара.

Таким образом, необработанные данные проанализировали для определения (непарных) генов эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи, выраженных в человеческом иммунном репертуаре. Выраженные белковые последовательности эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи затем оценили с целью определения их биофизических свойств, относящихся к разработке. Белковые последовательности эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k легкой цепи и вариабельного участка λ легкой цепи оценили in silico по следующим свойствам: длина CDR, изоэлектрическая точка (pi), предпочтительная изоэлектрическая точка составляет 7,5 или выше, так как она должна обеспечить стабильность в стандартной рН от 5,5 до рН 7 буферной смеси, участки потенциальных сайтов посттрансляционной модификации в областях, определяющих комплементарность (РТМ) (в частности, N-связанные сайты гликозилирования (NxS или NxT) или химические модификации, такие как Asp расщепление (часто в DP), Asp изомеризация (DS, DG), деамидирование (NS, NG), которые могут возникать in vivo (в сыворотке крови) или при хранении в буферной смеси и приводить к потере связывания антител), присутствие метионина в CDR (могут окисляться при воздействии растворителя), присутствие непарного цистеина (сформирует дисульфидные связи с любым другим непарным цистеином, таким образом приводя к сшиванию белков и/или более низким уровням экспрессии), отклонения от эмбрионального типа, присутствие потенциальных эпитопов Т-клеток, и теоретическая способность к агрегации.

Как показано в таблице 5 и на фигурах 2 и 3, в целом, для синтеза, комбинации и последующего функционального анализа выбрали 20 ведущих VH, 8 ведущих Vλ и 12 ведущих Vk. Последовательности генов эмбрионального типа синтезировали и затем комбинировали с целью образования 400 белковых пар эмбрионального типа, которые являются репрезентативными для генных пар эмбрионального типа, найденных в иммунном репертуаре, где каждый из вариабельных участков обладает благоприятными биофизическими свойствами, как определено in silico. 400 VH/VL белковых пар эмбрионального типа протестировали по следующим свойствам: а) относительный показатель отображения после получения фага и твердофазного ELISA фага в Fab форме; b) относительный продуктивность экспрессии Fab после получения Fab в Е.coli, клеточного лизиса E.coli и обнаружения полученного Fab с помощью твердофазного ELISA; с) термическая стабильность Fab, после получения Fab в E.coli, клеточного лизиса E.coli и обнаружения с помощью твердофазного ELISA неденатурированного Fab после инкубации при повышенных температурах; d) стабильность в бычьей или мышиной сыворотке Fab из лизатов Е.coli путем обнаружения с помощью твердофазного ELISA неденатурированного Fab после инкубации в бычьей или мышиной сыворотке; е) относительные уровни выхода экспрессии человеческого IgG1 после получения IgG1 в клетках млекопитающих и обнаружения с помощью твердофазного ELISA секретируемого IgG1 из супернатантов клеточных культур; и f) стабильность в бычьей сыворотке человеческого IgG1 путем обнаружения с помощью твердофазного ELISA неденатурированного Fab после инкубации в бычьей или мышиной сыворотке.

Из 400 протестированных белковых пар эмбрионального типа (результаты представлены в таблице 12) отобрали 95 для дальнейшего тестирования. После синтеза экспрессии и очистки 95 белковых пар эмбрионального типа, показанных на фигурах 16-24, протестировали и в Fab, и в IgG1 форме по следующим показателям: а) продуктивность экспрессии очищенного Fab в мг/л, b) содержание мономера очищенного Fab (% мономера), с) термостабильность очищенного Fab, d) продуктивность экспрессии очищенного IgG1 в мг/л, е) содержание мономера очищенного IgG1 (% мономера), f) термостабильность очищенного IgG1, g) изоэлектрическая точка IgG1 и h) стресс-тестирование IgG1 с воздействием кислоты, включая дифференциальную сканирующую флуорометрию (DSF), абсорбцию, динамическое рассеяние света и окрашивание частиц. Результаты показаны на фигурах 16-24.

В варианте осуществления установили следующие пороговые значения: i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л; ii) термостабильность при 70°С или выше в Fab форме; iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98% по определению с помощью SEC; iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л, v) термостабильность при 73°С или выше в IgG1 форме; и vii) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99% по определению с помощью SEC. Таким образом, в одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают в себя каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанные белковые пары эмбрионального типа включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC.

В дополнительных вариантах осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90% или по меньшей мере 95%, или каждое из антител или функциональных фрагментов включают в себя каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанные белковые пары эмбрионального типа включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC.

В дополнительных вариантах осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты содержат или содержат по существу каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые содержат белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанные белковые пары эмбрионального типа включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC.

В определенных вариантах осуществления

i) продуктивность экспрессии в Fab форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,538 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

ii) термостабильность в Fab форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

iii) содержание мономера (% мономера) в Fab форме определяли с помощью эксклюзионной хроматографии с применением колонки Superdex75 HR10/30 и Gibco D-PBS буфера с рН 7,4.

В определенных вариантах осуществления

iv) продуктивность экспрессии в IgG1 форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,369 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

v) термостабильность в IgG1 форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

vi) содержание мономера (% мономера) в IgG1 форме определяли с помощью эксклюзионной хроматографии с применением колонки Tosoh TSK-Gel G3000SWxl и Gibco D-PBS буфера с рН 7,4.

УФ-спектрофотометрию можно осуществлять с применением системы Nanadrop (Peqlab, Эрланген, Германия). Дифференциальную сканирующую флуорометрию можно осуществлять с применением термоциклера iCycler iQ5 (Biorad). Дифференциальную сканирующую флуорометрию можно осуществлять с применением Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Эксклюзионную хроматографию можно осуществлять с применением системы очистки АКТА (GE Healthcare).

Следующие белковые пары эмбрионального типа (54) находились на уровне или превышали следующие пороговые значения при применении способов, описанных выше: i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л; ii) термостабильность при 70°С или выше в Fab форме; iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98% по определению с помощью SEC; iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л, v) термостабильность при 73°С или выше в IgG1 форме; и vii) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99% по определению с помощью SEC, следовательно, обладают превосходной функциональной активностью, связанной с пригодностью к разработке (данные показаны на фигурах 16-24): VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)A/L1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) b VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252). Следовательно, коллекции, включающие любое число таких белковых пар эмбрионального типа, могут применяться для идентификации пригодных к разработке антител или их фрагментов против любого антигена.

В одном аспекте коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа специфических пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, например, VH1-18/VK1-39. Это означает, что коллекция включает антитела или фрагменты, где каркасные участки антител или фрагментов содержат белковые последовательности эмбрионального типа VH1-18/VK1-39, где каркасные участки вариабельного участка тяжелой цепи содержат белковые последовательности эмбрионального типа VH1-18, а каркасные участки вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа VK1-39. Большое число белковых пар эмбрионального типа тестировали как конструкты (как описано в примерах 5 и 9) по их функциональным свойствам, связанным с разработкой. Ряд протестированных конструктов показал превосходные функциональные свойства, связанные с пригодностью к разработке. Авторы настоящего изобретения полагают, что существует высокая корреляция между входными данными (коллекция антител, применяемая для выбора в отношении антигена) и результатом (антитела, определенные из коллекции как специфичные к антигену) в отношении тестируемых функциональных свойств. Следовательно, коллекции по настоящему изобретению включают антитела или фрагменты, которые включают, в частности, те же аминокислотные последовательности, что и протестированные конструкты, например, каркасные участки и/или определяющие комплементарность области. Начиная с того, что в одном аспекте коллекции включают аминокислотные последовательности или кодирующие их нуклеиновые кислоты протестированных конструкций, полагают, что коллекции включают антитела или их фрагменты, обладающие теми же превосходными функциональными свойствами, связанными с пригодностью к разработке, что и протестированные конструкты. Следовательно, ожидается, что антитела или фрагменты, впоследствии выбранные из коллекций к антигену, также будут обладать такими же превосходными функциональными свойствами, относящимися к пригодности к разработке. Данная гипотеза подтверждается экспериментами и данными, описываемыми в примере 11, смотри фигуры 37-39, 45-48 и 62.

В некоторых вариантах осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа, выбранные из двух или более, трех или более, четырех или более, пяти или более, шести или более, семи или более, восьми или более, девяти или более, десяти или более, одиннадцати или более, двенадцати или более, тринадцати или более, четырнадцати или более, пятнадцати или более, шестнадцати или более, семнадцати или более, восемнадцати или более, девятнадцати или более, двадцати или более, двадцати одной или более, двадцати двух или более, двадцати трех или более, двадцати четырех или более, двадцати пяти или более, двадцати шести или более, двадцати семи или более, двадцати восьми или более, двадцати девяти или более, тридцати или более, тридцати одного или более, тридцати двух или более, тридцати трех или более, тридцати четырех или более, тридцати пяти или более, тридцати шести или более, тридцати семи или более, тридцати восьми или более, тридцати девяти или более, сорока или более, сорока одного или более, сорока двух или более, сорока трех или более, сорока четырех или более, сорока пяти или более, сорока шести или более, сорока семи или более, сорока восьми или более или сорока девяти или более, или пятидесяти или более, или пятидесяти одного или более, или пятидесяти двух или более, или пятидесяти трех или более, или пятидесяти четырех пар вариабельных участков тяжелой цепи и вариабельных участков легкой цепи из VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251)/VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15(SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)/VL1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95%, или каждое из антител или функциональных фрагментов включает пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа, выбранные из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)/VL1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Один вариант осуществления включает коллекцию синтетических антител или их функциональных фрагментов, или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа из, состоящие из или состоящие по существу из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:240)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)A/L1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В вариантах осуществления, включающих 54 пары или их подгруппы, можно выбрать дополнительные пары для добавления к коллекции, где каждая добавленная белковая пара эмбрионального типа включает следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л, как определили с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,538 мл/мг и измеряя оптическую плотность при 280 нм,

ii) термостабильность при 70°С или выше, как определили с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера,

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98%, как определили с помощью эксклюзионной хроматографии с применением колонки Superdex75 HR10/30 и Gibco D-PBS буфера с рН 7,4,

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л, как определили с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,369 мл/мг и измеряя оптическую плотность при 280 нм,

v) термостабильность при 73°С или выше в IgG1 форме, как определили с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера, и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью эксклюзионной хроматографии с применением колонки Tosoh TSK-Gel G3000SWxl и Gibco D-PBS буфера с рН 7,4.

УФ-спектрофотометрию можно осуществлять с применением системы Nanadrop (Peqlab, Эрланген, Германия). Дифференциальную сканирующую флуорометрию можно осуществлять с применением термоциклера iCycler iQ5 (Biorad). Дифференциальную сканирующую флуорометрию можно осуществлять с применением Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Эксклюзионную хроматографию можно осуществлять с применением системы очистки AKTA (GE Healthcare).

Варианты осуществления настоящего описания изобретения включают подгруппы белковых пар эмбрионального типа (54) выше, обладающих превосходной функциональной активностью, связанной с пригодностью к разработке. В одном варианте осуществления подгруппу белковых пар эмбрионального типа (36 из 54) выбрали на основании сравнения данных стресс-тестирования, определенных с применением способов, описываемых в примерах 9.2.5 (a-d), данных, продемонстрированных на фигурах 19-24, примере 9.2.6 (a-d), данных, продемонстрированных на фигурах 49-54 и примере 9.2.7, оценки, продемонстрированной на фигурах 55-60. Способы стресс-тестирования оценивали 95 белковых пар эмбрионального типа в IgG1 форме с целью определения их способности противостоять воздействию кислот и встряхиванию со стеклянными шариками. Выбрали 36 белковых пар эмбрионального типа варианта осуществления, так как они обладают дополнительными превосходными функциональными свойствами, относящимися к пригодности к разработке, поскольку они показали сильную устойчивость к кислоте и стрессу встряхиванием. 36 белковых пар эмбрионального типа, выбранных в варианте осуществления, выполнили все пороговые показатели функциональной активности 54 пар и, в дополнение, получили оценку на уровне или выше 1225 в кумулятивной оценке стресс-тестирования (как описано в примере 9.2.7), которая оценивала белковые пары эмбрионального типа в соответствии со следующими характеристиками: оптическая плотность при 320 нм до и после воздействия кислоты, радиус и % полидисперсности до и после воздействия кислоты, окрашивание частиц до и после воздействия кислоты, оптическая плотность при 320 нм до и после встряхивания со стеклянными шариками, радиус и % полидисперсности до и после встряхивания со стеклянными шариками и окрашивание частиц до и после встряхивания со стеклянными шариками. 36 белковых пар эмбрионального типа, выбранных в данном варианте осуществления, обладали значениями на уровне или выше следующих пороговых значений по каждому критерию: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1) по меньшей мере 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1) по меньшей мере 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2) по меньшей мере 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2) по меньшей мере 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3) по меньшей мере 98%; f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3) по меньшей мере 99% и g) кумулятивная оценка стресс-тестирования (описываемая в примере 9.2.7) по меньшей мере 1225.

Следовательно, в одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1 -51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В вариантах осуществления, включающих 36 пар или их подгруппы, можно выбрать дополнительные пары для добавления к коллекции, где каждая добавленная белковая пара эмбрионального типа включает следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л, как определили с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,538 мл/мг и измеряя оптическую плотность при 280 нм,

ii) термостабильность при 70°С или выше, как определили с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера,

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98%, как определили с помощью эксклюзионной хроматографии с применением колонки Superdex75 HR10/30 и Gibco D-PBS буфера с рН 7,4,

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л, как определили с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,369 мл/мг и измеряя оптическую плотность при 280 нм,

v) термостабильность при 73°С или выше в IgG1 форме, как определили с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера, и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью эксклюзионной хроматографии с применением колонки Tosoh TSK-Gel G3000SWxl и Gibco D-PBS буфера с рН 7,4.

УФ-спектрофотометрию можно осуществлять с применением системы Nanadrop (Peqlab, Эрланген, Германия). Дифференциальную сканирующую флуорометрию можно осуществлять с применением термоциклера iCycler iQ5 (Biorad). Дифференциальную сканирующую флуорометрию можно осуществлять с применением Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Эксклюзионную хроматографию можно осуществлять с применением системы очистки AKTA (GE Healthcare).

В вариантах осуществления коллекция синтетических антител или их функциональных фрагментов, или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, где по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95%, или каждое из антител или функциональных фрагментов включает пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа, выбранные из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В других вариантах осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа, выбранные из двух или более, трех или более, четырех или более, пяти или более, шести или более, семи или более, восьми или более, девяти или более, десяти или более, одиннадцати или более, двенадцати или более, тринадцати или более, четырнадцати или более, пятнадцати или более, шестнадцати или более, семнадцати или более, восемнадцати или более, девятнадцати или более, двадцати или более, двадцати одной или более, двадцати двух или более, двадцати трех или более, двадцати четырех или более, двадцати пяти или более, двадцати шести или более, двадцати семи или более, двадцати восьми или более, двадцати девяти или более, тридцати или более, тридцати одного или более, тридцати двух или более, тридцати трех или более, тридцати четырех или более, тридцати пяти или более, тридцати шести следующих пар вариабельных участков тяжелой цепи и вариабельных участков легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69-01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа из, состоящие из или состоящие по существу из следующих пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)A/K1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В другом варианте осуществления выбрали следующие пороговые значения для каждого критерия: а) продуктивность экспрессии очищенного Fab (описываемый в примере 9.1.1) по меньшей мере 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1) по меньшей мере 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2) по меньшей мере 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2) по меньшей мере 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3) по меньшей мере 99%; f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3) по меньшей мере 99%; g) изоэлектрическая точка очищенного IgG1 (описываемая в примере 9.2.4) по меньшей мере 8,3; и h) кумулятивная оценка стресс-тестирования (описываемая в примере 9.2.7) по меньшей мере 1225.

Следовательно, в одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанные белковые пары эмбрионального типа включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 99%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC; и

vii) изоэлектрическая точка в IgG1 форме по меньшей мере 8,3.

В определенных вариантах осуществления

i) продуктивность экспрессии в Fab форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,538 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

ii) термостабильность в Fab форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

iii) содержание мономера (% мономера) в Fab форме определяли с помощью эксклюзионной хроматографии с применением колонки Superdex75 HR10/30 и Gibco D-PBS буфера с рН 7,4.

В определенных вариантах осуществления

iv) продуктивность экспрессии в IgG1 форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,369 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

v) термостабильность в IgG1 форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

vi) содержание мономера (% мономера) в IgG1 форме определяли с помощью эксклюзионной хроматографии с применением колонки Tosoh TSK-Gel G3000SWxl и Gibco D-PBS буфера с рН 7,4.

УФ-спектрофотометрию можно осуществлять с применением системы Nanadrop (Peqlab, Эрланген, Германия). Дифференциальную сканирующую флуорометрию можно осуществлять с применением термоциклера iCycler iQ5 (Biorad). Дифференциальную сканирующую флуорометрию можно осуществлять с применением Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Эксклюзионную хроматографию можно осуществлять с применением системы очистки AKTA (GE Healthcare).

В дополнительных вариантах осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95% или каждое из антител или функциональных фрагментов включает каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанные белковые пары эмбрионального типа включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 99%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC и

vii) изоэлектрическая точка в IgG1 форме по меньшей мере 8,3.

В дополнительных вариантах осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты состоят из или состоят по существу из каркасных участков вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащих белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанные белковые пары эмбрионального типа включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 99%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC и

vii) изоэлектрическая точка в IgG1 форме по меньшей мере 8,3.

Следующие белковые пары эмбрионального типа (33) находились на уровне или выше следующих пороговых значений: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1) по меньшей мере 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1) по меньшей мере 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2) по меньшей мере 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2) по меньшей мере 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3) по меньшей мере 99%; f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3) по меньшей мере 99%; g) изоэлектрическая точка очищенного IgG1 (описываемая в примере 9.2.4) по меньшей мере 8,3; и h) кумулятивная оценка стресс-тестирования (описываемая в примере 9.2.7) по меньшей мере 1225, следовательно, обладают превосходной функциональной активностью, связанной с пригодностью к разработке: VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) им VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Следовательно, в одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK:3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В вариантах осуществления, включающих 33 пары или их подгруппы, можно выбрать дополнительные пары для добавления к коллекции, где каждая добавленная белковая пара эмбрионального типа включает следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л, как определили с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,538 мл/мг и измеряя оптическую плотность при 280 нм,

ii) термостабильность при 70°С или выше, как определили с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера,

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 99%, как определили с помощью эксклюзионной хроматографии с применением колонки Superdex75 HR10/30 и Gibco D-PBS буфера с рН 7,4,

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л, как определили с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,369 мл/мг и измеряя оптическую плотность при 280 нм,

v) термостабильность при 73°С или выше в IgG1 форме, как определили с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера, и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью эксклюзионной хроматографии с применением колонки Tosoh TSK-Gel G3000SWxl и Gibco D-PBS буфера с рН 7,4.

УФ-спектрофотометрию можно осуществлять с применением системы Nanadrop (peqlab, Эрланген, Германия). Дифференциальную сканирующую флуорометрию можно осуществлять с применением термоциклера iCycler iQ5 (Biorad). Дифференциальную сканирующую флуорометрию можно осуществлять с применением Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Эксклюзионную хроматографию можно осуществлять с применением системы очистки AKTA (GE Healthcare).

В вариантах осуществления, включающих 33 пары или их подгруппы, можно выбрать дополнительные пары для добавления к коллекции, где каждая добавленная белковая пара эмбрионального типа дополнительно включает следующее свойство:

vii) изоэлектрическая точка в IgG1 форме по меньшей мере 8,3.

В дополнительном варианте осуществления пары добавляются к коллекции, даже если пары сами не отвечали всем пороговым значениям в каждом критерии, но добавлялись к коллекции в целях повышения разнообразия. В одном варианте осуществления коллекция из 33 белковых пар эмбрионального типа дополнительно включает: VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); и VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256).

В данном варианте осуществления коллекция включает (36 пар): VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)A/K1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В вариантах осуществления коллекции, которые включают любое количество данных белковых пар эмбрионального типа или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, могут применяться для идентификации пригодных к разработке антител или их фрагментов против любого антигена.

В некоторых вариантах осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа, выбранные из двух или более, трех или более, четырех или более, пяти или более, шести или более, семи или более, восьми или более, девяти или более, десяти или более, одиннадцати или более, двенадцати или более, тринадцати или более, четырнадцати или более, пятнадцати или более, шестнадцати или более, семнадцати или более, восемнадцати или более, девятнадцати или более, двадцати или более, двадцати одной или более, двадцати двух или более, двадцати трех или более, двадцати четырех или более, двадцати пяти или более, двадцати шести или более, двадцати семи или более, двадцати восьми или более, двадцати девяти или более, тридцати или более, тридцати одного или более, тридцати двух или более, тридцати трех или более пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, выбранных из группы, которая включает: VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO; 238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK:3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQIDNO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В одном варианте осуществления коллекция включает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95% или каждое из антител или функциональных фрагментов включает пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа, выбранные из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Один вариант осуществления включает коллекцию синтетических антител или их функциональных фрагментов, или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, где антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа из, состоящие из, состоящие по существу из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQIDNO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09(SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Дополнительным аспектом к настоящему изобретению является способность коллекций быть полезными в идентификации антител или их функциональных фрагментов против любого иммуногена. Следовательно, в некоторых вариантах осуществления коллекции включают каркасные участки вариабельного участка тяжелой цепи и каркасные участки вариабельного участка легкой цепи, содержащие белковые последовательности эмбрионального типа по меньшей мере двух различных белковых пар эмбрионального типа; по меньшей мере трех различных белковых пар эмбрионального типа; по меньшей мере четырех различных белковых пар эмбрионального типа; по меньшей мере пяти различных белковых пар эмбрионального типа; по меньшей мере шести различных белковых пар эмбрионального типа; по меньшей мере семи различных белковых пар эмбрионального типа; по меньшей мере восьми различных белковых пар эмбрионального типа; по меньшей мере девяти различных белковых пар эмбрионального типа; по меньшей мере десяти различных белковых пар эмбрионального типа; по меньшей мере одиннадцати различных белковых пар эмбрионального типа; по меньшей мере двенадцати различных белковых пар эмбрионального типа; по меньшей мере тринадцати различных белковых пар эмбрионального типа; по меньшей мере четырнадцати различных белковых пар эмбрионального типа; по меньшей мере пятнадцати различных белковых пар эмбрионального типа; по меньшей мере шестнадцати различных белковых пар эмбрионального типа; по меньшей мере семнадцати различных белковых пар эмбрионального типа; по меньшей мере восемнадцати различных белковых пар эмбрионального типа; по меньшей мере девятнадцати различных белковых пар эмбрионального типа; по меньшей мере двадцати различных белковых пар эмбрионального типа; по меньшей мере 21 различной белковой пары эмбрионального типа; по меньшей мере 22 различных белковых пар эмбрионального типа; по меньшей мере 23 различных белковых пар эмбрионального типа; по меньшей мере 24 различных белковых пар эмбрионального типа; по меньшей мере 25 различных белковых пар эмбрионального типа; по меньшей мере 26 различных белковых пар эмбрионального типа; по меньшей мере 27 различных белковых пар эмбрионального типа; по меньшей мере 28 различных белковых пар эмбрионального типа; по меньшей мере 29 различных белковых пар эмбрионального типа; по меньшей мере 30 различных белковых пар эмбрионального типа; по меньшей мере 31 различной белковой пары эмбрионального типа; по меньшей мере 32 различных белковых пар эмбрионального типа; по меньшей мере 33 различных белковых пар эмбрионального типа; по меньшей мере 34 различных белковых пар эмбрионального типа; по меньшей мере 35 различных белковых пар эмбрионального типа; по меньшей мере 36 различных белковых пар эмбрионального типа; по меньшей мере 37 различных белковых пар эмбрионального типа; по меньшей мере 38 различных белковых пар эмбрионального типа; по меньшей мере 39 различных белковых пар эмбрионального типа; по меньшей мере 40 различных белковых пар эмбрионального типа; по меньшей мере 41 различной белковой пары эмбрионального типа; по меньшей мере 42 различных белковых пар эмбрионального типа; по меньшей мере 43 различных белковых пар эмбрионального типа; по меньшей мере 44 различных белковых пар эмбрионального типа; по меньшей мере 45 различных белковых пар эмбрионального типа; по меньшей мере 46 различных белковых пар эмбрионального типа; по меньшей мере 47 различных белковых пар эмбрионального типа; по меньшей мере 48 различных белковых пар эмбрионального типа; по меньшей мере 49 различных белковых пар эмбрионального типа; по меньшей мере 50 различных белковых пар эмбрионального типа; по меньшей мере 51 различной белковой пары эмбрионального типа; по меньшей мере 52 различных белковых пар эмбрионального типа; по меньшей мере 53 различных белковых пар эмбрионального типа; по меньшей мере 54 различных белковых пар эмбрионального типа.

Так как низкий потенциал иммуногенности у человека является целью для терапевтических антител, в одном аспекте коллекции включают каркасные участки, содержащие белковые последовательности эмбрионального типа или нуклеиновые кислоты, кодирующих их. В дополнение, с целью поддержания низкого риска иммуногенности можно использовать определяющие комплементарность области, содержащие белковые последовательности эмбрионального типа. В одном варианте осуществления коллекции включают синтетические антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или их функциональные фрагменты, включающие одну или несколько гипервариабельных участков, содержащих белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот гипервариабельных участков вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 25-33. Более определенно, в одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие участки CDR1, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот участки CDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 25, 28 и 31 и соответствующих SEQ ID NO:204-265. В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR1, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области HCDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигуре 25 и соответствующих SEQ ID NO:204-229. В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области LCDR1, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области LCDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 28 и 31 и соответствующих SEQ ID NO:230-265. В дополнительном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие участки CDR2, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот участки CDR2 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 26, 29 и 32 и соответствующих SEQ ID NO:204-265. В дополнительном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR2, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области HCDR2 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигуре 26 и соответствующих SEQ ID NO:204-229. В дополнительном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области LCDR2, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области LCDR2 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 29 и 32 и соответствующих SEQ ID NO:230-265.

Аспект описания настоящего изобретения включает модификацию гипервариабельных участков эмбрионального типа для удаления потенциальных сайтов посттрансляционной модификации (РТМ). Примеры гипервариабельных участков вариабельного участка тяжелой цепи, модифицированных для удаления РТМ, показаны на фигурах 34-36. В одном аспекте коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие один или несколько гипервариабельных участков, содержащих аминокислотные модификации, которые удаляют потенциальные сайты посттрансляционных модификаций. В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие один или несколько гипервариабельных участков, содержащих последовательности гипервариабельных участков или последовательности нуклеиновых кислот, кодирующих то же самое, которые изображены на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. В дополнительном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR1, которые содержат HCDR1 или нуклеиновые кислоты, кодирующие то же самое, которые изображены на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. Аминокислотные последовательности областей HCDR1 с низкой РТМ изображены в SEQ ID NO:266-278. Последовательности нуклеиновых кислот областей HCDR1 с низкой РТМ изображены в SEQ ID NO:279-291. В дополнительном варианте осуществления, коллекция включает антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR2, которые содержат области HCDR2 или нуклеиновые кислоты, кодирующие то же самое, изображенные на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. Аминокислотные последовательности областей HCDR2 с низкой РТМ изображены в SEQ ID NO:266-278. Последовательности нуклеиновых кислот областей HCDR2 с низкой РТМ изображены в SEQ ID NO:279-291.

Аспект описания настоящего изобретения включает использование последовательностей FR4 эмбрионального типа в коллекции. В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие FR4 участки, выбранные из группы, которая содержит: JH4 (SEQ ID NO:293), Jk1 (SEQ ID NO:297) и Jλ2/3 (SEQ ID NO:301). В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие область JH4 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность JH4 FR4, изображена в (SEQ ID NO:293) и (SEQ ID NO:295). Последовательность нуклеиновых кислот JH4 FR4 изображена в (SEQ ID NO:292) и (SEQ ID NO:294). В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие область Jk1 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность Jk1 FR4 изображена в (SEQ ID NO:297). Последовательность нуклеиновых кислот Jk1 FR4 изображена в (SEQ ID NO:296), (SEQ ID NO:298) и (SEQ ID NO:299). В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие область Jλ2/3 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность Jλ2/3 FR4 изображена в (SEQ ID NO:301). Последовательность нуклеиновых кислот Jλ2/3 FR4 изображена в (SEQ ID NO:300), (SEQ ID NO:302) и (SEQ ID NO:303).

В одном аспекте с целью повышения способности идентификации антител или их фрагментов к любому антигену, коллекции включают диверсифицированные участки CDR3. В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие диверсифицированный участок HCDR3. В одном варианте осуществления коллекция включает антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или их функциональные фрагменты, включающие диверсифицированный участок LCDR3.

В другом аспекте с целью повышения способности идентификации антител или их фрагментов против любого антигена, коллекции включают по меньшей мере 1×104 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, по меньшей мере 1×105 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, по меньшей мере 1×106 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, по меньшей мере 1×107 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, по меньшей мере 1×108 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, по меньшей мере 1×109 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, по меньшей мере 1×1010 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, по меньшей мере 1×1011 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты.

В одном варианте осуществления коллекции включают антитела или синтетические нуклеиновые кислоты, кодирующие такие антитела, выбранные из группы, включающей человеческий IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM и IgD. В одном варианте осуществления коллекции включают фрагменты антител или синтетические нуклеиновые кислоты, кодирующие такие фрагменты, выбранные из группы, включающей Fab, F(ab′)2, Fab′, Fv и scFv.

В вариантах осуществления константные домены тяжелой цепи IgG антител коллекции включают аминокислотные последовательности, показанные на фигурах 41 А-В (SEQ ID NO:305). В других вариантах осуществления нуклеиновые кислоты, кодирующие константные домены тяжелой цепи IgG антител коллекции включают последовательности нуклеиновых кислот, показанные на фигурах 41 А-В (SEQ ID NO:304). В вариантах осуществления константные домены тяжелой цепи Fab фрагментов антител коллекций включают аминокислотные последовательности, показанные на фигуре 42 (SEQ ID NO:307). В других вариантах осуществления нуклеиновые кислоты, кодирующие константные домены тяжелой цепи Fab антител коллекции включают последовательности нуклеиновых кислот, показанные на фигуре 42 (SEQ ID NO:306). В вариантах осуществления константные домены легкой каппа-цепи IgG (SEQ ID NO:309) и/или Fab (SEQ ID NO:311) антител или фрагментов антител коллекций включают аминокислотные последовательности, показанные на фигуре 43. В других вариантах осуществления нуклеиновые кислоты, кодирующие константные домены легкой каппа-цепи IgG (SEQ ID NO:308) и/или Fab (SEQ ID NO:310) антител или фрагментов антител коллекций включают последовательности нуклеиновых кислот, показанные на фигуре 43. В вариантах осуществления константные домены легкой лямбда-цепи IgG (SEQ ID NO:313) и/или Fab (SEQ ID NO:315) антител или фрагментов антител коллекции включают аминокислотные последовательности, показанные на фигуре 44. В других вариантах осуществления нуклеиновые кислоты, кодирующие константные домены легкой лямбда-цепи IgG (SEQ ID NO:312) и/или Fab (SEQ ID NO:314) антител или фрагментов антител коллекции включают последовательности нуклеиновых кислот, показанные на фигуре 44.

Аспект включает вектор, включающий в себя коллекции нуклеиновых кислот, описываемых в данном документе. В одном варианте осуществления вектор включает дисплейный вектор. В одном варианте осуществления вектор включает фагемидный вектор, дрожжевой дисплейный вектор или дисплейный вектор млекопитающих. Аспектом является рекомбинантная клетка-хозяин, включающая нуклеиновые кислоты, описываемые в данном документе, или вектор, описываемый в данном документе. В одном варианте осуществления рекомбинантный хозяин является прокариотическим или эукариотическим. В варианте осуществления рекомбинантной клеткой-хозяином является клетка E.coli, млекопитающего или дрожжей.

Способы получения

Аспект включает способы получения коллекций, описываемые в данном документе. Аспект включает способ получения коллекции синтетических антител или их функциональных фрагментов, или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты, при котором:

a) идентифицируют генные пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, присутствующие в человеческом иммунном репертуаре;

b) тестируют белковые пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, идентифицированные на этапе а), по следующим свойствам:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC; и

c) создают коллекцию, где по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95%, или каждое из либо антител, либо их функциональных фрагментов включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа белковых пар эмбрионального типа, удовлетворяющие свойствам этапа b).

В определенных вариантах осуществления способа

i) продуктивность экспрессии в Fab форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,538 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

ii) термостабильность в Fab форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

iii) содержание мономера (% мономера) в Fab форме определяли с помощью эксклюзионной хроматографии с применением колонки Superdex75 HR10/30 и Gibco D-PBS буфера с рН 7,4.

В определенных вариантах осуществления

iv) продуктивность экспрессии в IgG1 форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,369 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

v) термостабильность в IgG1 форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

vi) содержание мономера (% мономера) в IgG1 форме определяли с помощью эксклюзионной хроматографии с применением колонки Tosoh TSK-Gel G3000SWxl и Gibco D-PBS буфера с рН 7,4.

УФ-спектрофотометрию можно осуществлять с применением системы Nanadrop (peqlab, Эрланген, Германия). Дифференциальную сканирующую флуорометрию можно осуществлять с применением термоциклера iCycler iQ5 (Biorad). Дифференциальную сканирующую флуорометрию можно осуществлять с применением Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Эксклюзионную хроматографию можно осуществлять с применением системы очистки AKTA (GE Healthcare).

В одном варианте осуществления этап а) дополнительно включает этапы, на которых:

aa) изолируют человеческие В-клетки из образца;

ab) генерируют кДНК из В-клеток;

ac) амплифицируют ПЦР кДНК из В-клеток;

ad) секвенируют продукты ПЦР;

ae) идентифицируют гены эмбрионального типа каждого продукта ПЦР.

ДНК, кодирующую антитела и их фрагменты из каждой В-клетки изолируют и амплифицируют, например, тяжелую и легкую цепи физически изолируют в ПЦР-реакции. ДНК предпочтительно секвенируют. Секвенированная ДНК может являться кДНК, генерированной из B-клеточной мРНК. Экстракция мРНК из эукариотических клеток, таких как В-клетки, является хорошо известным технологическим процессом. Существуют многочисленные протоколы и доступны коммерческие наборы. Такие, как система выделения мРНК PolyATtract® (PolyATtract® mRNA Isolation System) (Promega, Мадисон, Висконсин, США) или различные наборы RNeasy и Oligotex DirectmRNA (оба из Qiagen, Хильден, Германия). Многие из этих методов используют полиаденильный хвост эукариотической мРНК, например, с помощью аффинной очистки до олиго (dT) матриц, таких, как олиго (dT) целлюлоза.

кДНК можно селективно амплифицировать из изолированной мРНК с помощью обратной транскрипции с применением специфических праймеров, с последующей обычной ПЦР. Специфические праймеры применяют для амплификации нуклеиновых кислот вариабельного домена тяжелой и легкой цепей. Смотри Cancer Surv. 1997; 30:21-44, J Clin. Pathol. 1994; 47:493-6, J. Clin. Pathol. 1990; 43:888-90 или Moi. Pathol. 2002 April; 55(2):98-101. ДНК, кодирующие вариабельный и легкой цепи домены из одной В-клетки, поддерживают вместе так, что возможно идентифицировать объединение классов (пару) вариабельных доменов тяжелой и легкой цепей. Методы изолирования нуклеиновых кислот, кодирующих пары вариабельных доменов из отдельных В-клеток, хорошо известны в данной области. Смотри, например, WO 01/92291; WO 92/15678; WO 93/03151, WO 2005/042774; Mullinax RL et al., 1992 Biotechniques 12:6 864-868; Chapal, N. et al. 1997 Biotechniques 23, 518-524,, Embleton MJ et al., 1992 Nucleic Acids Res. 20:15, 3831-3837; Coronella, J.A. et al. 2000 Nucleic Acids Res. 28:20, E85; Thirion S et al., 1996 European Journal of Cancer Prevention 5:6 507-511; и Wang, X et al. 2000 J. Immunol. Methods 20, 217-225.

Предпочтительно, ДНК из каждой В-клетки секвенируют. Существуют различные компании, которые способны секвенировать целые геномы, такие как корпорация Helicos BioSciences (Кембридж, Массачусетс, США). С ее технологией True Single Molecule Sequencing™ Helicos способна непосредственно секвенировать одиночные молекулы ДНК или РНК с высокой скоростью и эффективностью. Другие компании, способные выполнять аналогичные попытки секвенирования включают Illumina (Сан-Диего, Калифорния, США; система Solexa) и Roche (Базель, СН; система 454). Перед секвенированием не требуются этапа клонирования.

В другом аспекте описание настоящего изобретения обеспечивает способы идентификации семейства эмбрионального типа пар вариабельных доменов тяжелой и легкой цепи, присутствующих в иммунном репертуаре. Все антитела или их фрагменты можно проследить до их семейства эмбрионального типа, применяя способы, известные специалистам в данной области. С помощью анализа последовательности нуклеиновой кислоты, кодирующей антитело или его фрагмент, можно установить семейство эмбрионального типа и VH, и VL способами, известными специалисту в данной области. Например, Вилдт и соавт. (Wildt et. al.) (1999) отобрал образцы В-клеток от 3 пациентов и идентифицировал 365 пар классов VH и VL. РНК от каждой В-клетки применяли для синтеза кДНК, и кДНК, кодирующую участки VH и VL ПЦР-амплифицировали и секвенировали. Как показано на фигуре 1 из Wildt, определенные VH и VL классы спарены чаще, чем другие, например, VH3-8 с Vk 3-1, Vk 3-19, Vk 4-1, Vλ2-3 θ ли Vλ 1 -2 и VH3-9 с Vk 3-1, Vk 3-3 или Vλ 1-5.

В одном варианте осуществления этап b) дополнительно включает этапы, на которых:

ba) синтезируют ДНК, кодирующую антитела или их функциональные фрагменты, включающие белковые пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, представляющие пары, которые присутствуют в человеческом иммунном репертуаре;

bb) экспрессируют белковые пары эмбрионального типа, синтезированные в ba); и

bc) тестируют белковые пары эмбрионального типа из bb) по каждому из свойств.

В одном аспекте способа нуклеиновые кислоты, кодирующие коллекции антител или их фрагментов, по настоящему изобретению синтезируют и экспрессируют в коллекциях, которые можно использовать для выбора против антигена. В данном варианте осуществления способ включает этап с), где этап с) включает этапы, на которых:

ca) синтезируют нуклеиновые кислоты, кодирующие антитела или их функциональные фрагменты;

cb) клонируют нуклеиновые кислоты в вектор;

cc) экспрессируют антитела или их функциональные фрагменты.

В другом варианте осуществления способа антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO; 209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В другом варианте осуществления способа антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи включают белковые последовательности эмбрионального типа, содержащие две или более, три или более, четыре или более, пять или более, шесть или более, семь или более, восемь или более, девять или более, десять или более, одиннадцать или более, двенадцать или более, тринадцать или более, четырнадцать или более, пятнадцать или более, шестнадцать или более, семнадцать или более, восемнадцать или более, девятнадцать или более, двадцать или более, двадцать одну или более, двадцать две или более, двадцать три или более, двадцать четыре или более, двадцать пять или более, двадцать шесть или более, двадцать семь или более, двадцать восемь или более, двадцать девять или более, тридцать или более, тридцать одну или более, тридцать две или более, тридцать три или более, тридцать четыре или более, тридцать пять или более, или тридцать шесть или более, тридцать семь или более, тридцать восемь или более, тридцать девять или более, сорок или более, сорок одну или более, или сорок две или более, или сорок три или более, или сорок четыре или более, или сорок пять или более, или сорок шесть или более, или сорок семь или более, или сорок восемь или более, или сорок девять или более, или пятьдесят или более, или пятьдесят одну или более, или пятьдесят две или более, или пятьдесят три или более, или пятьдесят четыре пары вариабельных участков тяжелой цепи и вариабельных участков легкой цепи, выбранных из группы, включающей VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209) /VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)/VL1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В дополнительных вариантах осуществления способа по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95%, или каждое из либо антител, либо их функциональных фрагментов включает каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанная белковая пара эмбрионального типа включает следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 99%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vi) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC;

vii) изоэлектрическая точка в IgG1 форме по меньшей мере 8,3.

В данном варианте осуществления способа антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)A/K1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В дополнительном варианте осуществления способа антитела или функциональные фрагменты включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи дополнительно содержат белковые последовательности эмбрионального типа из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); и VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256). В данном варианте осуществления способа коллекция включает (36 пар): VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Способы применения

Аспект включает способы применения коллекций, описываемые в данном документе, для идентификации антител или фрагментов, специфичных к антигену.

Аспект настоящего описания изобретения включает способ идентификации антитела или фрагмента антитела, специфичного к антигену, при котором:

(a) антиген контактирует с коллекцией антител или их функциональных фрагментов, где по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95%, или каждое из либо антител, либо их функциональных фрагментов коллекции включают пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа белковых пар эмбрионального типа, которые включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 98%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме и содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC, и

(b) выбирают одно или несколько антител или фрагментов антител, которые связываются с указанным антигеном.

В определенных вариантах осуществления

i) продуктивность экспрессии в Fab форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,538 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

ii) термостабильность в Fab форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

iii) содержание мономера (% мономера) в Fab форме определяли с помощью эксклюзионной хроматографии с применением колонки Superdex75 HR10/30 и Gibco D-PBS буфера с рН 7,4.

В определенных вариантах осуществления

iv) продуктивность экспрессии в IgG1 форме определяли с помощью УФ-спектрофотометрии, применяя коэффициент экстинкции 1,369 мл/мг и измеряя оптическую плотность при 280 нм.

В определенных вариантах осуществления

v) термостабильность в IgG1 форме определяли с помощью дифференциальной сканирующей флуорометрии с применением PBS буфера.

В определенных вариантах осуществления

vi) содержание мономера (% мономера) в IgG1 форме определяли с помощью эксклюзионной хроматографии с применением колонки Tosoh TSK-Gel G3000SWxl и Gibco D-PBS буфера с рН 7,4.

УФ-спектрофотометрию можно осуществлять с применением системы Nanadrop (peqlab, Эрланген, Германия). Дифференциальную сканирующую флуорометрию можно осуществлять с применением термоциклера iCycler iQ5 (Biorad). Дифференциальную сканирующую флуорометрию можно осуществлять с применением Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Эксклюзионную хроматографию можно осуществлять с применением системы очистки AKTA (GE Healthcare).

В одном варианте осуществления способа каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа из VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В одном варианте осуществления способа антитела или их функциональные фрагменты включают две или более, три или более, четыре или более, пять или более, шесть или более, семь или более, восемь или более, девять или более, десять или более, одиннадцать или более, двенадцать или более, тринадцать или более, четырнадцать или более, пятнадцать или более, шестнадцать или более, семнадцать или более, восемнадцать или более, девятнадцать или более, двадцать или более, двадцать одну или более, двадцать две или более, двадцать три или более, двадцать четыре или более, двадцать пять или более, двадцать шесть или более, двадцать семь или более, двадцать восемь или более, двадцать девять или более, тридцать или более, тридцать одну или более, тридцать две или более, тридцать три или более, тридцать четыре или более, тридцать пять или более, или тридцать шесть или более, тридцать семь или более, тридцать восемь или более, тридцать девять или более, сорок или более, сорок одну или более, или сорок две или более, или сорок три или более, или сорок четыре или более, или сорок пять или более, или сорок шесть или более, или сорок семь или более, или сорок восемь или более, или сорок девять или более, или пятьдесят или более, или пятьдесят одну или более, или пятьдесят две или более, или пятьдесят три или более, или пятьдесят четыре пары вариабельных участков тяжелой цепи и вариабельных участков легкой цепи, выбранных из группы, включающей пары вариабельных участков тяжелой цепи и вариабельных участков легкой цепи, выбранные из VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VKL1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)/VL1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)A/L1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В варианте осуществления способа по существу все или по меньшей мере 50%, или по меньшей мере 60%, или по меньшей мере 70%, или по меньшей мере 80%, или по меньшей мере 90%, или по меньшей мере 95%, или каждое из либо антител, либо их функциональных фрагментов включает каркасные участки вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, содержащие белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанная белковая пара эмбрионального типа включают следующие свойства:

i) продуктивность экспрессии в Fab форме по меньшей мере 2,5 мг/л;

ii) термостабильность при 70°С или выше в Fab форме;

iii) содержание мономера (% мономера) в Fab форме по меньшей мере 99%, как определили с помощью SEC;

iv) продуктивность экспрессии в IgG1 форме по меньшей мере 30 мг/л;

v) термостабильность при 73°С или выше в IgG1 форме; и

vii) содержание мономера (% мономера) в IgG1 форме по меньшей мере 99%, как определили с помощью SEC;

viii) изоэлектрическая точка в IgG1 форме по меньшей мере 8,3.

В данном варианте осуществления способа каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи включают белковые последовательности эмбрионального типа из VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В дополнительном варианте осуществления способа каркасные участки пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи включают белковые последовательности эмбрионального типа, дополнительно выбранные из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); и VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256). В данном варианте осуществления коллекция включает (36 пар): VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Аспекты способов

В дополнительных аспектах способов, описываемых в данном документе, коллекции включают синтетические антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие одну или несколько гипервариабельных участков, содержащих белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где аминокислотные последовательности гипервариабельных участков вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 25-33. Более определенно, в одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие участки CDR1, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот участки CDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 25, 28 и 31 и соответствующих SEQ ID NO:204-265. В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR1, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области HCDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигуре 25 и соответствующих SEQ ID NO:204-229. В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области LCDR1, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области LCDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 28 и 31 и соответствующих SEQ ID NO:230-265. В дополнительном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие участки CDR2, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот участки CDR2 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 26, 29 и 32 и соответствующих SEQ ID NO:204-265. В дополнительном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR2, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области HCDR2 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигуре 26 и соответствующих SEQ ID NO:204-229. В дополнительном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области LCDR2, которые содержат белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где последовательности аминокислот и нуклеиновых кислот области LCDR2 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 29 и 32 и соответствующих SEQ ID NO:230-265.

В вариантах осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие один или несколько гипервариабельных участков, содержащих аминокислотные модификации, которые удаляют потенциальные сайты посттрансляционных модификаций. В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие один или несколько гипервариабельных участков, содержащих последовательности гипервариабельных участков или последовательности нуклеиновых кислот, кодирующих то же самое, которые изображены на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. В дополнительном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR1, которые содержат HCDR1 или нуклеиновые кислоты, кодирующие то же самое, которые изображены на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. Аминокислотные последовательности областей HCDR1 с низкой РТМ изображены в SEQ ID NO:266-278. Последовательности нуклеиновых кислот областей HCDR1 с низкой РТМ изображены в SEQ ID NO:279-291. В дополнительном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие области HCDR2, которые содержат области HCDR2 или нуклеиновые кислоты, кодирующие то же самое, изображенные на фигурах 34-36 из соответствующего вариабельного участка тяжелой цепи. Аминокислотные последовательности областей HCDR2 с низкой РТМ изображены в SEQ ID NO:266-278. Последовательности нуклеиновых кислот областей HCDR2 с низкой РТМ изображены в SEQ ID NO:279-291.

В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие FR4 участки, выбранные из группы, которая содержит: JH4 (SEQ ID NO:293), Jk1 (SEQ ID NO:297) и Jλ/3 (SEQ ID NO:301). В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие область JH4 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность JH4 FR4, изображена в (SEQ ID NO:293) и (SEQ ID NO:295). Последовательность нуклеиновых кислот JH4 FR4 изображена в (SEQ ID NO:292) и (SEQ ID NO:294). В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие область Jk1 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность Jk1 FR4 изображена в (SEQ ID NO:297). Последовательность нуклеиновых кислот Jk1 FR4 изображена в (SEQ ID NO:296), (SEQ ID NO:298) и (SEQ ID NO:299). В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие область Jλ2/3 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность Jλ2/3 FR4 изображена в (SEQ ID NO:301). Последовательность нуклеиновых кислот Jλ2/3 FR4 изображена в (SEQ ID NO:300), (SEQ ID NO:302) и (SEQ ID NO:303).

В одном аспекте с целью повышения способности идентификации антител или их фрагментов против любого антигена, коллекции включают диверсифицированные участки CDR3. В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, включающие диверсифицированный участок HCDR3. В одном варианте осуществления способа коллекция включает антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или их функциональные фрагменты, включающие диверсифицированный участок LCDR3.

В другом аспекте с целью повышения способности идентификации антител или их фрагментов против любого антигена, коллекции способа включают по меньшей мере 1×104 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты по меньшей мере 1×105 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты по меньшей мере 1×106 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты по меньшей мере 1×107 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты по меньшей мере 1×108 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты по меньшей мере 1×109 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты по меньшей мере 1×1010 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты по меньшей мере 1×1011 антител или их функциональных фрагментов или синтетических нуклеиновых кислот, кодирующих такие антитела или функциональные фрагменты.

В одном варианте осуществления способа коллекции включают антитела или синтетические нуклеиновые кислоты, кодирующие такие антитела, выбранные из группы, включающей человеческий IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM и IgD. В одном варианте осуществления способа коллекции включают фрагменты антител или синтетические нуклеиновые кислоты, кодирующие такие фрагменты, выбранные из группы, включающей Fab, F(ab′)2, Fab′, Fv и scFv.

В вариантах осуществления способа константные домены тяжелой цепи IgG антител коллекции включают аминокислотные последовательности, показанные на фигурах 41 А-В (SEQ ID NO:305). В других вариантах осуществления способа нуклеиновые кислоты, кодирующие константные домены тяжелой цепи IgG антител коллекции включают последовательности нуклеиновых кислот, показанные на фигурах 41 А-В (SEQ ID NO:304). В вариантах осуществления константные домены тяжелой цепи Fab фрагментов антител коллекций включают аминокислотные последовательности, показанные на фигуре 42 (SEQ ID NO:307). В других вариантах осуществления способа нуклеиновые кислоты, кодирующие константные домены тяжелой цепи Fab антител коллекции включают последовательности нуклеиновых кислот, показанные на фигуре 42 (SEQ ID NO:306). В вариантах осуществления способа константные домены легкой каппа-цепи IgG (SEQ ID NO:309) и/или Fab (SEQ ID NO:311) антител или фрагментов антител коллекций включают аминокислотные последовательности, показанные на фигуре 43. В других вариантах осуществления способа нуклеиновые кислоты, кодирующие константные домены легкой каппа-цепи IgG (SEQ ID NO:308) и/или Fab (SEQ ID NO:310) антител или фрагментов антител коллекций, включают последовательности нуклеиновых кислот, показанные на фигуре 43. В вариантах осуществления способа константные домены легкой лямбда-цепи IgG (SEQ ID NO:313), и/или Fab (SEQ ID NO:315) антител или фрагментов антител коллекций включают аминокислотные последовательности, показанные на фигуре 44. В других вариантах осуществления способа нуклеиновые кислоты, кодирующие константные домены легкой лямбда-цепи IgG (SEQ ID NO:312) и/или Fab (SEQ ID NO:314) антител или фрагментов антител коллекций включают последовательности нуклеиновых кислот, показанные на фигуре 44.

Антитела по настоящему изобретению

В другом аспекте описание настоящего изобретения предполагает синтетические антитела или их функциональные фрагменты, или синтетические нуклеиновые кислоты, кодирующие такие антитела или функциональные фрагменты, где антитело или функциональный фрагмент включает пару вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где каркасные участки пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи содержат белковые последовательности эмбрионального типа, выбранные из пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)/VL1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает одну или несколько гипервариабельных участков, содержащих белковые последовательности эмбрионального типа из соответствующих пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, где последовательность аминокислот определяющей комплементарность области вариабельного участка тяжелой цепи и вариабельного участка легкой цепи изображена на фигурах 25-33. Более определенно, в одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область CDR1, которая содержит белковые последовательности эмбрионального типа из соответствующей пары вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где аминокислотная последовательность участки CDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображена на фигурах 25, 28 и 31 и соответствующих SEQ ID NO:204-265. В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область HCDR1, которая содержит белковые последовательности эмбрионального типа из соответствующей пары вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где аминокислотные последовательности области HCDR1 вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи изображены на фигуре 25 и соответствующих SEQ ID NO:204-229. В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область LCDR1, которая содержит белковые последовательности эмбрионального типа из соответствующей пары вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где аминокислотные последовательности области LCDR1 вариабельных участков тяжелых цепей и вариабельных участков легких цепей изображены на фигурах 28 и 31 и соответствующих SEQ ID NO:230-265. В дополнительном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область CDR2, которая содержит белковые последовательности эмбрионального типа из соответствующей пары вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где аминокислотные последовательности участки CDR2 вариабельного участка тяжелой цепи и вариабельного участка легкой цепи изображены на фигурах 26, 29 и 32 и соответствующих SEQ ID NO:204-265. В дополнительном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область HCDR2, которая содержит белковые последовательности эмбрионального типа из соответствующей пары вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где аминокислотные последовательности области HCDR2 вариабельного участка тяжелой цепи и вариабельного участка легкой цепи изображены на фигуре 26 и соответствующих SEQ ID NO:204-229. В дополнительном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область LCDR2, которая содержит белковые последовательности эмбрионального типа из соответствующей пары вариабельного участка тяжелой цепи и/или вариабельного участка легкой цепи, где аминокислотные последовательности области LCDR2 вариабельного участка тяжелой цепи и вариабельного участка легкой цепи изображены на фигурах 29 и 32 и соответствующих SEQ ID NO:230-265.

Аспект описания настоящего изобретения включает модификацию гипервариабельных участков эмбрионального типа для удаления потенциальных сайтов посттрансляционной модификации (РТМ). Примеры гипервариабельных участков вариабельного участка тяжелой цепи, модифицированных для удаления РТМ, показаны на фигурах 34-36. В одном аспекте синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает один или несколько гипервариабельных участков, содержащих аминокислотные модификации, которые удаляют потенциальные сайты посттрансляционных модификаций. В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает один или несколько гипервариабельных участков, содержащих последовательности гипервариабельных участков или последовательности нуклеиновых кислот, кодирующих то же самое, которые изображены на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. В дополнительном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область HCDR1, которая содержит HCDR1 или нуклеиновые кислоты, кодирующие то же самое, которая изображена на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. Аминокислотные последовательности областей HCDR1 с низкой РТМ изображены в SEQ ID NO:266-278. Последовательности нуклеиновых кислот областей HCDR1 с низкой РТМ изображены в SEQ ID NO:279-291. В дополнительном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область HCDR2, которая содержит область HCDR2 или нуклеиновые кислоты, кодирующие то же самое, которая изображена на фигурах 34-36, из соответствующего вариабельного участка тяжелой цепи. Аминокислотные последовательности областей HCDR2 с низкой РТМ изображены в SEQ ID NO:266-278. Последовательности нуклеиновых кислот областей HCDR2 с низкой РТМ изображены в SEQ ID NO:279-291.

Аспект описания настоящего изобретения включает использование последовательностей FR4 эмбрионального типа. В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает FR4 участок, выбранный из группы, которая содержит: JH4 (SEQ ID NO:293), Jk1 (SEQ ID NO:297) и Jλ2/3 (SEQ ID NO:301). В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область JH4 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность JH4 FR4, изображена в (SEQ ID NO:293) и (SEQ ID NO:295). Последовательность нуклеиновых кислот JH4 FR4 изображена в (SEQ ID NO:292) и (SEQ ID NO:294). В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область Jk1 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность Jk1 FR4 изображена в (SEQ ID NO:297). Последовательность нуклеиновых кислот Jk1 FR4 изображена в (SEQ ID NO:296), (SEQ ID NO:298) и (SEQ ID NO:299). В одном варианте осуществления синтетическое антитело или его функциональный фрагмент, или синтетическая нуклеиновая кислота, кодирующая такое антитело или его функциональный фрагмент, включает область Jλ2/3 FR4 эмбрионального типа, чья последовательность аминокислот или нуклеиновых кислот изображена на фигуре 40. Аминокислотная последовательность Jλ2/3 FR4 изображена в (SEQ ID NO:301). Последовательность нуклеиновых кислот Jλ2/3 FR4 изображена в (SEQ ID NO:300), (SEQ ID NO:302) и (SEQ ID NO:303).

В одном варианте осуществления синтетическое антитело или синтетическую нуклеиновую кислоту, кодирующую такое антитело, выбирают из группы, включающей человеческий IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM и IgD. В одном варианте осуществления фрагмент синтетического антитела, или синтетическую нуклеиновую кислоту, кодирующую такой фрагмент антитела, выбирают из группы, включающей Fab, F(ab′)2, Fab′, Fv и scFv.

В вариантах осуществления константный домен тяжелой цепи IgG антитела включает аминокислотные последовательности, показанные на фигурах 41 А-В (SEQ ID NO:305). В других вариантах осуществления нуклеиновые кислоты, кодирующие константные домены тяжелой цепи IgG антител включают последовательности нуклеиновых кислот, показанные на фигурах 41 А-В (SEQ ID NO:304). В вариантах осуществления константный домен тяжелой цепи Fab фрагментов антител включает аминокислотные последовательности, показанные на фигуре 42 (SEQ ID NO:307). В других вариантах осуществления нуклеиновые кислоты, кодирующие константный домен тяжелой цепи Fab фрагмента антитела, включают последовательности нуклеиновых кислот, показанные на фигуре 42 (SEQ ID NO:306). В вариантах осуществления константные домены легкой каппа-цепи IgG (SEQ ID NO:309), и/или Fab (SEQ ID NO:311) антител или фрагментов антител включают аминокислотные последовательности, показанные на фигуре 43. В других вариантах осуществления нуклеиновые кислоты, кодирующие константные домены легкой каппа-цепи IgG (SEQ ID NO:308) и/или Fab (SEQ ID NO:310) антител или фрагментов антител, включают последовательности нуклеиновых кислот, показанные на фигуре 43. В вариантах осуществления константные домены легкой лямбда-цепи IgG (SEQ ID NO:313) и/или Fab (SEQ ID NO:315) антител или фрагментов антител включают аминокислотные последовательности, показанные на фигуре 44. В других вариантах осуществления нуклеиновые кислоты, кодирующие константные домены легкой лямбда-цепи IgG (SEQ ID NO:312) и/или Fab (SEQ ID NO:314) антител или фрагментов антител включают последовательности нуклеиновых кислот, показанные на фигуре 44.

ПРИМЕРЫ

Пример 1: Создание сайтов рестрикции в C-конце прокариотической сигнальной последовательности и человеческой лидерной последовательности, предусматривающих области FR1 полной длины эмбрионального типа

В одном аспекте настоящее описание изобретения описывает коллекции антител или их фрагментов, которые включают каркасные участки, содержащие белковые последовательности эмбрионального типа, в частности FR1. Предполагают, что наличие последовательностей эмбрионального типа снизит риск иммуногенности данных антител при введении человеку. Однако следует применять совместимые сайты рестрикции с целью обеспечения стандартного клонирования нуклеиновых кислот, кодирующих коллекции антител, в дисплей и/или векторы экспрессии таким образом, что антитела можно подвергать скринингу против иммуногенов. В прошлом сайты рестрикции, используемые для клонирования, часто располагали в пределах каркасных участков, таким образом, модифицируя последовательность нуклеиновой кислоты и/или аминокислоты от эмбрионального типа. С целью обеспечения поддержания белковой последовательности эмбрионального типа по меньшей мере каркасного 1 (FR1) участка каждого из антител по настоящему описанию изобретения, не должно присутствовать никаких сайтов рестрикции в пределах FR1, которые могли бы привести к отклонению от аминокислотной последовательности эмбрионального типа. Следовательно, одним из аспектов настоящего описания изобретения является включение идентичных или по меньшей мере совместимых сайтов рестрикции в пределах С-конца прокариотических сигнальных последовательностей и человеческих лидерных последовательностей, в частности, в пределах трех С-концевых остатков. В дополнение, прокариотическая сигнальная последовательность и человеческая лидерная последовательность, включающая идентичный или совместимый сайт рестрикции, должна являться функциональной и обеспечивать хороший дисплей и продуктивность экспрессии антител или их фрагментов и в прокариотических системах экспрессии, и в системах экспрессии млекопитающих.

Фигура 1 демонстрирует выбранные сайты рестрикции и их соответствующие положения. Сайт рестрикции NheI (VLA) выбрали для включения в прокариотические сигнальные последовательности тяжелой цепи (phoA). Последовательности аминокислот и нуклеиновых кислот сигнальной последовательности phoA дикого типа и сигнальной последовательности NheI (VLA) phoA показаны в таблице 1.

Таблица 1:

Сигнальная последовательность phoA дикого типа E.coli (С-концевой аминокислотной последовательностью от положения -3 до положения -1 является TKA без сайта рестрикции):

(SEQ ID NO:8 и 7, соответственно, в порядке появления)

Модифицированная сигнальная последовательность phoA Е.coli с С-концевыми VLA и NheI сайтом рестрикции (=GCTAGC):

(SEQ ID NO:10 и 9, соответственно, в порядке появления)

Сайт рестрикции NdeI(AYA) выбрали для включения в прокариотические сигнальные последовательности каппа и лямбда (ompA). Последовательности аминокислот и нуклеиновых кислот сигнальной последовательности ompA дикого типа и модифицированной сигнальной последовательности NdeI(AYA) ompA показаны в таблице 2.

Таблица 2:

Сигнальная последовательность ompA дикого типа E.coli (С-концевой аминокислотной последовательностью от положения -3 до положения -1 является AQA без сайта рестрикции):

(SEQ ID NO:12 и 11, соответственно, в порядке появления)

Модифицированная сигнальная последовательность ompA Е.coli с С-концевыми AYA and NdeI сайтом рестрикции (=CATATG):

Альтернативно, ДНК последовательность включает:

(SEQ ID NO:14, 13 и 15 соответственно, в порядке появления).

С целью обеспечения легкого переключения от формы Fab, экспрессированной в Е.Coli, к форме IgG, экспрессированной в млекопитающем, человеческие лидерные последовательности для легкой цепи IgG (человеческая лидерная последовательность легкой каппа-цепи) и тяжелой цепи (человеческая лидерная последовательность тяжелой цепи) генерировали с содержанием тех же сайтов рестрикции, как и С-концы сигнальных последовательностей ompA (NdeI (AYA)) и phoA (NheI (VLA)). Последовательность дикого типа и модифицированные человеческая лидерная последовательность тяжелой цепи и человеческая лидерная последовательность легкой каппа-цепи показаны в таблице 3.

Таблица 3

Лидерная последовательность тяжелой цепи

А)

Человеческая лидерная последовательность тяжелой цепи дикого типа (С-концевой аминокислотной последовательностью от положения -3 до положения -1 является VLS без сайта рестрикции):

(SEQ ID NO:17 и 16, соответственно, в порядке появления)

В)

Модифицированная человеческая лидерная последовательность тяжелой цепи с С-концевыми VLA и NheI сайтом рестрикции (=GCTAGC):

(SEQ ID NO:19 и 18, соответственно, в порядке появления)

С)

Человеческая лидерная последовательность легкой каппа-цепи немутантного типа (С-концевой аминокислотной последовательностью от положения -3 до положения -1 является AYG без сайта рестрикции):

(SEQ ID NO:21 и 20, соответственно, в порядке появления)

D)

Модифицированная человеческая лидерная последовательность легкой каппа-цепи с С-концевыми AYA и NdeIсайтом рестрикции (=CATATG):

(SEQ ID NO:23 и 22, соответственно, в порядке появления)

Выбранные модифицированные прокариотические сигнальные последовательности и человеческие лидерные последовательности (а) приводят к высокому выходу белка Fab и IgG, в соответствии с применяемой векторной системой, (b) обеспечивают полную совместимость для переключения форм антитела, векторов и систем экспрессии между прокариотическими системами и системами млекопитающих и (с) располагаются в сигнальной/лидерной последовательностях, поддерживая тем самым полные последовательности эмбрионального типа АК1.

Пример 2: Идентификация наиболее часто встречающихся пар VH/VL в человеческом репертуаре

В самом общем смысле, авторы настоящего изобретения начали с идеи, что коллекция антител, которая имитирует иммунную систему человека существенным путем, может являться выгодной. Авторы настоящего изобретения работали с их гипотезой о том, что пары генов эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, в большом количестве экспрессированные в человеческом иммунном репертуаре, вероятно, обладают благоприятными биофизическими свойствами, которые могут привести к более эффективной клинической разработке и повышению безопасности и эффективности полученных антител у пациентов. В целях подтверждения данной гипотезы первым шагом являлась идентификация пар генов эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, выражено экспрессированных в человеческом иммунном репертуаре.

Пример 2.1: Определение использования VH/VL пары генов эмбрионального типа

С целью идентификации преимущественно экспрессированных VH/VL пар генов эмбрионального типа из человеческого иммунного репертуара проанализировали общедоступные данные и отобрали образцы В-клеток человека. В качестве первого шага провели обзор общедоступных данных для идентификации статей, которые описывают VH/VL пары генов эмбрионального типа, изолированные из В-клеток человека. Как уже упоминалось, многие общедоступные базы данных предусматривают последовательности антител, однако многие предусматривают только последовательности вариабельного домена либо VH, либо VL, но редко предусматривают связь VH/VL пар генов эмбрионального типа. Идентифицировали и проанализированы в деталях следующие статьи: Wardemann H. et al. (2003) Science 301, 1374-1377 и любые вспомогательные таблицы; Yurasov S. et al. (2005) J. Exp. Med. 201, 703-712 и любые вспомогательные таблицы; Tsuiji M. et al. (2006) J. Exp. Med. 203, 393-401 и любые вспомогательные таблицы; Yurasov S. et al. (2006) J. Exp. Med. 203, 2255-2262 и любые вспомогательные таблицы. Tiller Т. et al. (2007) Immunity 26, 205-213 и любые вспомогательные таблицы, and Mietzner В. et al. (2008) PNAS 105, 9727-9732 и любые вспомогательные таблицы, все из которых включены в качестве ссылки во всей их полноте. Дополнительные данные VH/VL пар идентифицировали из образца В-клеток человека, описываемого ниже.

Пример 2.2: Определение использования VH/VL пары генов из человеческого образца

С целью получения дополнительных данных использования VH/VL пар генов эмбрионального типа изолировали мононуклеарные клетки периферической крови (МКПК) из организма человека. МКПК отсортировали, кДНК В-клеток амплифицировали с помощью ПЦР, ДНК из В-клеток секвенировали, и затем последовательности проанализировали с помощью IgBLAST (Национальный центр биотехнологической информации (NCBI)) для идентификации VH/VL пар генов эмбрионального типа от каждой В-клетки.

Общие способы изолирования и сортировки человеческих МКПК из венозной крови и мононуклеарных клеток из костного мозга описаны в Tiller et al., J Immunol Methods, 2008 Jan 1; 329(1-2): 112-24, которая включена в качестве ссылки во всей полноте. МКПК изолировали, а затем отдельно отсортировали в соответствии с маркером поверхности клетки представляющего интерес фенотипа. Ig генные транскрипты отдельно отсортированных зрелых необученных (mn) В-клеток и клеток, секретирующих антитела (asc), затем ПЦР амплифицировали для определения VH/VL пар генов эмбрионального типа. Общие способы ПЦР амплификации кДНК В-клеток и праймеры, подходящие для нее же, также описаны в Tiller et. al. 2008 (ссылка выше). Применявшиеся специфические праймеры показаны в таблице 4.

Синтезировали кДНК отдельно отсортированных зрелых необученных (mn) В-клеток и клеток, секретирующих антитела (asc). Провели гнездовую ПЦР, где независимо ПЦР амплифицировали человеческие генные транскрипты IgH, Igk и IgL V. Результаты секвенирования проанализировали с помощью IgBLAST (NCBI) для идентификации соответствующих VH, VK и VL генов эмбрионального типа.

Пример 2.3 VH/VL пары генов эмбрионального типа, выявленные в человеческом иммунном репертуаре

Данные VH/VL генной пары эмбрионального типа, идентифицированные из общедоступной литературы, описываемые в примере 2.1, объединили с данными, идентифицированными из человеческого образца, описываемыми в примере 2.2. Объединенные данные проанализировали и показали в виде ранжирования в таблице 6, то есть ранжирования процентного соотношения (%) VH/VL пар генов эмбрионального типа, идентифицированных в человеческом иммунном репертуаре.

Пример 3: Определение использования VH и VL генов эмбрионального типа

Обзор таблицы 6 показывает, что небольшое число пар VH/VL являются доминирующими в человеческом иммунном репертуаре по сравнению с общим количеством генов эмбрионального типа. Вилдт и соавт. на 895-896 описали данное явление. Вилдт и соавт. также описали, что часто экспрессированные генные сегменты тяжелой и легкой цепи часто находятся в паре, и наблюдали, что половине пар выборки соответствовали лишь пять VH/VL пар генов эмбрионального типа.

В дополнение, объединенные данные и дополнительные ссылки оценили для идентификации VH, Vk и Vλ генов эмбрионального типа, которые независимо экспрессированы (не как пары) в человеческом иммунном репертуаре. Дополнительными литературными ссылками, которые включают экспрессию непарных VH и/или VL генов эмбрионального типа, являлись Brezinschek H.P. et al. (1997) J. Clin. Invest. 99, 2488, Demaison С. et al. (1995) Immunogenetics 42, 342, и Foster S.J. et al. (1997) J. Clin. Invest. 99, 1614, которые обе включены в качестве ссылки во всей их полноте. Данные из примеров 2.1 и 2.2 и дополнительных ссылок объединили и ранжировали для определения VH, Vk и Vλ генов эмбрионального типа, наиболее заметно экспрессированных в человеческом иммунном репертуаре. Ранжирование показано в таблице 5.

При сравнении таблицы 5, показывающей распространенность несцепленных VH, Vk и Vλ генов эмбрионального типа в человеческом иммунном репертуаре, и таблицы 6, показывающей распространенность сцепленных VH/VL пар генов эмбрионального типа в человеческом иммунном репертуаре, являлось очевидным, что многие из VH, Vk и Vλ генов эмбрионального типа, которые широко представлены при оценке независимо от сцепления или пар, также являлись широко представленными в VH/VL парах.

Данное наблюдение подтверждается участками, показанными на фигурах 4-5, которые показывают VH/VL пары генов эмбрионального типа человеческого иммунного репертуара. Фигуры показывают фактическое число каждой VH/VL генной пары эмбрионального типа, идентифицированной из объединенных данных, нанесенных на матрицу, где ось Y включает ранжирование VH генов эмбрионального типа, а ось Х включает ранжирование VL генов эмбрионального типа.

Пример 4: Выбор VH/VL пар генов эмбрионального типа для дальнейшей оценки их биофизических свойств

В качестве следующего шага являлось необходимым определить, какие белковые пары эмбрионального типа следует тестировать, так как в человеческом иммунном репертуаре существует ~2500 пар, и целью авторов настоящего изобретения являлось определение белковых пар эмбрионального типа, которые включают благоприятные биофизические свойства, которые помогали бы в подборе и разработке. Одним из способов могло являться тестирование белковых пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые выраженно встречаются в человеческом иммунном репертуаре, например, смотри таблицу 6. Можно, например, выбрать ведущие четыреста пар для тестирования, или выбрать белковые пары эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, присутствующие свыше определенного порогового числа. Данный подход потребовал бы синтеза и тестирования большого числа различных последовательностей белковых пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, следовательно, такой подход может оказаться не очень эффективным.

В качестве альтернативного подхода авторы настоящего изобретения выбрали подгруппу пар эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые являются репрезентативными, точно воспроизводят или охватывают большинство выраженных пар из человеческого иммунного репертуара. Данный подход основывался, в частности, на вышеприведенном наблюдении, что небольшое число генов эмбрионального типа (непарных) вариабельного участка тяжелой цепи, вариабельного участка k-легкой цепи и вариабельного участка λ-легкой цепи являются доминирующими в человеческом иммунном репертуаре. Следовательно, небольшое число выраженных генов эмбрионального типа (непарных) тяжелой и легкой цепи можно комбинировать для создания группы VH/VL пар, которые являются репрезентативными в человеческом иммунном репертуаре.

Данный подход предприняли следующим образом. В примере 3 определили экспрессию генов эмбрионального типа вариабельного участка тяжелой цепи, вариабельного участка k-легкой цепи и вариабельного участка λ-легкой цепи. В качестве следующего шага, выполнили in silica анализ выраженных VH, Vk и Vλ генов эмбрионального типа, где оценили по меньшей мере следующие факторы: длина CDR, изоэлектрическая точка (pi) (предпочтительная изоэлектрическая точка составляет 7,5 или выше, так как она должна обеспечивать стабильность в стандартной буферной смеси от рН 5,5 до рН 7), потенциальные сайты посттрансляционной модификации (РТМ) (в частности, N-связанные сайты гликозилирования (NxS или NxT) или химических модификаций, таких как расщепление Asp (аспарагиновой кислоты) (часто в DP или DQ), изомеризация Asp (DS, DG), деамидирование (NS, NG), которые могут возникать in vivo (в сыворотке крови) или при хранении в буферной смеси, и приводить к потере связывания антител), присутствие метионина в областях CDR (может окисляться при контакте с растворителем), присутствие неспаренного цистеина (образует дисульфидные связи с любым другим неспаренным цистеином, что приводит к сшиванию белков и/или пониженной мощности экспрессии), отклонения от эмбрионального типа, присутствие возможных Т-клеточных эпитопов, и теоретическая способность к агрегации. Отобранные данные in silico анализа показаны на фигурах 2-3.

На основе in silico анализа выраженных VH, Vλ и Vk генов эмбрионального типа выбрали их подгруппу для синтеза, комбинации и последующего функционального тестирования. Данная подгруппа показана на фигуре 2-3. При сравнении таблицы 5 и фигур 2-3 становится ясным, что не все из наиболее выраженных VH, Vλ и Vk генов эмбрионального типа выбрали для дальнейшего тестирования. Из наиболее выраженных VH генов эмбрионального типа, показанных в таблице 5, не выбрали IGHV4-34, IGHV4-59 и IGHV3-9. Вместо этого, смотри на фигурах 2-3, выбрали IGHV3-74, IGHV3-73, и IGHV6-1. В общей сложности выбрали 20 VH генов эмбрионального типа. Из наиболее выраженных Vk генов эмбрионального типа, показанных в таблице 5, не выбрали IGKV4-1, IGKV2-28/2D-28, IGKV1 -33/1D-33 и IGKV1-8. В общей сложности выбрали 12 Vk генов эмбрионального типа. Из наиболее выраженных Vλ генов эмбрионального типа, показанных в таблице 5, не выбрали IGLV1-44. В общей сложности выбрали 8 Vλ генов эмбрионального типа.

Таблица 5 показывает ранжирование использования VH, Vk и Vλ генов эмбрионального типа из человеческого иммунного репертуара и выделяет жирным шрифтом и подчеркивает гены эмбрионального типа, которые выбрали для дальнейшего функционального тестирования.

Таблица 5

Пример 4.1: Рекомбинация широко распространенных VH, Vk и Vλ генов эмбрионального типа для создания отображения наиболее выраженных VH/VL пар в человеческом иммунном репертуаре.

В качестве следующего шага, синтезировали и комбинировали 20 VH, 12 Vk и 8 Vλ выбранных VH, Vk и Vλ генов эмбрионального типа с созданием 400 VH/VL генных пар эмбрионального типа, которые впоследствии тестировали по их биофизическим свойствам. Таблица 6 показывает, что 400 VH/VL пар генов эмбрионального типа, генерированных для проведения функционального тестирования, по сути, точно воспроизводят или охватывают большинство выраженных VH/VL пар генов эмбрионального типа в человеческом иммунном репертуаре. Таблица 6 показывает ранжирование VH/VL пар, экспрессированных в человеческом иммунном репертуаре, где 400 VH/VL пар, которые протестировали, выделены жирным шрифтом и подчеркнуты.

Таблица 6:
400 функционально протестированных VH/VL пар генов эмбрионального типа являются репрезентативными для VH/VL пар генов эмбрионального типа, идентифицированных в человеческом иммунном репертуаре "pos" представляет позицию относительного ранжирования VH/VL пар, определяемую процентом (%) каждой VH (V heavy) / VL (V light) пары от общих объединенных данных. N=2137 B-клеток
поз V тяжелые V легкие %
1 IGHV3-23 IGKV1-5 1,26
2 IGHV4-34 IGKV3-20 1,17
3 IGHV3-23 IGKV3-20 1,12
4 IGHV4-39 IGKV3-15 1,03
5 IGHV3-23 IGKV3-15 0,94
6 IGHV4-59 IGKV1-39/1D-39 0,89
7 IGHV4-39 IGKV1-39/1D-39 0,84
IGHV4-34 IGKV1-39/1D-39 0,84
8 IGHV4-59 IGKV3-20 0,70
IGHV1-18 IGKV3-20 0,70
9 IGHV3-30 IGKV3-20 0,66
IGHV4-39 IGKV1-5 0,66
IGHV1-69 IGKV1-39/1D-39 0,66
IGHV5-51 IGLV 1-40 0,66
10 IGHV3-23 IGKV4-1 0,61
IGHV4-39 IGKV3-20 0,61
IGHV3-23 IGLV 2-14 0,61
IGHV4-39 IGLV 3-21 0,61
11 IGHV3-23 IGKV1-39/1D-39 0,56
IGHV3-30 IGKV1-39/1D-39 0,56
IGHV3-30 IGKV3-11 0,56
IGHV1-69 IGKV3-20 0,56
IGHV3-48 IGKV3-20 0,56
IGHV1-2 IGKV3-20 0,56
12 IGHV3-30 IGKV4-1 0,51
IGHV5-51 IGLV 2-14 0,51
13 IGHV4-59 IGKV4-1 0,47
IGHV5-51 IGKV3-20 0,47
IGHV3-7 IGKV1-39/1D-39 0,47
IGHV3-7 IGKV1-5 0,47
IGHV3-15 IGKV3-20 0,47
IGHV4-39 IGLV 2-14 0,47
IGHV4-39 IGLV 2-8 0,47
IGHV4-34 IGLV 2-14 0,47
14 IGHV3-23 IGKV3-11 0,42
IGHV3-30 IGKV1-5 0,42
IGHV3-30 IGKV3-15 0,42
IGHV4-34 IGKV1-5 0,42
IGHV3-21 IGKV1-5 0,42
IGHV3-21 IGKV3-15 0,42
IGHV3-30 IGLV 1-51 0,42
IGHV4-34 IGLV 1-51 0,42
IGHV3-21 IGLV 1-51 0,42
IGHV3-53 IGLV 1-44 0,42
15 IGHV4-59 IGKV3-15 0,37
IGHV4-34 IGKV3-15 0,37
IGHV5-51 IGKV4-1 0,37
IGHV1-69 IGKV4-1 0,37
IGHV1-69 IGKV3-11 0,37
IGHV3-7 IGKV3-15 0,37
IGHV1-18 IGKV1-39/1D-39 0,37
IGHV3-48 IGKV1-39/1D-39 0,37
IGHV3-33 IGKV3-15 0,37
IGHV3-53 IGKV1-5 0,37
IGHV4-59 IGLV 1-40 0,37
IGHV1-69 IGLV 2-14 0,37
IGHV1-69 IGLV 1-44 0,37
IGHV4-31 IGLV 2-14 0,37
IGHV1-2 IGLV 2-14 0,37
16 IGHV3-23 IGKV2-28/2D-28 0,33
IGHV3-30 IGKV1-9 0,33
IGHV4-34 IGKV4-1 0,33
IGHV5-51 IGKV1-39/1D-39 0,33
IGHV5-51 IGKV3-15 0,33
IGHV1-69 IGKV3-15 0,33
IGHV1-18 IGKV1-33/1D-33 0,33
IGHV3-48 IGKV3-11 0,33
IGHV3-21 IGKV1-39/1D-39 0,33
IGHV4-31 IGKV3-20 0,33
IGHV4-31 IGKV3-11 0,33
IGHV3-30 IGLV 2-14 0,33
IGHV4-39 IGLV 1-44 0,33
IGHV1-69 IGLV 1-40 0,33
IGHV3-9 IGLV 2-23 0,33
17 IGHV3-23 IGKV1-33/1D-33 0,28
IGHV4-39 IGKV3-11 0,28
IGHV4-34 IGKV3-11 0,28
IGHV4-34 IGKV2-28/2D-28 0,28
IGHV5-51 IGKV3-11 0,28
IGHV5-51 IGKV1-13 0,28
IGHV3-7 IGKV3-20 0,28
IGHV3-48 IGKV3-15 0,28
IGHV3-48 IGKV4-1 0,28
IGHV3-48 IGKV1-33/1D-33 0,28
IGHV3-15 IGKV1-39/1D-39 0,28
IGHV3-15 IGKV1-5 0,28
IGHV1-2 IGKV1-39/1D-39 0,28
IGHV3-33 IGKV3-20 0,28
IGHV3-33 IGKV1-39/1D-39 0,28
IGHV3-33 IGKV4-1 0,28
IGHV3-53 IGKV3-15 0,28
IGHV3-11 IGKV1-5 0,28
IGHV4-4 IGKV3-20 0,28
IGHV1-46 IGKV3-20 0,28
IGHV3-23 IGLV 1-40 0,28
IGHV3-23 IGLV3-21 0,28
IGHV4-39 IGLV 1-40 0,28
IGHV4-34 IGLV 1-40 0,28
IGHV4-34 IGLV 1-47 0,28
IGHV3-48 IGLV 2-14 0,28
IGHV3-48 IGLV 1-47 0,28
IGHV1-2 IGLV 1-40 0,28
IGHV3-9 IGLV2-14 0,28
IGHV4-4 IGLV 1-44 0,28
18 IGHV3-23 IGKV1-17 0,23
IGHV4-39 IGKV4-1 0,23
IGHV4-39 IGKV2-28/2D-28 0,23
IGHV1-69 IGKV1-5 0,23
IGHV3-7 IGKV4-1 0,23
IGHV1-18 IGKV1-5 0,23
IGHV1-18 IGKV2-28/2D-28 0,23
IGHV3-21 IGKV3-20 0,23
IGHV3-33 IGKV1-5 0,23
IGHV3-53 IGKV1-39/1D-39 0,23
IGHV3-53 IGKV1-33/1D-33 0,23
IGHV3-11 IGKV1-39/1D-39 0,23
IGHV3-11 1GKV3-15 0,23
IGHV4-4 IGKV1-39/1D-39 0,23
IGHV1-46 IGKV1-39/1D-39 0,23
IGHV4-61 IGKV4-1 0,23
IGHV3-23 IGLV 1-44 0,23
IGHV3-23 IGLV 2-11 0,23
IGHV3-23 IGLV 3-1 0,23
IGHV3-30 IGLV 1-40 0,23
IGHV4-39 IGLV 1-51 0,23
IGHV4-39 IGLV 2-23 0,23
IGHV4-59 IGLV 3-1 0,23
IGHV5-51 IGLV 1-44 0,23
IGHV1-69 IGLV 1-51 0,23
IGHV1-69 IGLV 2-11 0,23
IGHV1-18 IGLV 2-14 0,23
IGHV1-18 IGLV 1-40 0,23
IGHV3-21 IGLV 2-14 0,23
IGHV1-2 IGLV 1-44 0,23
19 IGHV3-23 IGKV1-27 0,19
IGHV3-23 IGKV1-8 0,19
IGHV3-30 IGKV2-28/2D-28 0,19
IGHV4-39 IGKV1-33/1D-33 0,19
IGHV4-39 IGKV1-27 0,19
IGHV4-59 IGKV3-11 0,19
IGHV5-51 IGKV1-5 0,19
IGHV5-51 IGKV2-28/2D-28 0,19
IGHV3-7 IGKV3-11 0,19
IGHV3-7 IGKV2-30 0,19
IGHV1-18 IGKV3-15 0,19
IGHV1-18 IGKV3-11 0,19
IGHV3-21 IGKV4-1 0,19
IGHV3-15 IGKV3-15 0,19
IGHV3-15 IGKV4-1 0,19
IGHV3-15 IGKV1-33/1D-33 0,19
IGHV4-31 IGKV1-39/1D-39 0,19
IGHV4-31 IGKV1-5 0,19
IGHV4-31 IGKV3-15 0,19
IGHV4-31 IGKV2-28/2D-28 0,19
IGHV3-33 IGKV2-28/2D-28 0,19
IGHV3-53 IGKV4-1 0,19
IGHV3-53 IGKV3-11 0,19
IGHV3-74 IGKV3-20 0,19
IGHV4-4 IGKV1-5 0,19
IGHV1-46 IGKV1-9 0,19
IGHV1-8 IGKV3-15 0,19
IGHV1-24 IGKV3-11 0,19
IGHV1-3 IGKV1-39/1D-39 0,19
IGHV3-49 IGKV1-39/1D-39 0,19
IGHV3-23 IGLV 2-23 0,19
IGHV3-30 IGLV 1-44 0,19
IGHV4-59 IGLV 2-14 0,19
IGHV4-59 IGLV 1-44 0,19
IGHV4-59 IGLV 1-51 0,19
IGHV4-34 IGLV 2-8 0,19
IGHV5-51 IGLV 1-47 0,19
IGHV1-69 IGLV 2-8 0,19
IGHV3-7 IGLV 1-40 0,19
IGHV3-15 IGLV 1-44 0,19
IGHV4-31 IGLV 2-23 0,19
IGHV3-33 IGLV 2-14 0,19
IGHV3-33 IGLV 1-47 0,19
IGHV3-33 IGLV 2-23 0,19
IGHV3-33 IGLV 3-21 0,19
IGHV3-9 IGLV 1-44 0,19
IGHV4-4 IGLV 2-14 0,19
IGHV1-46 IGLV 1-51 0,19
IGHV4-61 IGLV 1-44 0,19
IGHV1-8 IGLV 2-14 0,19
IGHV4-28 IGLV 2-23 0,19
20 IGHV3-23 IGKV1-9 0,14
IGHV3-23 IGKV1-16 0,14
IGHV4-39 IGKV1-6 0,14
IGHV4-59 IGKV1-5 0,14
IGHV4-59 IGKV1-27 0,14
IGHV4-34 IGKV1-33/1D-33 0,14
IGHV5-51 IGKV1-33/1D-33 0,14
IGHV1-69 IGKV2-28/2D-28 0,14
IGHV1-69 IGKV1-33/1D-33 0,14
IGHV3-7 IGKV2-28/2D-28 0,14
IGHV3-7 IGKV1-8 0,14
IGHV3-48 IGKV2-28/2D-28 0,14
IGHV3-48 IGKV1-8 0,14
IGHV3-15 IGKV3-11 0,14
IGHV3-15 IGKV2-28/2D-28 0,14
IGHV3-15 IGKV1-9 0,14
IGHV4-31 IGKV1-33/1D-33 0,14
IGHV1-2 IGKV1-5 0,14
IGHV1-2 IGKV4-1 0,14
IGHV3-11 IGKV3-20 0,14
IGHV3-11 IGKV3-11 0,14
IGHV3-11 IGKV2-28/2D-28 0,14
IGHV3-9 IGKV1-39/1D-39 0,14
IGHV3-9 IGKV1-5 0,14
IGHV3-9 IGKV4-1 0,14
IGHV3-9 IGKV2D-29 0,14
IGHV3-74 IGKV1-39/1D-39 0,14
IGHV3-74 IGKV1-5 0,14
IGHV3-74 IGKV3-15 0,14
IGHV3-74 IGKV4-1 0,14
IGHV4-4 IGKV3-15 0,14
IGHV4-4 IGKV4-1 0,14
IGHV4-4 IGKV3-11 0,14
IGHV1-46 IGKV1-5 0,14
IGHV1-46 IGKV3-15 0,14
IGHV4-61 IGKV1-39/1D-39 0,14
IGHV1-24 IGKV1-39/1D-39 0,14
IGHV1-24 IGKV3-15 0,14
IGHV1-3 IGKV3-15 0,14
IGHV3-49 IGKV1-17 0,14
IGHV3-43 IGKV1-5 0,14
IGHV7-81 IGKV3-20 0,14
IGHV3-13 IGKV1-39/1D-39 0,14
IGHV3-23 IGLV 1-51 0,14
IGHV3-30 IGLV 3-21 0,14
IGHV3-30 IGLV 3-1 0,14
IGHV4-39 IGLV 1-47 0,14
IGHV4-39 IGLV 2-18 0,14
IGHV4-59 IGLV 1-47 0,14
IGHV5-51 IGLV 2-23 0,14
IGHV5-51 IGLV 3-21 0,14
IGHV1-69 IGLV 2-23 0,14
IGHV3-7 IGLV 1-44 0,14
IGHV3-7 IGLV 1-51 0,14
IGHV3-7 IGLV 1-47 0,14
IGHV3-7 IGLV 3-21 0,14
IGHV1-18 IGLV 1-44 0,14
IGHV1-18 IGLV 1-51 0,14
IGHV3-48 IGLV 3-1 0,14
IGHV3-21 IGLV 1-47 0,14
IGHV3-15 IGLV 7-46 0,14
IGHV4-31 IGLV 1-40 0,14
IGHV4-31 IGLV 1-51 0,14
IGHV4-31 IGLV 1-47 0,14
IGHV1-2 IGLV 1-51 0,14
IGHV1-2 IGLV 2-23 0,14
IGHV1-2 IGLV 3-1 0,14
IGHV3-11 IGLV 2-14 0,14
IGHV3-11 IGLV 1-44 0,14
IGHV3-11 IGLV 2-11 0,14
IGHV3-11 IGLV 3-1 0,14
IGHV3-9 IGLV 1-47 0,14
IGHV3-9 IGLV2-11 0,14
IGHV3-74 IGLV 2-23 0,14
IGHV3-74 IGLV3-21 0,14
IGHV4-4 IGLV 1-40 0,14
IGHV1-46 IGLV 2-14 0,14
IGHV1-46 IGLV 1-44 0,14
IGHV4-61 IGLV 2-14 0,14
21 IGHV3-23 IGKV2D-29 0,09
IGHV3-23 IGKV2-29 0,09
IGHV3-23 IGKV2-40/2D-40 0,09
IGHV3-30 IGKV1-33/1D-33 0,09
IGHV3-30 IGKV2-30 0,09
IGHV3-30 IGKV1-8 0,09
IGHV3-30 IGKV1-6 0,09
IGHV3-30 IGKV2-24 0,09
IGHV3-30 IGKV1D-8 0,09
IGHV4-39 IGKV2-30 0,09
IGHV4-59 IGKV1-33/1D-33 0,09
IGHV4-59 IGKV1-12 0,09
IGHV4-34 IGKV1-9 0,09
IGHV4-34 IGKV1-17 0,09
IGHV4-34 IGKV1-16 0,09
IGHV5-51 IGKV2-30 0,09
IGHV1-69 IGKV1-27 0,09
IGHV1-69 IGKV1-8 0,09
IGHV1-69 IGKV3D-15 0,09
IGHV3-7 IGKV1-9 0,09
IGHV3-7 IGKV1-17 0,09
IGHV3-7 IGKV1-27 0,09
IGHV3-7 IGKV1-13 0,09
IGHV1-18 IGKV4-1 0,09
IGHV1-18 IGKV2-30 0,09
IGHV3-48 IGKV1-9 0,09
IGHV3-48 IGKV1-17 0,09
IGHV3-48 IGKV1-16 0,09
IGHV3-21 IGKV3-11 0,09
IGHV3-21 IGKV2-28/2D-28 0,09
IGHV3-21 IGKV1-27 0,09
IGHV3-21 IGKV1-8 0,09
IGHV3-21 IGKV1-6 0,09
IGHV4-31 IGKV4-1 0,09
IGHV4-31 IGKV1-17 0,09
IGHV4-31 IGKV1-27 0,09
IGHV1-2 IGKV3-15 0,09
IGHV1-2 IGKV2-28/2D-28 0,09
IGHV1-2 IGKV1-27 0,09
IGHV3-33 IGKV3-11 0,09
IGHV3-33 IGKV1-33/1D-33 0,09
IGHV3-33 IGKV1-9 0,09
IGHV3-53 IGKV3-20 0,09
IGHV3-53 IGKV1-27 0,09
IGHV3-53 IGKV1-8 0,09
IGHV3-11 IGKV4-1 0,09
IGHV3-11 IGKV1-6 0,09
IGHV3-9 IGKV3-15 0,09
IGHV3-9 IGKV3-11 0,09
IGHV3-9 IGKV1-16 0,09
IGHV3-74 IGKV3-11 0,09
IGHV3-74 IGKV2-30 0,09
IGHV4-4 IGKV2-28/2D-28 0,09
IGHV4-4 IGKV2D-29 0,09
IGHV1-46 IGKV3-11 0,09
IGHV1-46 IGKV1-27 0,09
IGHV1-46 IGKV1-16 0,09
IGHV4-61 IGKV3-15 0,09
IGHV1-8 IGKV3-20 0,09
IGHV1-8 IGKV4-1 0,09
IGHV1-24 IGKV2-28/2D-28 0,09
IGHV1-24 IGKV2-30 0,09
IGHV1-3 IGKV3-20 0,09
IGHV3-49 IGKV3-20 0,09
IGHV3-49 IGKV1-5 0,09
IGHV3-43 IGKV3-11 0,09
IGHV3-64 IGKV1-5 0,09
IGHV3-64 IGKV3-11 0,09
IGHV7-81 IGKV1-39/1D-39 0,09
IGHV3-13 IGKV4-1 0,09
IGHV3-72 IGKV1-5 0,09
IGHV3-72 IGKV3-15 0,09
IGHV1-58 IGKV3-20 0,09
IGHV3-66 IGKV1-39/1D-39 0,09
IGHV3-23 IGLV 1-36 0,09
IGHV3-30 IGLV 2-23 0,09
IGHV3-30 IGLV 2-11 0,09
IGHV3-30 IGLV 9-49 0,09
IGHV3-30 IGLV 3-10 0,09
IGHV4-39 IGLV 3-1 0,09
IGHV4-39 IGLV 6-57 0,09
IGHV4-59 IGLV 2-23 0,09
IGHV4-59 IGLV 3-21 0,09
IGHV4-59 IGLV 2-11 0,09
IGHV4-34 IGLV 1-44 0,09
IGHV4-34 IGLV 2-23 0,09
IGHV4-34 IGLV 3-21 0,09
IGHV4-34 IGLV 3-25 0,09
IGHV5-51 IGLV 1-36 0,09
IGHV5-51 IGLV 3-25 0,09
IGHV1-69 IGLV 1-47 0,09
IGHV1-69 IGLV 3-21 0,09
IGHV1-69 IGLV 3-1 0,09
IGHV3-7 IGLV 2-14 0,09
IGHV1-18 IGLV 2-8 0,09
IGHV1-18 IGLV 6-57 0,09
IGHV3-48 IGLV 2-11 0,09
IGHV3-21 IGLV 1-40 0,09
IGHV3-21 IGLV 1-44 0,09
IGHV3-21 IGLV 3-21 0,09
IGHV3-21 IGLV 2-11 0,09
IGHV3-21 IGLV 4-69 0,09
IGHV3-15 IGLV 1-40 0,09
IGHV3-15 IGLV 1-51 0,09
IGHV3-15 IGLV 3-1 0,09
IGHV3-15 IGLV 2-8 0,09
IGHV3-15 IGLV 7-43 0,09
IGHV4-31 IGLV 3-21 0,09
IGHV1-2 IGLV 2-8 0,09
IGHV1-2 IGLV 7-46 0,09
IGHV3-33 IGLV 6-57 0,09
IGHV3-53 IGLV 2-14 0,09
IGHV3-11 IGLV 2-23 0,09
IGHV3-11 IGLV 3-21 0,09
IGHV3-11 IGLV 4-69 0,09
IGHV3-9 IGLV 3-21 0,09
IGHV3-9 IGLV 2-8 0,09
IGHV3-74 IGLV 2-14 0,09
IGHV4-4 IGLV 1-51 0,09
IGHV4-4 IGLV 2-23 0,09
IGHV4-4 IGLV 2-8 0,09
IGHV1-46 IGLV 2-11 0,09
IGHV4-61 IGLV 2-11 0,09
IGHV1-8 IGLV 1-47 0,09
IGHV1-24 IGLV 2-23 0,09
IGHV1-3 IGLV 2-14 0,09
IGHV1-3 IGLV 2-23 0,09
IGHV1-3 IGLV 3-1 0,09
IGHV3-49 IGLV 3-21 0,09
IGHV4-28 IGLV 1-44 0,09
IGHV4-28 IGLV 1-51 0,09
IGHV4-28 IGLV 1-36 0,09
IGHV3-43 IGLV 1-51 0,09
IGHV3-64 IGLV 3-21 0,09
IGHV7-81 IGLV 2-14 0,09
IGHV7-81 IGLV 3-21 0,09
22 IGHV3-23 IGKV2-30 0,05
IGHV3-23 IGKV1-12 0,05
IGHV3-23 IGKV3D-20 0,05
IGHV3-23 IGKV1D-12 0,05
IGHV3-23 IGKV1D-13 0,05
IGHV3-30 IGKV1-17 0,05
IGHV3-30 IGKV1-27 0,05
IGHV3-30 IGKV1-16 0,05
IGHV3-30 IGKV2D-29 0,05
IGHV3-30 IGKV1-13 0,05
IGHV3-30 IGKV5-2 0,05
IGHV3-30 IGKV2D-30 0,05
IGHV4-39 IGKV1-17 0,05
IGHV4-39 IGKV3D-15 0,05
IGHV4-59 IGKV2-30 0,05
IGHV4-59 IGKV1-17 0,05
IGHV4-59 IGKV1-8 0,05
IGHV4-59 IGKV1-16 0,05
IGHV4-59 IGKV ID-43 0,05
IGHV4-59 IGKV2D-30 0,05
IGHV4-59 IGKV1D-17 0,05
IGHV4-34 IGKV1-27 0,05
IGHV4-34 IGKV1-8 0,05
IGHV4-34 IGKV1-12 0,05
IGHV5-51 IGKV1-9 0,05
IGHV5-51 IGKV1-17 0,05
IGHV5-51 IGKV1-27 0,05
IGHV5-51 IGKV1-12 0,05
IGHV1-69 IGKV2-30 0,05
IGHV1-69 IGKV1-16 0,05
IGHV1-69 IGKV1-6 0,05
IGHV1-69 IGKV2D-29 0,05
IGHV1-69 IGKV2D-30 0,05
IGHV1-69 IGKV1D-16 0,05
IGHV3-7 IGKV1-6 0,05
IGHV3-7 IGKV1D-8 0,05
IGHV3-7 IGKV1D-17 0,05
IGHV1-18 IGKV1-17 0,05
IGHV1-18 IGKV1-8 0,05
IGHV1-18 IGKV1-16 0,05
IGHV1-18 IGKV1-12 0,05
IGHV1-18 IGKV1-13 0,05
IGHV1-18 IGKV2-40/2D-40 0,05
IGHV3-48 IGKV1-5 0,05
IGHV3-48 IGKV1-27 0,05
IGHV3-48 IGKV1-6 0,05
IGHV3-48 IGKV2D-29 0,05
IGHV3-48 IGKV3D-20 0,05
IGHV3-48 IGKV1D-12 0,05
IGHV3-21 IGKV2D-29 0,05
IGHV3-15 IGKV2-30 0,05
IGHV3-15 IGKV1-27 0,05
IGHV3-15 IGKV2D-29 0,05
IGHV3-15 IGKV1-13 0,05
IGHV3-15 IGKV ID-43 0,05
IGHV4-31 IGKV1-6 0,05
IGHV4-31 IGKV2-29 0,05
IGHV4-31 IGKV2-40/2D-40 0,05
IGHV1-2 IGKV 1-33/1 D-33 0,05
IGHV1-2 IGKV2-30 0,05
IGHV1-2 IGKV1-8 0,05
IGHV1-2 IGKV1-6 0,05
IGHV3-33 IGKV1-17 0,05
IGHV3-33 IGKV1-8 0,05
IGHV3-33 IGKV1-16 0,05
IGHV3-33 IGKV2-24 0,05
IGHV3-53 IGKV2-28/2D-28 0,05
IGHV3-53 IGKV1-9 0,05
IGHV3-53 IGKV1-17 0,05
IGHV3-53 IGKV1-12 0,05
IGHV3-53 IGKV2-29 0,05
IGHV3-53 IGKV1D-16 0,05
IGHV3-11 IGKV1-33/1D-33 0,05
IGHV3-11 IGKV1-9 0,05
IGHV3-11 IGKV1-17 0,05
IGHV3-11 IGKV1-12 0,05
IGHV3-11 IGKV1D-8 0,05
IGHV3-9 IGKV3-20 0,05
IGHV3-9 IGKV2-28/2D-28 0,05
IGHV3-9 IGKV1-17 0,05
IGHV3-9 IGKV1-27 0,05
IGHV3-9 IGKV1-8 0,05
IGHV3-9 IGKV1-12 0,05
IGHV3-9 IGKV1D-8 0,05
IGHV4-4 IGKV1-17 0,05
IGHV4-4 IGKV1-27 0,05
IGHV4-4 IGKV1-6 0,05
IGHV4-4 IGKV1D-8 0,05
IGHV1-46 IGKV4-1 0,05
IGHV1-46 IGKV 1-33/1 D-33 0,05
IGHV1-46 IGKV1-8 0,05
IGHV4-61 IGKV3-11 0,05
IGHV4-61 IGKV2-28/2D-28 0,05
IGHV4-61 IGKV1-16 0,05
IGHV4-61 IGKV1-12 0,05
IGHV4-61 IGKV1-13 0,05
IGHV1-8 IGKV1-39/1D-39 0,05
IGHV1-8 IGKV 1-5 0,05
IGHV1-8 IGKV3-11 0,05
IGHV1-8 IGKV2-28/2D-28 0,05
IGHV1-8 IGKV1-33/1D-33 0,05
IGHV1-8 IGKV1-9 0,05
IGHV1-8 IGKV2-29 0,05
IGHV1-24 IGKV3-20 0,05
IGHV1-24 IGKV4-1 0,05
IGHV1-24 IGKV1-33/1D-33 0,05
IGHV1-24 IGKV2-24 0,05
IGHV1-24 IGKV2-40/2D-40 0,05
IGHV1-3 IGKV 1-5 0,05
IGHV1-3 IGKV1-33/1D-33 0,05
IGHV1-3 IGKV2-30 0,05
IGHV1-3 IGKV1-6 0,05
IGHV1-3 IGKV2D-29 0,05
IGHV3-49 IGKV3-15 0,05
IGHV3-49 IGKV3-11 0,05
IGHV3-49 IGKV2-28/2D-28 0,05
IGHV4-28 IGKV3-20 0,05
IGHV4-28 IGKV1-39/1D-39 0,05
IGHV3-43 IGKV3-15 0,05
IGHV3-43 IGKV4-1 0,05
IGHV3-43 IGKV2-28/2D-28 0,05
IGHV3-43 IGKV1-33/1D-33 0,05
IGHV3-64 IGKV3-15 0,05
IGHV3-64 IGKV1-9 0,05
IGHV3-64 IGKV2D-29 0,05
IGHV7-81 IGKV 1-5 0,05
IGHV7-81 IGKV4-1 0,05
IGHV7-81 IGKV2-28/2D-28 0,05
IGHV3-13 IGKV1-5 0,05
IGHV3-13 IGKV1-33/1D-33 0,05
IGHV3-13 IGKV1-9 0,05
IGHV3-13 IGKV2-30 0,05
IGHV3-72 IGKV3-20 0,05
IGHV3-72 IGKV1-9 0,05
IGHV3-72 IGKV1-17 0,05
IGHV3-72 IGKV1-16 0,05
IGHV3-73 IGKV2-28/2D-28 0,05
IGHV3-73 IGKV1-9 0,05
IGHV1-58 IGKV1-5 0,05
IGHV1-58 IGKV4-1 0,05
IGHV1-58 IGKV3-11 0,05
IGHV4-30.2 IGKV1-39/1D-39 0,05
IGHV4-30.2 IGKV4-1 0,05
IGHV7-4.1 IGKV1-39/1D-39 0,05
IGHV7-4.1 IGKV1-5 0,05
IGHV3-20 IGKV1-39/1D-39 0,05
IGHV3-23 IGLV 1-47 0,05
IGHV3-23 IGLV 2-8 0,05
IGHV3-23 IGLV 7-43 0,05
IGHV3-23 IGLV 2-18 0,05
IGHV3-23 IGLV 3-19 0,05
IGHV3-30 IGLV 1-47 0,05
IGHV3-30 IGLV 2-8 0,05
IGHV3-30 IGLV 6-57 0,05
IGHV3-30 IGLV 3-27 0,05
IGHV4-39 IGLV 7-46 0,05
IGHV4-39 IGLV 3-9 0,05
IGHV4-59 IGLV 2-8 0,05
IGHV4-59 IGLV 6-57 0,05
IGHV4-59 IGLV 3-12 0,05
IGHV4-34 IGLV 2-11 0,05
IGHV4-34 IGLV 1-36 0,05
IGHV4-34 IGLV 7-43 0,05
IGHV4-34 IGLV 9-49 0,05
IGHV5-51 IGLV 7-43 0,05
IGHV1-69 IGLV 6-57 0,05
IGHV1-69 IGLV 3-25 0,05
IGHV1-69 IGLV 3-10 0,05
IGHV3-7 IGLV 2-23 0,05
IGHV3-7 IGLV 3-1 0,05
IGHV3-7 IGLV 2-8 0,05
IGHV3-7 IGLV 7-46 0,05
IGHV3-7 IGLV 3-27 0,05
IGHV1-18 IGLV 2-23 0,05
IGHV1-18 IGLV 2-11 0,05
IGHV1-18 IGLV 1-36 0,05
IGHV1-18 IGLV 3-25 0,05
IGHV1-18 IGLV 3-10 0,05
IGHV3-48 IGLV 1-40 0,05
IGHV3-48 IGLV 1-44 0,05
IGHV3-48 IGLV 1-51 0,05
IGHV3-48 IGLV 2-23 0,05
IGHV3-48 IGLV3-21 0,05
IGHV3-48 IGLV 3-25 0,05
IGHV3-48 IGLV 7-46 0,05
IGHV3-48 IGLV 9-49 0,05
IGHV3-21 IGLV 2-23 0,05
IGHV3-21 IGLV 3-1 0,05
IGHV3-21 IGLV 2-8 0,05
IGHV3-21 IGLV 6-57 0,05
IGHV3-21 IGLV 3-25 0,05
IGHV3-21 IGLV 7-46 0,05
IGHV3-15 IGLV 2-14 0,05
IGHV3-15 IGLV 1-47 0,05
IGHV3-15 IGLV 2-23 0,05
IGHV3-15 IGLV3-21 0,05
IGHV3-15 IGLV 6-57 0,05
IGHV3-15 IGLV 3-25 0,05
IGHV3-15 IGLV2-18 0,05
IGHV3-15 IGLV 3-22 0,05
IGHV4-31 IGLV 1-44 0,05
IGHV4-31 IGLV 2-11 0,05
IGHV4-31 IGLV 3-1 0,05
IGHV4-31 IGLV 4-69 0,05
IGHV4-31 IGLV 7-43 0,05
IGHV1-2 IGLV3-21 0,05
IGHV1-2 IGLV 2-11 0,05
IGHV1-2 IGLV 3-27 0,05
IGHV3-33 IGLV 1-40 0,05
IGHV3-33 IGLV 1-44 0,05
IGHV3-33 IGLV 1-51 0,05
IGHV3-33 IGLV 2-11 0,05
IGHV3-33 IGLV 3-1 0,05
IGHV3-33 IGLV 4-69 0,05
IGHV3-33 IGLV 3-27 0,05
IGHV3-33 IGLV 9-49 0,05
IGHV3-33 IGLV 3-9 0,05
IGHV3-53 IGLV 1-51 0,05
IGHV3-53 IGLV 1-47 0,05
IGHV3-53 IGLV 2-23 0,05
IGHV3-53 IGLV 2-11 0,05
IGHV3-53 IGLV 3-1 0,05
IGHV3-53 IGLV 2-8 0,05
IGHV3-53 IGLV 7-46 0,05
IGHV3-11 IGLV 1-40 0,05
IGHV3-11 IGLV 1-51 0,05
IGHV3-11 IGLV 1-47 0,05
IGHV3-11 IGLV 2-8 0,05
IGHV3-11 IGLV 3-25 0,05
IGHV3-11 IGLV 7-46 0,05
IGHV3-11 IGLV 9-49 0,05
IGHV3-11 IGLV 8-61 0,05
IGHV3-9 IGLV 1-40 0,05
IGHV3-9 IGLV 1-51 0,05
IGHV3-9 IGLV 4-69 0,05
IGHV3-9 IGLV 4-60 0,05
IGHV3-74 IGLV 1-47 0,05
IGHV3-74 IGLV 2-11 0,05
IGHV3-74 IGLV 3-1 0,05
IGHV3-74 IGLV 2-8 0,05
IGHV3-74 IGLV 7-43 0,05
IGHV3-74 IGLV 7-46 0,05
IGHV4-4 IGLV 2-11 0,05
IGHV4-4 IGLV 3-1 0,05
IGHV4-4 IGLV 3-25 0,05
IGHV4-4 IGLV 9-49 0,05
IGHV1-46 IGLV 1-40 0,05
IGHV1-46 IGLV 1-47 0,05
IGHV1-46 IGLV 2-23 0,05
IGHV1-46 IGLV 3-21 0,05
IGHV1-46 IGLV 6-57 0,05
IGHV4-61 IGLV 2-23 0,05
IGHV4-61 IGLV 3-21 0,05
IGHV4-61 IGLV 3-1 0,05
IGHV4-61 IGLV 7-43 0,05
IGHV1-8 IGLV 1-51 0,05
IGHV1-8 IGLV 2-11 0,05
IGHV1-8 IGLV 2-8 0,05
IGHV1-8 IGLV 9-49 0.05
IGHV1-24 IGLV 2-14 0,05
IGHV1-24 IGLV 1-40 0,05
IGHV1-24 IGLV 1-44 0,05
IGHV1-24 IGLV 3-21 0,05
IGHV1-24 IGLV 2-11 0,05
IGHV1-3 IGLV 1-40 0,05
IGHV3-49 IGLV 2-14 0,05
IGHV3-49 IGLV 1-40 0,05
IGHV3-49 IGLV 2-23 0,05
IGHV3-49 IGLV 2-8 0,05
IGHV4-28 IGLV 2-14 0,05
IGHV3-43 IGLV 2-14 0,05
IGHV3-43 IGLV2-11 0,05
IGHV3-43 IGLV 3-1 0,05
IGHV3-43 IGLV 1-36 0,05
IGHV3-43 IGLV 9-49 0,05
IGHV3-64 IGLV 2-14 0,05
IGHV3-64 IGLV 7-43 0,05
IGHV7-81 IGLV 1-40 0,05
IGHV3-13 IGLV 1-40 0,05
IGHV3-13 IGLV 1-47 0,05
IGHV3-72 IGLV 1-51 0,05
IGHV3-72 IGLV 4-69 0,05
IGHV3-73 IGLV 1-40 0,05
IGHV3-73 IGLV 1-51 0,05
IGHV3-73 IGLV 1-47 0,05
IGHV3-73 IGLV 2-11 0,05
IGHV3-73 IGLV 6-57 0,05
IGHV1-58 IGLV2-14 0,05
IGHV3-66 IGLV 1-44 0,05
IGHV3-66 IGLV 1-47 0,05
IGHV3-66 IGLV 3-25 0,05
IGHV4-30.2 IGLV 3-21 0,05
IGHV7-4.1 IGLV 1-51 0,05
IGHV3-20 IGLV 2-14 0,05

Пример 5: Получение генов эмбрионального типа для функционального анализа

В качестве следующего шага, VH, Vλ и Vk гены эмбрионального типа, выбранные для комбинации и последующего тестирования, как показано в таблице 5, направили в Geneart (Регенсбург, Германия) для оптимизации кодонов, соответствующей экспрессии в Е.coli (нейтральной к экспрессии у млекопитающих, без редких человеческих кодонов), оптимизации генов для устранения возможных ингибиторных мотивов или мотивов сплайсинга и синтеза.

Белковые последовательности эмбрионального типа каждого из VH, Vλ и Vk генов эмбрионального типа показаны на фигурах 6-8. Каждую последовательность гена эмбрионального типа синтезировали следующим образом:

a) для VH: лидерная последовательность (модифицированная сигнальная последовательность phoA, включающая сайт рестрикции NheI, как показано в таблице 1); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт рестрикции BssHII (GCGCGC), как показано на фигуре 1); CDR-H3 (WGGDGFYAMDY) (SEQ ID NO:1) антитела 4D5, используемый в Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и JH4 FR4 (включающий сайт рестрикции XhoI (CTCGAG), как показано на фигуре 1);

b) для Vk: лидерная последовательность (модифицированная сигнальная последовательность ompA, включающая сайт рестрикции NdeI, как показано в таблице 2); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт рестрикции BbsI (GAAGAC), как показано на фигуре 1), каппа-подобный CDR-L3 (QQHYTTPPT) (SEQ ID NO:2) в соответствии с Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и Jk1 FR4 (включающий сайт узнавания KpnI/Acc65I (KpnI/Acc65I RE site) (GGTACC), как показано на фигуре 1);

c) для Vλ: лидерная последовательность (модифицированная сигнальная последовательность ompA, включающая сайт рестрикции NdeI, как показано в таблице 2); FR1, CDR1, FR2, CDR2 и FR3 эмбрионального типа (включающие сайт рестрикции BbsI (GAAGAC), как показано на фигуре 1) лямбда-подобный CDR-L3 (QSYDSSLSGVV) (SEQ ID NO:3) в соответствии с Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553; и J12/3 FR4 (включающий сайт узнавания KpnI/Acc65I (KpnI/Acc65I RE site) (GGTACC), как показано на фигуре 1).

Пример 6: Функциональное тестирование белковых пар эмбрионального типа, репрезентативных для человеческого иммунного репертуара

400 белковых пар эмбрионального типа затем вставили в фаговый дисплей, в векторы для экспрессии в E.Coli и в клетках млекопитающего либо формы Fab, либо формы человеческого IgG1 и затем тестировали по следующим свойствам: а) относительный показатель отображения после получения фага и твердофазного ELISA фага в Fab форме; b) относительная продуктивность экспрессии Fab после получения Fab в E.coli, клеточного лизиса E.coli и обнаружения полученного Fab с помощью твердофазного ELISA; с) термическая стабильность Fab после получения Fab в E.coli, клеточного лизиса E.coli и обнаружения с помощью твердофазного ELISA неденатурированного Fab после инкубации при повышенных температурах; d) стабильность в бычьей или мышиной сыворотке Fab из лизатов Е.coli путем обнаружения с помощью твердофазного ELISA неденатурированного Fab после инкубации в бычьей или мышиной сыворотке; е) относительные уровни продуктивности экспрессии человеческого IgG1 после получения IgG1 в клетках млекопитающих и обнаружения с помощью твердофазного ELISA секретируемого IgG1 из супернатантов клеточных культур; и f) стабильность в бычьей сыворотке человеческого IgG1 путем обнаружения с помощью твердофазного ELISA неденатурированного IgG после инкубации в бычьей или мышиной сыворотке.

Пример 6.1: Получение Fab пула, представленного на фаге, для определения функциональных характеристик

Антитела или фрагменты антител, синтезированные в примере 5, показанные в таблице 5, клонировали в трицистронный Fab дисплейный вектор pJPd1 (фигура 9) для функционального тестирования. Получили пулы Fab, которые содержали комбинации каждого из основных генов, 20 VH, комбинированных с 8 Vλ и 12 Vk, что дает 400 комбинаций, показанных в таблице 6.

Фаги, содержащие вышеуказанные пары генов, получили в небольшом масштабе с применением 96-луночных планшетов. Контрольный планшет создавали путем заполнения каждой из лунок средой 2xYT/CAM/TET/Gluc и внесения клонов из 400 VH/VL комбинаций, где в качестве контроля применяли pMORPH30_Vk3-11_AQA/VH3-23_TKA или pMORPH30_Vk3-11_AYA/VH3-23_VLA (pMORPH30 показан на фигуре 12). Планшеты инкубировали в течение ночи при 37°С при встряхивании. Контрольные планшеты хранили в конечной концентрации 15% глицерина и замороженными при -80°С.

Дополнительные 96-луночные планшеты изготовили для получения фагов, применяя 2xYT/CAM/TET/Gluc в качестве среды, и внесли клоны из контрольных планшетов, описываемых выше. Планшеты инкубировали при 37°С в течение ~2-4 часов, встряхивая при 400 оборотах в минуту, до достижения оптической плотности, измеренной при длине волны 600 нм (OD 600), ~0,5.

Планшеты инфицировали фагом-хелпером 5 мкл на лунку (Hyperphage; PROGEN, 1×1012 БОЕ (бляшкообразующих единиц) / мл (pfu/ml). Планшеты инкубировали при 37°С в течение 45 минут без встряхивания, а затем в течение 60 мин при встряхивании при 400 оборотах в минуту. Бактерии центрифугировали с ускорением 2200 g в течение 5 мин при 4°С.

Надосадочную жидкость (супернатанты), содержащую фаг-хелпер, удалили, и инфицированный осадок E.coli ресуспендировали с 2xYT/Cam/TET/Kan/IPTG без глюкозы. Ресуспендированный осадок перенесли в новый планшет с 96 глубокими лунками, предварительно заполненными 2xYT/Cm/TET/Kan/IPTG. Планшеты инкубировали в течение ночи при 22°С при встряхивании. Надосадочную жидкость, содержащую фаг, собрали путем центрифугирования и удаления клеток E.coli и клеточного детрита.

Пример 6.2: Оценка ранжирования фагового дисплея Fab с помощью твердофазного ELISA

Супернатанты, содержащие фаг, подготовленные как описано в примере 6.1, применили для ранжирования фагового дисплея Fab с помощью твердофазных ELISA. Дисплей (отображение) Fab-фрагментов оценили в твердофазном ELISA фага с применением двух захватывающих антител:

(1) антитело к М13 (Amersham # 27-9420-01) применили для захвата фаговых частиц посредством основного белка оболочки g8p, следовательно, можно определить титр фага.

(2) применили антитело к Fd (сайт связывания # РС075), которое связывается с представленным Fab, следовательно, захватывается только фаг, представляющий Fab-фрагменты, включающие основные гены.

Соответствующие захватывающие антитела иммобилизовали на черных 96-луночных Maxisorp™ планшетах путем распределения 100 мкл раствора антител в концентрации 7,5 мкг/мл для антитела и к М13 1,0 мкг/мл для антитела к Fd в различные лунки, герметизации планшетов многослойной фольгой и инкубации в течение ночи при 4°С. На следующий день планшеты дважды промыли буфером TBST, и каждую лунку блокировали с помощью 300 мкл CTBST в течение 1 ч при комнатной температуре.

И супернатанты, содержащие фаг, и эталонные образцы перенесли для обнаружения следующим образом. Блокированные ELISA планшеты дважды промыли TBST. 100 мкл соответствующим образом разведенных фаг-содержащих супернатантов в CTBST перенесли из планшетов разведения на иммуноглобулиновые ELISA планшеты, инкубировали в течение 1-2 ч при комнатной температуре, промыли 5 раз с помощью TBST. Добавили 100 мкл/лунку конъюгата антитела к М13-пероксидазы (Amersham), разведенного 1:5000 в CTBST, и инкубировали в течение 1-2 ч при комнатной температуре. Рабочий раствор Quanta Blu (Pierce) подготовили путем смешивания 1 части (например, 0,5 мл) раствора перекиси и 9 частей (например, 4,5 мл) раствора субстрата, и уравновешивания его до комнатной температуры в течение по меньшей мере 30 мин. ELISA-планшеты промыли 5 раз с помощью TBST, добавили 100 мкл/лунку рабочего раствора QuantaBlu. Флуоресценцию измерили после инкубации в течение ~2 мин (возбуждение: 320 нм, излучение 430 нм), а впоследствии с интервалами в 5 мин.

Оценку данных твердофазного ELISA выполнили следующим образом: создали калибровочные кривые, применяя получение эталонного фага HuCAL GOLD (VH3 каппа + лямбда), и рассчитали титры фаг-содержащих супернатантов и контроля. Для каждого образца титр антитела к Fd делили на титр антитела к М13 (анти-pVIII), полученное соотношение является относительным показателем отображения. Таблица 12 показывает относительные показатели отображения для большинства из 400 белковых пар эмбрионального типа.

Пример 6.3: Скрининговый твердофазный ELISA 400 VH/VL комбинаций для определения мощности экспрессии Fab в лизатах E.coli

В шаблонные планшеты (МР) внесли путем пересаживания клоны, трансформированные пулами VH/VL комбинаций в векторе экспрессии Fab pJPx1 (показано на фигуре 10) в среду 2YT/Cam/1% Gluc в лунку. Данные планшеты инкубировали при 37°С в течение ночи при встряхивании. В экспрессионные планшеты (ЕР) инокулировали 2,5 мкл культур из шаблонных планшетов в 2YT/Cam/0,1% глюкозы на лунку. Контроли (смотри таблицу 8) инокулировали из глицеринового материала. Данные планшеты инкубировали в течение 6 часов при 37°С и встряхивании, затем индуцировали экспрессию Fab добавлением IPTG и инкубировали при 22°С в течение ночи при встряхивании. Клеточные лизаты E.coli получили путем добавления борной/кислоты/ЭДТК/лизоцим-буфера (BEL) в экспрессионные планшеты (1 ч инкубации при 22°С, встряхивая), и бактериальные лизаты впоследствии блокировали с помощью 12,5% MPBST, встряхивая по меньшей мере 30 мин при комнатной температуре. Лизаты E.coli из экспрессионных планшетов развели соответственно в 0,5% MPBS и применили в следующем анализе.

Таблица 7 показывает немеченые покрывающие антитела и меченые щелочной фосфатазой (AP-labeled) детекторные антитела, которые применялись.

Таблица 7:
Название MOR Метка Хозяин Антитело Компания Число Концентрация Разведение Серия
Покрывающие антитела 15 Немеченые Овца антитела к IgG человека (Fd) Binding Site рс075 12,1 мг/мл 1:1000 236366, использовать до 2009/10
Детекторные антитела АР27 Щелочная фосфатаза Мышь Анти-FlagM2 Sigma А9469 1,1 мг/мл 1:5000 048K6143, новая серия

Таблица 8 описывает использованные контроли.

Таблица 8:
# Название конструкции
3 pMx11_FH VH1-69 VLA_V11-40 AYA
1
5 pMx11_FH VH3-23 VLA_Vk3-11 AYA
Пустой BEL буфер pMx9_APStuffer_FHClone1 (не содержащий молекулы Fab!)

Скрининговый твердофазный ELISA включал следующие этапы, на которых: покрыли 384 лунки планшета MaxiSorp Fd-специфическими антителами к IgG человека, разведенными в PBS (фосфатно-солевой буфер), и инкубировали в течение ночи при 4°С. На следующий день планшеты промыли 2 раза с помощью PBST (фосфатно-солевой буфер с твином) и блокировали добавлением (5% молочного порошка в PBS) в каждую лунку и инкубированием в течение 1-2 часов при комнатной температуре при встряхивании. Затем планшеты снова промыли PBST и добавили предварительно блокированные лизаты E.coli, разведенные в 0,5% MPBS (фосфатно-солевом буфере с обезжиренным молоком), и инкубировали в течение 1 ч при встряхивании при комнатной температуре. Также добавили контроли #3 и #5. Затем планшеты промыли PBST и меченое щелочной фосфатазой детекторное антитело развели в 0,5% MPBS. Добавили разведенное детекторное антитело, а затем инкубировали в течение 1 часа при комнатной температуре при умеренном встряхивании. Сигнал идентифицировали следующим образом: промыли лунки с помощью TBST и добавили 20 мкл флуоресцентного субстрата AttoPhos (1:5 разведенного в ddH2O (дистиллированной деминерализированной воде)), и считывали в 5 мин и 7-8 мин с применением считывающего устройства Tecan (infiniTe F200), программы PrimeScreen.

Относительную продуктивность экспрессии Fab рассчитывали путем последовательного деления сигнала твердофазного ELISA соответствующих VH/VL пар на сигнал твердофазного ELISA эталонного Fab pMx11_FH VH1-69 VLA_V11-40 AYA. Таким образом, одинаково высокие сигналы твердофазного ELISA приводили к относительной продуктивности экспрессии Fab=1. Эталонный Fab экспрессировали в плазмидах pMORPHX11 (показаны на фигуре 11), которые включают а) модифицированную сигнальную последовательность phoA тяжелой цепи, содержащую С-концевой сайт рестрикции NheI; b) модифицированную сигнальную последовательность ompA легкой цепи, содержащую сайт рестрикции С-концевой NdeI; с) белковые последовательности эмбрионального типа вариабельного участка тяжелой цепи гена VH1-69*01 эмбрионального типа, показанные на фигуре 6А, d) белковые последовательности эмбрионального типа вариабельного участка легкой цепи гена IGLV1-40 эмбрионального типа, показанные на фигуре 8А; е) объединение CDR-H3 (WGGDGFYAMDY) (SEQ ID NO:1) антитела hu4D5-8 и JH4 белковой последовательности эмбрионального типа для FR4 тяжелой цепи, f) объединение участки CDR-L3 (QSYDSSLSGVV) (SEQ ID NO:3) и J12/3 белковой последовательности эмбрионального типа для FR4 легкой цепи. hu4D5-8 описано в Carter P. et al. (1992) "Humanization of an anti-p185Her2 antibody for human cancer therapy" Proc. Natl. Acad. Sci. USA 89, 4285-4289) и Ewert S. et al., J. Mol. Biol. (2003) 325, 531-553. Все гены генерировали в Geneart (Регенсбург, Германия). Результаты показаны в таблице 12.

Пример 6.4: Скрининговый твердофазный ELISA 400 VH/VL комбинаций для определения температурной стабильности Fab и BEL лизатов

Экспрессионные планшеты получили, как описано в примере 6.3. Разведенные лизаты Е.coli из экспрессионных планшетов инкубировали при различных температурах в течение 45 минут и использовали в следующем анализе. Таблица 9 показывает немеченые покрывающие антитела и меченые щелочной фосфатазой детекторные антитела, которые применялись.

Таблица 9:
Название MOR Метка Хозяин Антитело Компания Число Концентрация Разведение Серия
Покрывающие антитела 57 немеченные мышь моноклональные антитела IgG1 к пилигистидину (антитела к 6Х-гистидину); полипептиды, содержащие полигистидиновую метку R&D Systems МАВ050 500 мкг/мл 1:250 AEJ1708111
детекторные антитела АР30 Щелочная фосфатаза коза антитела к каппа-легким цепям иммуноглобулинов человека Sigma А3813 2,3 мг/мл 1:2300 018K6069
детекторные антитела АР5 Щелочная фосфатаза коза антитела к лямбда-легким цепям иммуноглобулинов человека Sigma А2904 0,8 мг/мл 1:800 096K6030

Скрининговый твердофазный ELISA включал следующие этапы, на которых: покрыли 384 лунки планшета MaxiSorp покрывающими антителами (смотри таблицу выше), разведенными в PBS. Планшеты инкубировали в течение ночи при 4°С. На следующий день планшеты промыли с помощью PBST и блокировали добавлением 5% MPBS (фосфатно-солевой буфер с обезжиренным молоком) в каждую лунку и инкубированием в течение 1-2 часов при комнатной температуре при встряхивании. Затем разведенные лизаты Е.coli из экспрессионных планшетов распределили в четыре 96-луночных ПЦР-планшета (каждый около 40 мкл) и подвергли воздействию различных температур (4°С (на льду), 60°С, 70°С, 80°С и затем на льду) в термоциклере для ПЦР, каждая температура в течение 45 минут. Блокированные 384-луночные планшеты промыли PBST, затем в планшеты добавили предварительно инкубированные лизаты Fab. Затем планшеты инкубировали 1 час при комнатной температуре при встряхивании. Планшеты промыли PBST, меченые щелочной фосфатазой детекторные антитела развели в 0,5% MPBS. Добавили 20 мкл/лунку разведенных детекторных антител и инкубировали в течение 1 часа при комнатной температуре при умеренном встряхивании. Сигнал идентифицировали следующим образом: промыли лунки с помощью TBST и добавили флуоресцентный субстрат AttoPhos (1:5 разведенного в ddH2O (дистиллированной деминерализированной воде)) во все лунки. Сигнал считывали в различные моменты времени (от 5 мин до 10 мин) с применением Tecan (infiniTe F200), программы PrimeScreen. Результаты показаны в таблице 12.

Пример 6.5: Скрининговый твердофазный ELISA 400 VH/VL комбинаций для определения стабильности в сыворотке крови Fab в лизатах E.coli

Экспрессионные планшеты получили, как описано в примере 6.3. Fab-содержащие лизаты E.coli развели и инкубировали в бычьей и мышиной сыворотке, применяя следующие шаги, на которых: лизаты E.coli из экспрессионных планшетов развели в 50% сыворотки (общий объем 100 мкл), добавили 1:1000 хлорамфеникола (Cam) для предотвращения роста бактерий, и лизаты разделили в два 96-луночных планшета, и оба планшета заморозили. Первый планшет разморозили и инкубировали при 37°С в течение 12-13 дней. Второй планшет хранили при -80°С до проведения твердофазного ELISA (0 дней инкубации при 37°С).

Таблица 10 показывает немеченые покрывающие антитела и меченые щелочной фосфатазой детекторные антитела, которые применялись.

Таблица 10:
Название MOR Метка Хозяин Антитело Компания Число Концентрация Разведение Серия
Покрывающие антитела 36 Fab коза Антитела к IgG (тяжелым и легким цепям) человека Jackson Immuno. Research 109-006-088 1,3 мг/мл 1:1000 80299
детекторные антитела АР30 Щелочная фосфатаза коза антитела к каппа-легким цепям иммуноглобулинов человека Sigma А3813 2,3 мг/мл 1:2300 018K6069
детекторные антитела АР5 Щелочная фосфатаза коза антитела к лямбда-легким цепям иммуноглобулинов человека; связанные + свободные Sigma А2904 0,8 мг/мл 1:800 096K6030

На 11 или 12 день 384 лунки планшета MaxiSorp покрыли 20 мкг покрывающих антител, разведенных в PBS. Планшеты инкубировали в течение ночи при 4°С. На следующий день планшеты промыли PBST и блокировали добавлением 5% MPBS в каждую лунку и инкубировали в течение 1-2 ч при комнатной температуре при встряхивании. Затем заблокированные 384-луночные планшеты промыли PBST. Лизаты E.coli в сыворотке из образцов -80°С и 37°С перенесли в покрытые ELISA планшеты и инкубировали в течение 1 часа при комнатной температуре при встряхивании. Планшеты промыли PBST, и меченые щелочной фосфатазой детекторные антитела развели в 0,5% MPBS. Добавили меченые щелочной фосфатазой детекторные антитела, и планшет инкубировали в течение 1 часа при комнатной температуре при встряхивании. Сигнал идентифицировали следующим образом: промыли лунки с помощью TBST и добавили AttoPhos (1:5 разведенный в ddH20) во все лунки. Сигнал считывали в разные моменты времени (от 5 мин до 10 мин) с применением Tecan (infiniTe F200), программы PrimeScreen. Результаты тестирования стабильности в бычьей сыворотке показаны на фигуре 19. Результаты тестирования стабильности в мышиной сыворотке показаны в таблице 12.

Пример 7: Получение человеческого IgG1 для оценки биофизических свойств

Для получения 400 IgG1 белковых пар эмбрионального типа 20 генов вариабельного участка тяжелой цепи субклонировали в вектор экспрессии человеческого IgG1 pJP_hIgG1f, показанный на фигуре 13. Параллельно 12 генов вариабельного участка каппа-легкой цепи субклонировали в вектор экспрессии каппа-легкой цепи млекопитающих pJP hIgkappa, показанный на фигуре 14, и 8 генов вариабельного участка лямбда-легкой цепи субклонировали в вектор экспрессии лямбда-легкой цепи млекопитающих pJP_hIglambda2, показанный на фигуре 15.

С помощью котрансфекции каждой можно получить экспрессирующую плазмиду тяжелой и легкой цепи для всех 400 VH/VL пар отдельно путем клонирования только 40 экспрессирующих конструкций.

Таким образом, в клетки HEK.EBNA ввели путем котрансфекции все 20 конструкций тяжелой цепи и все 20 экспрессирующих конструкций легкой цепи. IgG1 человека собрали или обнаружили через несколько дней после трансфекции в супернатантах клеточной культуры.

Пример 7.1: Ранжирование экспрессии IgG1

Одним из критериев отбора VH/VL пары для включения в коллекцию является уровень экспрессии 400 различных VH/VL пар формы IgG1. Уровень экспрессии каждой VH/VL пары формы IgG1 человека оценили с помощью сэндвич-метода ELISA. Следовательно, в клетки HEK.EBNA ввели путем трансфекции все 400 VH/VL комбинаций формы IgG1 человека и экспрессировали в малом масштабе. Супернатанты клеточных культур собрали через несколько дней и оценили уровни IgG.

Провели следующую процедуру. 384-луночные планшеты MaxiSorpTM покрыли Fcγ-pan R10Z8E9 мышиными антителами к IgG человека при 2,5 нг/мл в PBS. Планшеты инкубировали в течение ночи при 4°С. Планшеты промыли PBST. Планшеты блокировали с помощью 5% BSA или 1x Chemiblocker в PBST и инкубировали в течение 1 ч при комнатной температуре при встряхивании, и снова промыли PBST. Супернатанты, экспрессирующие IgG, развели в 2,5% BSA-PBST, и разбавленные образцы добавили к блокированным и промытым ELISA планшетам. Применяли следующие контроли: пустой супернатант и Супернатанты со слабо экспрессированным антителом, умеренно экспрессированным антителом и высоко экспрессированным антителом. Планшеты инкубировали в течение 2 ч при комнатной температуре при встряхивании. Затем планшеты промыли TBST. Добавили конъюгат соответствующим образом разведенных мышиных антител Fcγ-pan R10Z8E9 к IgG человека с биотином в 1% BSA-TBST. Планшеты инкубировали в течение 1 ч при комнатной температуре. Планшеты промыли TBST. Добавили конъюгат стрептавидин-щелочная фосфатаза, разведенный 1:2000 в 0,5% BSA-TBST, и планшеты инкубировали в течение 1 ч при комнатной температуре при встряхивании. Планшеты промыли TBST. Добавили флуоресцентный субстрат AttoPhosTM (подготовленный в соответствии с инструкциями производителя), разведенный в TBST непосредственно перед применением. Через 5 и 10 мин, измерили флуоресценцию с помощью считывающего устройства для микропланшетов Tecan.

Относительные мощности экспрессии IgG1 рассчитали путем последовательного деления сигнала твердофазного ELISA соответствующих VH/VL пар на сигнал твердофазного ELISA эталонного IgG1 MOR03080 (показанного в таблице 11). Таким образом, одинаково высокие сигналы твердофазного ELISA приводят к уровню относительной мощности экспрессии IgG1=1.

Таблица 11

Аминокислотная последовательность MOR03080 является следующей:

03080 вариабельный участок тяжелой цепи с областями CDR жирным шрифтом:

(1) QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSN

(51) IYSDGSNTFY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARNM

(101) YRWPFHYFFDYWGQGTLVTVSS (SEQ ID NO:61)

03080 вариабельный участок легкой цепи с областями CDR жирным шрифтом:

(1) DIELTQPPSV SVAPGQTARISCSGDNIGNKYVSWYQQKPGQAPVVVIYGD

(51) NNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDSSYFVFGGG

(101) TKLTVLGQ (SEQ ID NO:62)

Результаты показаны в таблице 12. Последовательности Fc части показаны на фигурах 48, 50-51.

Пример 7.2: Ранжирование стабильности IgG1 в сыворотке

Одним из критериев отбора пары вариабельного участка тяжелой цепи и вариабельного участка легкой цепи для включения в коллекцию является стабильность в сыворотке 400 различных пар вариабельного участка тяжелой цепи и вариабельного участка легкой цепи формы IgG1. Стабильность в сыворотке каждого супернатанта IgG оценили с помощью инкубации в 50% мышиной сыворотке в течение 14 дней и последующего сэндвич-метода ELISA с клоном R10Z8E9 мышиных антител к IgG человека (СН2). Снова все 400 VH/VL комбинаций формы IgG1 человека ввели путем трансфекции в клетки HEK.EBNA и экспрессировали в малом масштабе. Супернатанты клеточных культур собрали через несколько дней и IgG в супернатантах протестировали на стабильность в сыворотке.

Провели следующую процедуру. 384-луночные планшеты MaxiSorpTM покрыли Fcγ-pan R10Z8E9 мышиными антителами к IgG человека при 2,5 нг/мл в PBS. Планшеты инкубировали в течение ночи при 4°С. Планшеты промыли PBST и затем блокировали с помощью 5% BSA-PBST или 1x Chemiblocker в течение 1 ч при комнатной температуре при встряхивании. Планшеты промыли PBST. IgG1-содержащие супернатанты клеточных культур развели а) в 2,5% BSA-PBST и b) в 50% мышиной сыворотке, и инкубировали при 37°С в течение по меньшей мере 14 дней, и добавили данные образцы в блокированный и промытый ELISA планшет. Применяли следующие контроли: пустой супернатант и супернатанты со слабо экспрессированным антителом, умеренно экспрессированным антителом и высоко экспрессированным антителом. Планшеты инкубировали в течение 2 ч при комнатной температуре при встряхивании. Планшеты промыли TBST. Добавили конъюгат мышиных антител Fcγ-pan R10Z8E9 к IgG человека с биотином, разведенный до 0,8 нг/мл в 1% BSA-TBST. Планшеты инкубировали в течение 1 ч при комнатной температуре. Планшеты промыли TBST. Добавили конъюгат стрептавидин-щелочная фосфатаза, разведенный 1:2000 в 0,5% BSA-TBST. Планшеты инкубировали в течение 1 ч при комнатной температуре при встряхивании. Планшеты промыли TBST. Добавили флуоресцентный субстрат AttoPhosTM (подготовленный в соответствии с инструкциями производителя), разведенный 1:5 в TBST непосредственно перед применением. Через 5 и 10 мин измерили флуоресценцию с помощью считывающего устройства для микропланшетов Tecan. Результаты показаны в таблице 12.

Пример 8: Выбор VH/VL пар с благоприятными био-физическими свойствами для включения в коллекцию

После тестирования 400 пар эмбрионального типа белка в отношении следующих свойств: а) относительное отображение после образования фага и ELISA фага формы Fab, b) относительная продуктивность экспрессии Fab после образования Fab в E.coli, лизиса клеток Е.coli и обнаружения ELISA образованных Fab, с) температурная стабильность Fab после образования Fab в E.coli, лизиса клеток E.coli и ELISA обнаружения неденатурированного Fab после инкубации при повышенной температуре, d) стабильность Fab из лизата E.coli в сыворотке крупного рогатого скота/мыши с помощью обнаружения ELISA неденатурированного Fab после инкубации в сыворотке крупного рогатого скота/мыши, е) относительная продуктивность экспрессии человеческого IgG1 после образования IgG1 в клетках млекопитающих и обнаружения ELISA секретируемого IgG1 из супернатантов клеточных культур; и е) стабильность в сыворотке крупного рогатого скота IgG1 путем обнаружения ELISA неденатурированного IgG1 после инкубации в сыворотке крупного рогатого скота/мыши, выбрали, какие из пар эмбрионального типа VH/VL должны были быть включены в коллекцию. Результаты функционального тестирования для каждой VH/VL белковой пары эмбрионального типа показаны в Таблице 12.

Ключ к таблице 12:

Для относительного показателя отображения Fab, относительной экспрессии Fab и относительной экспрессии IgG1 значения иллюстрируют уровни по сравнению с контролем. Более высокие числа указывают на более высокие уровни.

Для термостабильности Fab цифры 60 и 70 указывают VH/VL пары, которые являются стабильными в течение 45 минут при температуре 60°С или 70°С в тестируемых условиях. Цифра 4 указывает термолабильные пары и bg (фон) указывает на низкие уровни экспрессии.

Для стабильности Fab в мышиной сыворотке, стабильности Fab в сыворотке крупного рогатого скота и стабильности IgG1 в сыворотке крупного рогатого скота S означает стабильный, U означает нестабильный и bg означает фон, в тестируемых условиях.

Как описано в предыдущих примерах, преобладающие VH и VL гены эмбрионального типа и преобладающие VH/VL пары генов эмбрионального типа идентифицировали из человеческого иммунного репертуара, затем преобладающие VH и VL белковые последовательности эмбрионального типа анализировали in silica с целью идентификации и выбора белковых последовательностей эмбрионального типа вариабельного участка тяжелой цепи и вариабельного участка легкой цепи, которые обладают благоприятными биофизическими свойствами. Как показано в таблице 5 и фигурах 2-3, в целом, выбрали ведущие 20 VH, ведущие 8Vλ и ведущие 12Vk для синтеза, комбинации и последующего функционального анализа. Последовательности генов эмбрионального типа синтезировали и затем комбинировали в целях получения 400 белковых пар эмбрионального типа, которые являются репрезентативными для широко распространенных пар генов эмбрионального типа, экспрессированных в человеческом иммунном репертуаре. 400 VH/VL белковых пар эмбрионального типа протестировали по следующим свойствам: а) относительный показатель отображения после получения фага и твердофазного ELISA фага в Fab форме; b) относительная продуктивность экспрессии Fab после получения Fab в E.coli, клеточного лизиса E.coli и обнаружения полученного Fab с помощью твердофазного ELISA; с) термическая стабильность Fab, после получения Fab в E.coli, клеточного лизиса E.coli и обнаружения с помощью твердофазного ELISA неденатурированного Fab после инкубации при повышенных температурах; d) стабильность в сыворотке крупного рогатого скота/мыши Fab из лизатов Е.coli путем обнаружения с помощью твердофазного ELISA неденатурированного Fab после инкубации в сыворотке крупного рогатого скота/мыши; е) относительная продуктивность экспрессии человеческого IgG1 после получения IgG1 в клетках млекопитающих и обнаружения с помощью твердофазного ELISA секретируемого IgG1 из супернатантов клеточных культур; и f) стабильность в сыворотке крупного рогатого скота человеческого IgG1 путем обнаружения с помощью твердофазного ELISA неденатурированного IgG1 после инкубации в сыворотке крупного рогатого скота/мыши.

Применяя данные, приведенные в таблице 12, специалист в данной области может легко идентифицировать белковые пары эмбрионального типа, обладающие благоприятными биофизическими свойствами.

В целом, для включения в коллекции выбрали белковые пары эмбрионального типа, обладающими пороговыми значениями по каждому функциональному свойству. Например, в некоторых вариантах осуществления для включения в коллекции выбрали белковые пары эмбрионального типа, включающие все из следующих свойств: i) относительный уровень отображения формы Fab, включающий значения в пределах ведущих 75% от Fab-фрагментов выборки; ii) мощность экспрессии в Fab форме по меньшей мере 0,4 по сравнению с Fab VH1-69 VLA_VI1-40 AYA; iii) термостабильность при 60°С или выше в течение по меньшей мере 45 минут формы Fab; iv) стабильность в бычьей или мышиной сыворотке в Fab форме в течение более десяти дней при 37°С; v) продуктивность экспрессии формы IgG по меньшей мере 0,4 по сравнению с MOR03080; и vi), стабильность в сыворотке формы IgG в течение четырнадцати дней при 37°С. Таблица 32 показывает жирным шрифтом и подчеркиванием белковые пары эмбрионального типа, включающие все из данных функциональных свойств.

Однако, как описано выше, белковые пары эмбрионального типа, обладающие одним или более из данных функциональных свойств, можно выбирать для включения в коллекции. В данном документе создали совокупное ранжирование 400 протестированных белковых пар эмбрионального типа, так что каждую белковую пару эмбрионального типа можно ранжировать по отношению к другим, придавая значение каждому из протестированных функциональных свойств. Это позволило авторам настоящего изобретения выбрать одну или более белковых пар эмбрионального типа, обладающих одним или несколькими, или всеми из перечисленных функциональных свойств. В некоторых вариантах осуществления коллекции включают все белковые пары эмбрионального типа, обладающие вышеуказанными характеристиками. В некоторых вариантах осуществления коллекция включает белковые пары эмбрионального типа, обладающие самой высокой совокупной оценкой из 400 протестированных пар. В некоторых вариантах осуществления для включения в коллекции выбрали белковые пары эмбрионального типа, обладающие совокупной оценкой в пределах ведущих 10%, ведущих 20%, или ведущих 30% из 400 протестированных пар.

Пример 9: Дополнительное тестирование ~100 VH/VL пар

Из 400 белковых пар эмбрионального типа, протестированных выше (результаты показаны в таблице 12), для дополнительного тестирования выбрали 95 пар. Предыдущее тестирование 400 белковых пар эмбрионального типа на отображение, мощность экспрессии, термостабильность и стабильность в сыворотке действовало как предварительный фильтр для удаления белковых пар эмбрионального типа, которые не обладают характеристиками, как считают, благоприятными для терапевтической разработки. Цель состояла в выборе подгруппы белковых пар эмбрионального типа, обладающих благоприятными характеристиками пригодности к разработке, и в то же время поддерживающих высокий уровень разнообразия в пределах коллекции, так что коллекцию можно применять для идентификации пригодных к разработке кандидатов против любого антигена.

Таблица 12 показывает ~60 выделенных жирным шрифтом и подчеркиванием белковых пар эмбрионального типа, которые соответствовали пороговым значениям варианта осуществления настоящего описания изобретения. Из 95 белковых пар эмбрионального типа, выбранных для дополнительного тестирования, некоторые выбрали потому, что они соответствовали предыдущим критериям, и являлось желательным протестировать их дополнительно. Другие выбрали несмотря на несоответствие определенным пороговым значениям, так чтобы иметь возможность переоценить данные пары. Опять же, одной из целей настоящего описания изобретения является получение разнообразной коллекции, которую возможно применять для идентификации антител или фрагментов против любого антигена. 95 белковых пар эмбрионального типа, показанных на фигурах 16-24, синтезировали, как описано в примере 5. После синтеза и экспрессии в формах Fab и IgG1 95 белковых пар эмбрионального типа дополнительно тестировали в обоих Fab и IgG1 формах по следующим свойствам: а) продуктивность экспрессии очищенного Fab в мг/л (экспрессионной культуры); b) содержание мономера (% мономера) очищенного Fab; с) термостабильность очищенного Fab в °С; d) продуктивность экспрессии очищенного IgG1 в мг/л (культуры клеток); е) содержание мономера (% мономера) очищенного IgG1; f) термостабильность очищенного IgG1 в °С; g) изоэлектрическая точка IgG1 и h) стресс-тестирование IgG с воздействием кислоты, включая дифференциальную сканирующую флуорометрию (DSF), поглощение, динамическое рассеяние света и окрашивание частиц.

Пример 9.1: Тестирование очищенного Fab

Fab-фрагменты, представляющие каждую из 95 белковых пар эмбрионального типа, выбранные для дополнительного тестирования, экспрессировали в E.coli и очистили. Экспрессию Fab-фрагментов в TG-1 F-клетках E.coli осуществили в 500 мл культур в среде 2×YT, дополненной 0,1% глюкозы и хлорамфениколом. Культуры встряхивали до достижения оптической плотности 0,5 при 600 нм. Экспрессию Fab индуцировали добавлением IPTG (изопропил-β-D-тиогалактопиранозид), и дополнительным культивированием в течение ночи. Клетки собрали и разрушили применением лизоцима. His6-меченные (SEQ ID NO:203) Fab-фрагменты изолировали с помощью IMAC (Bio-Rad, Мюнхен, Германия) и элюировали с применением имидазола. Замену буфера на 1х фосфатно-солевой буфер Дульбекко (D-PBS) (рН 7,2, Invitrogen, Дармштадт, Германия) провели с использованием колонки PD10 (GE Healthcare, Мюнхен, Германия). Образцы подвергли стерильной фильтрации (0,2 мкм).

Пример 9.1.1 Определение продуктивности экспрессии очищенного Fab

Белковые концентрации очищенных Fab-фрагментов, представляющих каждую из 95 белковых пар эмбрионального типа, определили с помощью УФ-спектрофотометрии (Nanodrop, peqlab, Эрланген, Германия). Использованный коэффициент экстинкции составлял 1,538 мл/мг, и спектральную поглощательную способность (оптическую плотность) измеряли при 280 нм. Результаты показаны на фигурах 16-18.

Пример 9.1.2 Определение термостабильности очищенного Fab

Термостабильность очищенных Fab-фрагментов, представляющих каждую из 95 белковых пар эмбрионального типа, определили с помощью дифференциальной сканирующей флуорометрии (DSF). Дифференциальная сканирующая флуорометрия (DSF) представляет собой метод на основе флуоресцентного красителя, который контролирует температурное разворачивание (точку плавления) представляющего интерес белка. Изменения флуоресценции гидрофобного красителя, взаимодействующего с гидрофобными аминокислотными боковыми цепями разворачивающегося белка, контролируются в диапазоне температур.

Применялись следующие материалы: флуоресцентный краситель Sypro Orange (Sigma, # S5692); ПЦР планшеты iCycler IQ, 96-луночные (Bio-Rad, # 2239441); клейкий изоляционный материал для заклеивания планшетов Microseal В (Microseal В Adhesive Sealer) (Biorad # MSB-1001); 96-луночная оптическая подложка (Optical Pad) (Biorad, # ADR3296); термоциклер iCycler iQ5 (Biorad) и Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США).

Разбавленный краситель Sypro Orange добавили в каждую лунку 96-луночного ПЦР планшета iCycler IQ, и образцы тестировали в конечной концентрации не менее 0,1 мг/мл. Для тестирования применяли термоциклер iCycler iQ5 (Biorad). Температуру сканировали от 20°С до 95°С при скорости нагрева 60°С /ч, а температуру разворачивания рассчитали путем анализа средней точки флуоресцентного перехода. Результаты показаны на фигурах 16-18 в колонке Thermafluor очищенного Fab.

Пример 9.1.3 Разделение очищенного Fab с помощью эксклюзионной хроматографии

Содержание мономера (% мономера) очищенных Fab-фрагментов, представляющих каждую из 95 белковых пар эмбрионального типа, определили с помощью эксклюзионной хроматографии (SEC). SEC провели на системе очистки AKTA (GE Healthcare Europe GmbH, Фрайбург, Германия). Для разделения применяли колонку Superdex75 HR 10/30 (GE Healthcare Europe GmbH, Фрайбург, Германия). Для каждого образца 10 мкл белка наносили на колонку, разделение проводили при скорости потока 0,05 мл/мин, и регистрировали анализ УФ-поглощения при 260 и 280 нм. Подвижный буфер состоял из Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Результаты показаны на фигурах 16-18.

Пример 9.2 Экспрессия и очистка IgG1

IgG1, представляющие каждую из 95 белковых пар эмбрионального типа, выбранные для дополнительного тестирования, экспрессировали в клетках HKB11. В эукариотические HKB11 клетки ввели путем трансфекции в соотношении 1:1 ДНК вектор экспрессии тяжелой и легкой цепи IgG. Супернатант клеточной культуры собрали в дни от 3 до 4 после трансфекции и подвергли аффинной хроматографии с белком A (MabSelect SURE, GE Healthcare, Мюнхен, Германия). Замену буфера провели с 1х фосфатно-солевым буфером Дульбекко (рН 7,2, Invitrogen, Дармштадт, Германия), и образцы подвергли стерильной фильтрации (0,2 мкм размер пор).

Пример 9.2.1 Определение продуктивности экспрессии очищенного IgG1

Белковые концентрации очищенных IgG1, представляющих каждую из 95 белковых пар эмбрионального типа, определили с помощью УФ-спектрофотометрии (Nanodrop, peqlab, Эрланген, Германия). Использованный коэффициент экстинкции составлял 1,369 мл/мг, и спектральную поглощательную способность (оптическую плотность) измеряли при 280 нм. Результаты показаны на фигурах 16-18.

Пример 9.2.2 Определение термостабильности очищенного IgG1

IgG1 термостабильность очищенных IgG1 определили с помощью дифференциальной сканирующей флуорометрии (DSF), описываемой в способе 9.1.2. Значения, указанные для каждого IgG. представляют случаи разворачивания, которые происходят в пределах вариабельных участков IgG. Значения, представляющие разворачивание Fc части не показаны, так как они в целом идентичны для каждого IgG1 человека. Результаты показаны на фигурах 16-18.

Пример 9.2.3 Разделение очищенного IgG1 с помощью эксклюзионной хроматографии

Содержание мономера (% мономера) очищенных IgG1, представляющих каждую из 95 белковых пар эмбрионального типа, определили с помощью эксклюзионной хроматографии (SEC). HP-SEC (высокоэффективную эксклюзионную хроматографию) провели на системе ВЭЖХ Dionex UltiMate 3000 Titanium (Dionex Corporation, Гермеринг, Германия) в комбинации с Wyatt miniDAWN Treos и Wyatt Optilab Rex (Wyatt Technology Europe, Дернбах. Германия). Для разделения применяли колонку Tosoh TSK-GEL G3000SWXL (Tosoh Bioscience, Штутгарт, Германия). Для каждого образца 15 мкг белка наносили на колонку, разделение проводили при скорости потока 0,5 мл/мин и регистрировали анализ УФ-поглощения при 280 нм. Подвижный буфер состоял из Gibco D-PBS, рН 7,4 (Invitrogen, Пейсли, США). Результаты показаны на фигурах 16-18.

Пример 9.2.4 Расчет изоэлектрической точки (pi) очищенного IgG1

Рассчитали изоэлектрическую точку каждой белковой пары эмбрионального типа в IgG1 форме. Способы определения pi белка известны специалистам в данной области. Например, можно применять следующие средства: http://www.expasy.org/tools/pi_tool.html; Vector NTI (Invitrogen, Карлсбад, Калифорния). Результаты показаны на фигурах 16-18.

Пример 9.2.5 Стресс-тестирование очищенного IgG1 с воздействием кислоты

Так как шаг инактивации вируса является стандартным в течение производства и выделения целевого продукта (DSP) в системе химии, производства и контроля CMC, способность 95 белковых пар эмбрионального типа выдерживать кислоту проверили путем снижения рН и регистрации особых данных агрегации для каждого из IgG1. Каждую из белковых пар эмбрионального типа внесли в форму 96-глубоколуночного планшета в концентрации 2 мг/мл. 150 мкл каждого перенесли в 96-луночный планшет. Первоначальное определение параметров выполнили с помощью поглощения, динамического рассеяния света (DLS), дифференциальной сканирующей флуорометрии (DSF) и измерений окрашивания частиц. Образцы подкисляли применением 1,8 мкл 1М цитрата рН 2,3. Образцы нейтрализовали через 2,5 часа применением 1 М Трис рН 9,0.

Пример 9.2.5 (а) Дифференциальная сканирующая флуорометрия очищенного IgG1

С целью оценки термостабильности до и после воздействия кислоты IgG1, представляющих каждую из 95 белковых пар эмбрионального типа, выбранных для дополнительного тестирования, провели дифференциальную сканирующую флуорометрию (DSF), как описано в примере 9.1.2. Значения, показанные для каждого IgG1, представляют случаи разворачивания, которые имеют место в пределах вариабельных участков IgG. Значения, представляющие разворачивание Fc части не показаны, так как они в целом идентичны для каждого IgG. Если значения Tm (кажущейся температуры плавления) до и после воздействия кислоты равны, то молекулярная структура антитела являлась либо неизмененной кислотой, либо смогла эффективно "перевернуться" (восстановить форму) после воздействия. Результаты показаны на фигурах 19, 21 и 23.

Пример 9.2.5 (b) Поглощение в УФ/видимой области спектра очищенным IgG1

С целью идентификации агрегирующих образцов регистрировали мутность при 320 нм. Мутность растворов IgG, представляющих каждую из 95 белковых пар эмбрионального типа, выбранных для дополнительного тестирования, оценивали до и после воздействия кислоты. Результаты показаны на фигурах 19, 21 и 23. Базовое поглощение составляло 0,035 единиц экстинкции, предполагаемых для прозрачных растворов. Увеличение поглощения обусловлено рассеянием света, что приводит к увеличению поглощения. Значения выше 0,039, вероятно, содержат агрегаты. Значения выше 0,045 ясно показывают наличие агрегатов. Значения выше 0,06 представляют критические уровни агрегации, которые обнаруживали для молекул с сильно неблагоприятной стабильностью.

Пример 9.2.5 (с) Динамическое рассеяние света очищенным IgG1

В добавление, на каждом IgG1, представляющем 95 выбранных белковых пар эмбрионального типа, провели динамическое рассеяние света (DLS). Динамического рассеяния света (DLS) является спектроскопическим способом для оценки гидродинамического радиуса частиц в растворе. Все DLS эксперименты проводили с применением системы кювет DynaPro Titan (Wyatt Technology Europe, Дернбах, Германия).

В случае видимого загрязнения частиц после стресс-тестирования IgG центрифугировали для удаления крупных агрегатов. Фигуры 20, 22 и 24 показывают кажущийся радиус частиц и полидисперсность, соответствующие мономерным IgG1, которые обнаруживают в препаратах до и после обработки кислотой. Данные оценили в соответствии с вычисленным радиусом кумулянтного анализа. В дополнение к гидродинамическому радиусу оценили % полидисперсности препаратов. Увеличение полидисперсности (>15%) указывает на возможную агрегацию молекул IgG, приводящую к неоднородному распределению частиц по размерам. Частицы с высоким молекулярным весом (HMW), явно отличающиеся от IgG (радиус >3 раза), не перечислены в таблице. Все результаты DLS показаны на фигурах 20, 22 и 24.

Пример 9.2.5 (d) Окрашивание частиц очищенного IgG1

С целью оценки количества и морфологии видимых агрегатов на каждом IgG1, представляющем 95 выбранных белковых пар эмбрионального типа, провели окрашивание частиц до и после воздействия кислоты. Применяли следующие реагенты для фильтрации и окрашивания частиц в препаратах IgG: стерильный фильтр Ultrafree-CL 0,22 мкм (Millipore, # UFC40GVOS); антитело к лямбда-легкой цепи человека, конъюгированное с АР (Sigma # А-2904); проявитель для конъюгатов с АР, Fast BCIP/NBT (Sigma # B-5655); Roti ®-ImmunoBlock (Roth # Т144.1); стоп-реагент для щелочной фосфатазы (Sigma # A5852-100 ML); TBS: 0,05 М Трис; 0,15 М NaCl; TBS с 0,1% Твин 20; и 5 М NaCl раствор.

Белковый раствор фильтровали через фильтр 0,22 мкм, и остающиеся агрегаты антител впоследствии окрашивали с применением мышиных антител к Fab2 человека, конъюгированных со щелочной фосфатазой, и проявителя для вестерн-блоттинга. Анализ проводили в соответствии с инструкцией производителя. Образцы впоследствии классифицировали при визуальном осмотре в диапазоне 1-4, где категория 1 представляет очень низкое содержание частиц, и категория 4 представляет большую нагрузку препарата частицами. Все результаты окрашивания частиц показаны на фигурах 20, 22 и 24.

Пример 9.2.6 Стресс-тестирование очищенного IgG1 со встряхиванием

Способность антител или фрагментов антител противостоять напряжению сдвига является полезным критерием, так как невозможно избежать шагов фильтрации во время процессинга. Следовательно, 95 белковых пар эмбрионального типа протестировали формы IgG1, применяя стеклянные шарики, которые ускоряли в 96-луночном планшете на орбитальном встряхивателе при 550 оборотах в минуту в глубоколуночном планшете. 350 мкл каждого IgG подвергли данной обработке. 150 мкл каждого перенесли в 96-луночный планшет. Первоначальное определение параметров выполнили с помощью поглощения, динамического рассеяния света (DLS), дифференциальной сканирующей флуорометрии (DSF) и измерений окрашивания частиц.

Пример 9.2.6 (а) Поглощение в УФ/видимой области спектра очищенным IgG1

С целью идентификации агрегирующих образцов регистрировали мутность при 320 нм. Мутность растворов IgG, представляющих каждую из 95 белковых пар эмбрионального типа, выбранных для дополнительного тестирования, оценивали до и после воздействия стресса, Результаты показаны на фигурах 49, 51 и 53. Базовое поглощение составляло 0,035 единиц экстинкции, предполагаемых для прозрачных растворов. Увеличение поглощения обусловлено рассеянием света, что приводит к увеличению поглощения. Значения выше 0,039, вероятно, содержат агрегаты. Значения выше 0,045 ясно показывают явное наличие агрегатов. Значения выше 0,06 обнаружили для критических уровней агрегации, которые обнаружили для молекул с сильно неблагоприятной стабильностью.

Пример 9.2.6 (b) Дифференциальная сканирующая флуорометрия очищенного IgG1

С целью оценки термостабильности до и после воздействия кислоты IgG1, представляющих каждую из 95 белковых пар эмбрионального типа, выбранных для дополнительного тестирования, провели дифференциальную сканирующую флуорометрию (DSF), как описано в примере 9.1.2. Значения, показанные для каждого IgG1 представляют случаи разворачивания, которые имеют место в пределах вариабельных участков IgG. Значения, представляющие разворачивание Fc части не показаны, так как они в целом идентичны для каждого IgG1 человека. Результаты показаны на фигурах 50, 52 и 54.

Пример 9.2.6 (с) Динамическое рассеяние света очищенным IgG1

В добавление, на каждом IgG1, представляющем 95 выбранных белковых пар эмбрионального типа, провели динамическое рассеяние света (DLS). Динамического рассеяния света (DLS) является спектроскопическим способом для оценки гидродинамического радиуса частиц в растворе. Все DLS эксперименты проводили с применением системы кювет DynaPro Titan (Wyatt Technology Europe, Дернбах, Германия).

В случае видимого загрязнения частиц после стресс-тестирования IgG центрифугировали с целью удаления крупных агрегатов. Фигуры 50, 52 и 54 показывают кажущийся радиус частиц и полидисперсность, соответствующие мономерным IgG1, которые обнаруживают в препаратах после воздействия стресса. Данные оценили в соответствии с вычисленным радиусом кумулянтного анализа. В дополнение к гидродинамическому радиусу оценили % полидисперсности препаратов. Увеличение полидисперсности (>15%) указывает на возможную агрегацию молекул IgG, приводящую к неоднородному распределению частиц по размерам. Частицы с высоким молекулярным весом (HMW), явно отличающиеся от IgG (радиус >3 раза), не перечислены в таблице. Все результаты DLS показаны на фигурах 50, 52 и 54.

Пример 9.2.6 (d) Окрашивание частиц очищенного IgG1

С целью оценки количества и морфологии видимых агрегатов на каждом IgG1, представляющем 95 выбранных белковых пар эмбрионального типа, провели окрашивание частиц до и после воздействия стресса. Применяли следующие реагенты для фильтрации и окрашивания частиц в препаратах IgG: стерильный фильтр Ultrafree-CL 0,22 мкм (Millipore, # UFC40GVOS); антитело к лямбда-легкой цепи человека, конъюгированное с АР (Sigma # А-2904); проявитель для конъюгатов с АР, Fast BCIP/NBT (Sigma # B-5655); Roti ®-ImmunoBlock (Roth # Т144.1); стоп-реагент для щелочной фосфатазы (Sigma # A5852-100 ML); TBS: 0,05 М Трис; 0,15 М NaCl; TBS с 0,1% Твин 20; и 5 М NaCl раствора.

Белковый раствор фильтровали через фильтр 0,22 мкм, и остающиеся агрегаты антител впоследствии окрашивали с применением мышиных антител к Fab2 человека, конъюгированных со щелочной фосфатазой, и проявителя для вестерн-блоттинга. Анализ проводили в соответствии с инструкцией производителя. Образцы впоследствии классифицировали при визуальном осмотре в диапазоне 1-4, где категория 1 представляет очень низкое содержание частиц, и категория 4 представляет большую нагрузку препарата частицами. Все результаты окрашивания частиц показаны на фигурах 50, 52 и 54.

Пример 9.2.7 Кумулятивная оценка стресс-тестирования IgG

С целью помочь оценить результаты стресс-тестирования с воздействием кислотой и встряхиванием со стеклянными шариками создали систему подсчета очков таким образом, чтобы являлось возможным сравнивать белковые пары эмбрионального типа. Каждому частному значению, полученному в примерах 9.2.5 (a-d), результаты, показанные на фигурах 19-24, и примеры 9.2.6 (a-d), результаты, показанные на фигурах 49-54, присвоили оценку в диапазоне от 0-100 (0, 25, 75 или 100), и оценки суммировали для получения кумулятивной оценки. Значениям термостабильности, идентифицированным в примерах 9.2.5 (а) и 9.2.6 (b), не присвоили оценок.

Фигуры 55 и 56 показывают оценки стресс-тестирования для белковых пар эмбрионального типа 1-32 из примеров 9.2.5-9.2.6. Каждая оценка является отображением исходных частных значений, показанных на фигурах 19, 20, 49 и 50. Фигуры 19-20 показывают ответ на воздействие кислоты, а фигуры 49-50 показывают ответ на встряхивание со стеклянными шариками. Фигура 56 показывает кумулятивную оценку, которая является дополнением каждой из оценок, показанных на фигурах 55 и 56.

Фигуры 57 и 58 показывают оценки стресс-тестирования для белковых пар эмбрионального типа 33-64 из примеров 9.2.5-9.2.6. Каждая оценка является отображением исходных частных значений, показанных на фигурах 21, 22, 51 и 52. Фигуры 21-22 показывают ответ на воздействие кислоты, а фигуры 51-52 показывают ответ на встряхивание со стеклянными шариками. Фигура 58 показывает кумулятивную оценку, которая является дополнением каждой из оценок, показанных на фигурах 57 и 58.

Фигуры 59 и 60 показывают оценки стресс-тестирования для белковых пар эмбрионального типа 65-95 из примеров 9.2.5-9.2.6. Каждая оценка является отображением исходных частных значений, показанных на фигурах 23, 24, 53 и 54. Фигуры 23-24 показывают ответ на воздействие кислоты, а фигуры 53-54 показывают ответ на встряхивание со стеклянными шариками. Фигура 60 показывает кумулятивную оценку, которая является дополнением каждой из оценок, показанных на фигурах 59 и 60.

Пример 10: Выбор композиции коллекции

Подводя итог вышесказанному, 400 белковых пар эмбрионального типа выбрали, как описано в примере 4. Данные 400 являются отображением разнообразия белковых пар эмбрионального типа, которые существуют в человеческом иммунном репертуаре. 400 белковых пар эмбрионального типа тестировали, как описано в примерах 6-7. 95 из 400 дополнительно тестировали, как описано в примере 9.

95 белковых пар эмбрионального типа сравнили, принимая во внимание следующие факторы: а) уровень отображения Fab; b) продуктивность экспрессии Fab, с) термостабильность Fab; d) стабильность Fab в сыворотке, е) содержание мономера Fab, определенное с помощью SEC (% мономера); f) продуктивность экспрессии IgG1; g) термостабильность IgG1; h) стабильность IgG1 в сыворотке; i) содержание мономера IgG1, определенное с помощью SEC (% мономера) и j) изоэлектрическая точка IgG1 (pi). Данные для каждого из данных факторов показаны на фигурах 16-18. Данные факторы хорошо коррелируют с пригодностью к разработке терапевтических антител.

Уровень отображения Fab является важным фактором в выборе антител или фрагментов против антигена. Fab, представленные на высоком уровне, обладают более высокой вероятностью подвергаться воздействию антигена при выборе. Высокий уровень отображения каждого из различных Fab-фрагментов гарантирует, что все разнообразие коллекции подвергается воздействию антигена при выборе. Уровень отображения Fab идентифицирован в примере 6.2, где эталоном являлся внутренний стандарт (препарат эталонного фага HuCAL GOLD (VH3 каппа + лямбда)). HuCAL GOLD VH3 препарат является препаратом высокого отображения. Уровень отображения Fab является важным фактором и являлся полезным в сокращении 400 пар до 95 для дополнительного тестирования, но в некоторых вариантах осуществления не рассматривался как определяющий фактор в выборе белковых пар эмбрионального типа для включения в коллекции.

Продуктивность экспрессии и Fab, и IgG1 является важной, так как антитела или фрагменты, выбранные против антигена, сначала следует протестировать, часто in vitro или in vivo для определения функциональной активности, затем в токсикологии видов и, наконец, у людей в клинических испытаниях. Является важным, чтобы антитела или фрагменты, выбранные против антигена, могли эффективно экспрессироваться в достаточно высоком количестве для поддержания всех различных тестирований, требуемых для терапевтического развития и поставки для клинических испытаний и на рынок. Продуктивность экспрессии (мг очищенного Fab/л экспрессионной культуры) очищенных Fab идентифицировали в примере 9.1.1 (результаты показаны на фигурах 16-18), и в варианте осуществления настоящего описания изобретения выбрали пороговое значение по меньшей мере 2,5 мг/л. В других вариантах осуществления выбрали другие пороговые значения. Продуктивность экспрессии (мг очищенного IgG1/л культуры клеток) очищенного IgG1 идентифицировали в примере 9.2.1 (результаты показаны на фигурах 16-18), и в варианте осуществления настоящего описания изобретения, выбрали пороговое значение по меньшей мере 30,0 мг/л был. В других вариантах осуществления выбрали другие пороговые значения.

Термостабильность является важным фактором, так как белки, такие как антитела, являются восприимчивыми к высоким температурам, следовательно, имеют важное значение антитела, которые способны выдерживать требования, связанные с хранением и транспортировкой, требуемых с целью распространения терапевтических средств во всем мире, и имеют длительный срок хранения. Термостабильность очищенного Fab определили в примере 9.1.2 (результаты показаны на фигурах 16-18), и в варианте осуществления настоящего описания изобретения выбрали пороговое значение по меньшей мере 70°С. В других вариантах осуществления выбрали другие пороговые значения. Термостабильность очищенного IgG1 определили в примере 9.2.2 (результаты показаны на фигурах 16-18), перечисленное значение представляет дестабилизацию вариабельных доменов, и в одном варианте осуществления выбрали пороговое значение по меньшей мере 73°С. В других вариантах осуществления выбрали другие пороговые значения.

Стабильность в сыворотке является важным фактором для терапевтических антител, так как терапевтические белки должны поддерживать эффективность и функциональную конформацию, несмотря на воздействие сывороточных протеаз, присутствующих в сыворотке человека. Стабильность в сыворотке белковых пар эмбрионального типа определили с помощью способов, описанных в примерах 6.5 и 7.2. Стабильность в сыворотке является важной, но не рассматривалась как определяющий фактор в выборе белковых пар эмбрионального типа, так как анализ стремился к ложно-отрицательным результатам в нескольких случаях.

Содержание мономера (% мономера), определяемое эксклюзионной хроматографией (SEC), является важным фактором, так как оно хорошо коррелирует со способностью к агрегации. Агрегация является распространенной проблемой в терапевтической разработке белка, которая приводит к инактивации, неоднородности и производственным потерям белкового терапевтического средства. Содержание мономера (% мономера), определяемое с помощью эксклюзионной хроматографией (SEC), и для очищенной Fab формы, и очищенной IgG1 формы определили с помощью способов, описываемых в примерах 9.1.3 и 9.2.3 (результаты показаны на фигурах 16-18). Содержание мономера (% мономера) очищенного Fab определили в примере 9.1.3, и в одном варианте осуществления выбрали пороговое значение по меньшей мере 98%. В других вариантах осуществления выбрали другие пороговые значения. Содержание мономера (% мономера) очищенного IgG1 определили в примере 9.2.3, и в одном варианте осуществления выбрали пороговое значение по меньшей мере 99%. В других вариантах осуществления выбрали другие пороговые значения.

Изоэлектрическая точка (pi) является прогнозирующей для растворимости при определенном рН. Когда рН раствора значительно отличается от pi данного белка, белок является растворимым. Изоэлектрическая точка является важной, но в некоторых вариантах осуществления не рассматривалась как определяющий фактор в выборе белковой пары эмбрионального типа.

В одном варианте осуществления настоящего описания изобретения, пороговые значения для каждого критерия выбрали следующим образом: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1) по меньшей мере 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1) по меньшей мере 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2) по меньшей мере 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2) по меньшей мере 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3) по меньшей мере 98%; и f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3) по меньшей мере 99%. Следующие белковые пары эмбрионального типа (54) определили как обладающие данной превосходной функциональной активностью, связанной с пригодностью к разработке, так как каждая из следующих пар обладала значениями, равными или превосходящими данные пороговые значения (данные показаны на фигурах 16-24): VH1-18 (SEQ ID NO:204)/VK1-39 (SEQ ID NO:236); VH1-18 (SEQ ID NO:204)/VK3-15 (SEQ ID NO:238); VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-46 (SEQ ID NO:205)/VL3-21 (SEQ ID NO:257); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-16 (SEQ ID NO:234); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK1-39 (SEQ ID NO:236); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VK1-05 (SEQ ID NO:230); VH3-11 (SEQ ID NO:208)/VK1-39 (SEQ ID NO:236); VH3-11 (SEQ ID NO:208)/VK3-15 (SEQ ID NO:238); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-16 (SEQ ID NO:234); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-40 (SEQ ID NO:250); VH3-15 (SEQ ID NO:209)/VL1-47 (SEQ ID NO:251); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-15 (SEQ ID NO:209)/VL2-14 (SEQ ID NO:254); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-21 (SEQ ID NO:210)/VK1-27 (SEQ ID NO:235); VH3-21 (SEQ ID NO:210)/VL2-11 (SEQ ID NO:253); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:2H)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-30 (SEQ ID NO:212)/VK3-20 (SEQ ID NO:239); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK1-27 (SEQ ID NO:235); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH3-74 (SEQ ID NO:214)/VL1-51 (SEQ ID NO:252); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-15 (SEQ ID NO:238); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252). Следовательно, коллекции, которые включают любое количество данных белковых пар эмбрионального типа, могут применяться для идентификации пригодных к разработке антител или их фрагментов к любому антигену.

В дополнение, подгруппу белковых пар эмбрионального типа выбрали на основе сравнения данных стресс-тестирования, идентифицированных с применением способов, описываемых в примерах 9.2.5 (a-d), данные показаны на фигурах 19-24, примерах 9.2.6 (а-d), данные показаны на фигурах 49-54, и примере 9.2.7, оценка показана на фигурах 55-60. Способами стресс-тестирования оценивали 95 белковых пар эмбрионального типа формы IgG1 с целью определения их способности противостоять воздействию кислот и встряхиванию со стеклянными шариками. 36 белковых пар эмбрионального типа варианта осуществления выбрали, так как они обладают дополнительными превосходными функциональными свойствами, относящимися к пригодности к разработке, так как они показали сильную устойчивость к кислоте и стрессу встряхивания. Способность антитела противостоять воздействию кислоты становится все более важным фактором, так как этап инактивации вируса является стандартным в течение производства и выделения целевого продукта (DSP) в системе химии, производства и контроля (CMC). Этап обработки кислотой денатурирует белки капсида вируса, которые вирус использует для заражения. Однако снижение рН оказывает дестабилизирующее воздействие на каждый белок. Нестабильные антитела денатурируют и теряют нативную структуру на данном этапе. На этапе активации вируса, после определенного времени, обработка кислотой ослабляется нейтрализацией, и в то время как белки капсида вируса остаются в неактивной конформации, обработанные антитела идеально сохраняют свою нативную структуру. Способность антител или фрагментов антител противостоять напряжению сдвига является полезным критерием, так как невозможно избежать этапа фильтрации во время процессинга. Данные 36 белковых пар эмбрионального типа, выбранные в варианте осуществления, выполнили все предыдущие пороговые значения функциональной активности и, в дополнение, получили оценку на уровне или выше 1225 в кумулятивной оценке стресс-тестирования. В одном варианте осуществления пороговые значения для каждого критерия выбрали следующим образом: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1) по меньшей мере 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1) по меньшей мере 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2) по меньшей мере 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2) по меньшей мере 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3) по меньшей мере 98%; и f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3) по меньшей мере 99%; и g) кумулятивная оценка стресс-тестирования (описываемая в примере 9.2.7) по меньшей мере 1225. Следовательно, варианты осуществления настоящего раскрытия изобретения включают коллекции, включающие подгруппу полностью функциональных белковых пар эмбрионального типа (36 из 54), которые обладают дополнительными превосходными функциональными свойствами, относящимися к пригодности к разработке. В данном варианте осуществления коллекция включает: VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В другом варианте осуществления пороговые значения для каждого критерия выбрали следующим образом: а) продуктивность экспрессии очищенного Fab (описываемая в примере 9.1.1) по меньшей мере 2,5 мг/л; b) продуктивность экспрессии очищенного IgG1 (описываемая в примере 9.2.1) по меньшей мере 30,0 мг/л; с) термостабильность очищенного Fab (описываемая в примере 9.1.2) по меньшей мере 70°С; d) термостабильность очищенного IgG1 (описываемая в примере 9.2.2) по меньшей мере 73°С; е) содержание мономера очищенного Fab (описываемое в примере 9.1.3) по меньшей мере 99%; и f) содержание мономера очищенного IgG1 (описываемое в примере 9.2.3) по меньшей мере 99%; и g) изоэлектрическая точка очищенного IgG1 (описываемая в примере 9.2.4) по меньшей мере 8,3; и h) кумулятивная оценка стресс-тестирования (описываемая в примере 9.2.7) по меньшей мере 1225. В данном варианте осуществления коллекция включает 33 пары: VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

В дополнительном варианте осуществления пары добавляли к коллекции, даже если сами пары не удовлетворяли всем пороговым значениям в пределах каждого критерия, но добавлялись к коллекции в целях повышения разнообразия. В варианте осуществления коллекция дополнительно включает: VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); и VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256). В данном варианте осуществления коллекция включает (36 пар): VH1-18 (SEQ ID NO:204)/VK3-20 (SEQ ID NO:239); VH1-46 (SEQ ID NO:205)/VK3-15 (SEQ ID NO:238); VH1-46 (SEQ ID NO:205)/VL1-51 (SEQ ID NO:252); VH1-69*01 (SEQ ID NO:206)/VL1-51 (SEQ ID NO:252); VH3-07 (SEQ ID NO:207)/VK1-12 (SEQ ID NO:233); VH3-07 (SEQ ID NO:207)/VK1-27 (SEQ ID NO:235); VH3-07 (SEQ ID NO:207)/VK3-15 (SEQ ID NO:238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO:251); VH3-07 (SEQ ID NO:207)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL1-40 (SEQ ID NO:250); VH3-11 (SEQ ID NO:208)/VL1-47 (SEQ ID NO:251); VH3-11 (SEQ ID NO:208)/VL1-51 (SEQ ID NO:252); VH3-11 (SEQ ID NO:208)/VL2-23 (SEQ ID NO:255); VH3-15 (SEQ ID NO:209)/VK1-05 (SEQ ID NO:230); VH3-15 (SEQ ID NO:209)/VK1-06 (SEQ ID NO:231); VH3-15 (SEQ ID NO:209)/VK1-12 (SEQ ID NO:233); VH3-15 (SEQ ID NO:209)/VK1-27 (SEQ ID NO:235); VH3-15 (SEQ ID NO:209)/VK3-11 (SEQ ID NO:237); VH3-15 (SEQ ID NO:209)/VL1-51 (SEQ ID NO:252); VH3-21 (SEQ ID NO:210)/VK1-12 (SEQ ID NO:233); VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO:236); VH3-23 (SEQ ID NO:211)/VK3-15 (SEQ ID NO:238); VH3-23 (SEQ ID NO:211)/VL2-23 (SEQ ID NO:255); VH3-23 (SEQ ID NO:211)/VL3-1 (SEQ ID NO:256); VH3-53 (SEQ ID NO:213)/VK3-15 (SEQ ID NO:238); VH3-53 (SEQ ID NO:213)/VL2-11 (SEQ ID NO:253); VH3-74 (SEQ ID NO:214)/VK1-05 (SEQ ID NO:230); VH3-74 (SEQ ID NO:214)/VK1-06 (SEQ ID NO:231); VH3-74 (SEQ ID NO:214)/VK1-12 (SEQ ID NO:233); VH3-74 (SEQ ID NO:214)/VK3-20 (SEQ ID NO:239); VH5-51 (SEQ ID NO:215)/VK1-39 (SEQ ID NO:236); VH5-51 (SEQ ID NO:215)/VL1-40 (SEQ ID NO:250); VH5-51 (SEQ ID NO:215)/VL1-51 (SEQ ID NO:252); VH6-1 (SEQ ID NO:216)/VK1-09 (SEQ ID NO:232); VH6-1 (SEQ ID NO:216)/VK3-20 (SEQ ID NO:239) и VH6-1 (SEQ ID NO:216)/VL1-51 (SEQ ID NO:252).

Пример 11: Бета-тестирование коллекций

Для подтверждения эффективности образца коллекции, субколлекции, каждая из которых включает одну белковую пару эмбрионального типа, или пулы субколлекций создали и провели селекцию в отношении антигенов. Выбранные антитела затем тестировали и формы Fab, и формы IgG1 в отношении характеристик пригодности к разработке, таких как термостабильность в Fab форме, pi в IgG1 форме, продуктивности экспрессии и в Fab, и в IgG1 формах, термостабильность в IgG1 форме и % мономера в IgG1 форме, определяемый с помощью SEC. В дополнение, в некоторых случаях определяли аффинность в отношении антигена формы Fab.

Создание коллекции

Субколлекции, включающие белковые пары эмбрионального типа синтезировали следующим образом: области FR1-CDR1-FR2-CDR2-FR3 из соответствующих белковых последовательностей эмбрионального типа, показанные на фигурах 25-33, синтезировали в GeneArt (Регенсбург, Германия). VH клонировали посредством NheI и SaII, a VL посредством NdeI и Acc65I в дисплейный вектор pJPd1. Кассеты CDR-H3, включая константную область FR4, вставили посредством BssHII и XhoI с теоретическим разнообразием в диапазоне между 5,5×105 и 1,9×1019. CDR-H3 кассеты с длиной CDR-H3 6-17 аминокислот синтезировали в Sloning (Мартинсрид, Германия). Разнообразия CDR-L3 достигли введением либо каппа, либо лямбда TRIM кассет, синтезированных в ELLA Biotech (Мартинсрид, Германия) с теоретическим разнообразием в диапазоне между 4,6×106 и 2,5×109.

Как правило, от 0,25 до 2 мкг ДНК фагмиды pJPd1 субколлекций трансформировали в электрокомпетентные клетки МС1061 F′ Е.coli, и трансформанты собирали в среду ТВ и встряхивали при 37°С в течение 1 часа. Разведения разрастающейся среды высевали на LB/Cam/Gluc. Амплификацию библиотек проводили встряхиванием в течение ночи в соответствующих количествах LB/cam/1% Glu. Размеры библиотеки для субколлекций находились в диапазоне от 4,6×108 и 4,4×109. Общий размер библиотеки всех субколлекции вместе составляет около 1,3×1011 представителей. Для анализа качества разработанных субколлекций выбрали по меньшей мере 30 клонов для каждой субколлекции и участки CDR-L3 и -Н3 секвенировали для определения правильности и уникальности последовательностей. Библиотеки хранили в виде культур Е.coli с глицерином.

Фаги, отображающие субколлекции формы Fab, приготовили следующим образом. Для каждого препарата фага библиотеки бактерии из соответствующего глицеринового стока библиотеки инокулировали в 80 мл среды 2х YT/Cam/GIc, получая в результате оптическую плотность при 600 нм 0,2-0,3. Культуры встряхивали до достижения оптической плотности при 600 нм 0,45-0,55. Затем добавили фаг-хелпер при множественности заражения в 10 к бактериальной культуре с последующей инкубацией в течение 45 мин при 37°С без встряхивания, а затем в течение 45 мин при 37°С со встряхиванием при 120 оборотах в минуту. Бактерии осаждали центрифугированием, и супернатант, содержащий фаг-хелпер удаляли. Зараженные фагом бактерии ресуспендировали в 400 мл среды 2х YT/CAM/KAN/IPTG и инкубировали в течение ночи при 22°С при встряхивании со скоростью 120 оборотов в минуту. На следующий день бактерии из ночной культуры осадили и собрали супернатант, содержащий Fab-представляющий фаг. Преципитацию фага проводили путем добавления PEG/NaCl в фаг-содержащий супернатант. Образец инкубировали по меньшей мере в течение 30 мин на льду. Преципитированные фаги центрифугировали и ресуспендировали в PBS. Образец медленно вращали для получения однородной суспензии, и остаточный бактериальный детрит осадили и удалили. Из фаг-содержащего супернатанта фаг снова преципитировали с применением PEG/NaCl. Наконец, фаговый осадок ресуспендировали в PBS, перенесли в стерильную пробирку и встряхивали медленно до получения однородной суспензии. Титры фагов определили с помощью титрования методом spot, твердофазного ELISA и УФ-поглощения (Nanodrop) с оптической плотностью при 268 нм.

Титры фагов и уровни отображения Fab-фрагментов, экспрессированных трицистронным дисплейным вектором pJPd1 (показанным на фигуре 9) и представленных на фаге с помощью CysDisplay ® (как описано в WO 01/05950, США 6753136, который включен в качестве ссылки во всей своей полноте), оценили для каждого отдельного препарата фага путем твердофазного ELISA. Для захвата применяют два различных антитела:

(1) антитело к М13 (Amersham # 27-9420-01) применяли, поскольку оно захватывает фаговые частицы с помощью основного белка оболочки g8p, следовательно, можно определить титр фага.

(2) применяли антитело к Fd (сайт связывания # РС075), которое связывается с отображенным Fab, следовательно, захватывается только фаг, отображающий Fab.

Для (1) и (2) применяют отдельные эталонные кривые. Моноклональные антитела к М13 (направленные против основного белка оболочки фага М13, g8p), конъюгированные с пероксидазой хрена (HPR) применяют в качестве детекторного антитела.

Соответствующие захватывающие антитела иммобилизовали на 96-луночных планшетах MaxisorpTM путем дозирования раствора антител для антител к М13 и антител к Fd в различные лунки, герметизации планшета с помощью многослойной фольги и инкубации в течение ночи. На следующий день планшеты промыли TBST и каждую лунку блокировали CTBST.

Исходные разведения фаговых супернатантов и эталонных образцов (CS), подготовили в CTBST в титрационных микропланшетах. Подготовили исходные разведения фаговых супернатантов для антител к М13 и к Fd. Подготовили исходные разведения эталонных образцов, VH3-23 HuCAL Gold ® 1+k VCSM13 и объединенные фаги каппа и лямбда HuCAL PLATINUM. Подготовили серийные разведения фаговых супернатантов, при этом предварительно заполнили титрационные микропланшеты CTBST и добавили фаг, и предварительно заполнили второй титрационный микропланшет CTBST и добавили фаг. Для эталонного образца исходное разведение, описанное выше, нанесли на планшет и серийные разведения антител к М13 и к Fd нанесли на планшет.

И фаговые супернатанты и эталонные образцы перенесли для обнаружения следующим образом. Блокированные ELISA планшеты промыли TBST. Фаговые супернатанты перенесли из планшетов разведения в покрытые планшеты ELISA, инкубировали при комнатной температуре и промыли TBST. Добавили конъюгат антител к М13 с пероксидазой (Amersham), разведенный в CTBST, и инкубировали в течение 1-2 ч при комнатной температуре. Рабочий раствор Quanta Blu (Pierce) получили путем смешивания 1 части (например, 0,5 мл) раствора перекиси и 9 частей (например, 4,5 мл) раствора субстрата. ELISA-планшеты промыли TBST, добавили рабочий раствор QuantaBlu. Флуоресценцию измеряли после инкубации в течение ~2 мин (возбуждение 320 нм, излучение 430 нм), и последовательно с интервалами в 5 мин. Оценку данных ELISA провели следующим образом: создали калибровочные кривые и рассчитали титры фаговых супернатантов и контроля. Для каждого образца титр антител к Fd делили на титр антител к М13 (анти-pVIII), полученное соотношение являлось относительным уровнем отображения. Результаты показаны в таблице 13.

Таблица 13
Подбиблиотека Каркасный участок Титр (титрование методом spot) Титр (ELISA) Относительное отображение
VH VL Препарат фага I Препарат фага II Препарат фага I Препарат фага II Препарат фага I Препарат фага II
18 VH3-23 VK1-39 5,7Е+12 2,9Е+12 2,9Е+13 8,0Е+12 6,1 9,3
119 VH3-23 VL3-1 6,6Е+12 2,2Е+12 2,8Е+13 9,2Е+12 6,6 8,8

Выбор фагового дисплея против DKK3 человека. Слияние rhErbB4/Her4 Fc. Слияние rhFZD-4 Fc и eGFP (усиленный зеленый флуоресцентный белок)

Осуществили стратегии параллельного пэннинга с отдельными субколлекциями или пулами субколлекций с целью максимизировать вероятность идентификации разнообразно связывающихся антител с желаемыми биофизическими характеристиками. Dickkopf-3 (DKK3) (Gene ID 27122) человека, рекомбинантный человеческий слитый белок (rh)ErbB4/Her4 (Gene ID 2066)_Fc, rhFZD-4 (Gene ID 8322) Fc слияния и eGFP (усиленный зеленый флуоресцентный белок; последовательность приведена выше) выбрали в качестве модельных антигенов для проверки коллекции. Скрининг коллекции провели с помощью сольватационного пэннинга на основе эпоксидных гранул М-450 с соответствующими антигенами, ковалентно иммобилизованными на магнитных микрогранулах Dynabeads(R) (DynaI/Invitrogen Prod. no. 140.11), описываемых ниже.

Сольватационный пэннинг на основе гранул против DKK3

Карбоксильные гранулы (Dynal)), покрытые DKK3 и контрольным BSA (бычий сывороточный альбумин), блокировали с помощью MPBST при комнатной температуре перед инкубацией с предварительно адсорбированными фагами. После нескольких этапов промывки связанные фаги элюировали и амплифицировали путем заражения клеток TG1F + для следующего цикла отбора. После 3 циклов отбора ДНК фагмиды pJPd1 (показанной на фигуре 9) изолировали, и фрагменты, кодирующие Fab (модифицированный OmpA-VL и модифицированный phoA-Fd), вырезали путем рестрикционного расщепления с помощью XbaI и EcoRI и вшили в вектор экспрессии pJPx1 (показанный на фигуре 10), и трансформировали в E.coli TG1 F-. Инфицированные культуры затем поместили на большие LB/Cam/Gluc планшеты и оставили расти в течение ночи. Отдельные клоны изолировали и тестировали с помощью ELISA на продуктивность экспрессии Fab и связывание антигена. Экспрессию Fab обнаружили путем инкубирования Fab-содержащих клеточных экстрактов на ELISA планшете, покрытом овечьими антителами к Fd человека (The Binding Site Cat. PC075), с последующим обнаружением с помощью козьих антител, специфичных к человеческому IgG F(ab′)2-фрагменту, конъюгированных со щелочной фосфатазой (АР) (Jackson Cat. 109-055-097). Специфичность к антигену тестировали путем скрининга Fab-содержащих клеточных экстрактов на карбоксильных гранулах с иммобилизованным DKK3 и карбоксильных гранулах с иммобилизованным BSA (DynaI) с помощью технологии флуорометрического анализа микрообъемов (FMAT ®) для анализов на основе гранул (система обнаружения клеток Applied Biosystems 8200 Cellular Detection System/PE Biosystems). Первичные попадания определили как Fab, которые приводят к среднему флуоресцентному сигналу FMAT по меньшей мере в 5 превышающему фон, который установили на значении 200. Специфичность к DKK3 подтвердили во вторичном ELISA с DKK3 в качестве родственного антигена и CD38_Fc в качестве негативного контрольного антигена. CDR3 области тяжелой и легкой цепи 63, 43 и 44 клонов для подбиблиотек VH3-23/VK1-39, VH3-23/VL3-1 и HuCAL Platinum ® VH3-23/kappa выбрали для секвенирования с целью оценки вариабельности последовательности DKK3-связывающих антител. Последовательности областей CDR-H3 и CDR-13 выбранных связывающих антител показаны на фигуре 86. В целом, 31 из 56 успешных последовательностей (55%), 20 из 35 последовательностей (47%) и 17 из 44 последовательностей (39%) подбиблиотек VH3-23/VK1-39, VH3-23/VL3-1 и HuCAL-Pt VH3-23/kappa, соответственно, являлись разными, показывая, что созданные библиотеки содержали разнообразный репертуар DKK3 связывающих антител. Результаты показаны в таблице 14.

Таблица 14
Dkk-3
Библиотека Скринировано Попаданий Уровень попаданий [%] Выбрано для секвенирования Уникальные / Последовательности
18 732 525 72 63 31/56
119 715 536 75 43 20/35
HuCAL-Pt VH3-23/k 736 667 91 44 17.44

18 представляет VH3-23/VK1-39, и 119 представляет VH3-23/VL3-1.

Сольватационный пэннинг на основе гранул против rhErbB4/Her4 Fc слияния, rhFZD-4 Fc слияния и eGFP

Слияние rhErbB4/Her4_Fc, слияние rhFZD-4 Fc или eGFP и контрольные BSA эпоксидные М-450 гранулы (DynaI) блокировали с помощью реагента Chemiblocker в течение 2 ч при комнатной температуре (RT) перед инкубацией с предварительно адсорбированными фагами в течение 2 ч при комнатной температуре. После нескольких этапов промывки связанные фаги элюировали и амплифицировали путем заражения клеток TG1F+для следующего цикла отбора. После 3 циклов отбора ДНК фагмиды pJPd1 (показанной на фигуре 9) изолировали, и фрагменты, кодирующие Fab (модифицированный ompA-VL и модифицированный phoA-Fd), амплифицировали с помощью ПЦР, очистили и расщепили с помощью XbaI и EcoRI, и вшили в вектор экспрессии pJPx1 (показанный на фигуре 10), и трансформировали в E.coli TG1 F-. Инфицированные культуры затем поместили на большие LB/Cam/Gluc планшеты и оставили расти в течение ночи. Отдельные клоны изолировали и тестировали с помощью ELISA на продуктивность экспрессии Fab и связывание антигена. Экспрессию Fab обнаружили путем инкубирования Fab-содержащих клеточных экстрактов на ELISA планшете, покрытом овечьими антителами к Fd человека (The Binding Site Cat. PC075), с последующим обнаружением с помощью козьих антител, специфичных к человеческому IgG F(ab′)2-фрагменту, конъюгированных со щелочной фосфатазой (АР) (Jackson Cat. 109-055-097). Специфичность к антигену тестировали путем ELISA скрининга с Fab-содержащими клеточными экстрактами к антигену rhErbB4/Her4_Fc, антигену rhFZD 4_Fc или eGFP непосредственно нанесенному на планшеты MaxiSorp. Первичные попадания определили как Fab, которые приводят к сигналу ELISA по меньшей мере в 5 раз превышающему фон. Результаты показаны на фигурах 61 A-D.

Пэннинг с захватывающим Fc (Fc-capture panning) против ErbB4/Her4 Fc

Три цикла твердофазного пэннинга с захватывающим Fc провели с применением ErbB4/Her4 рекомбинантного белка, меченного Fc, иммобилизованного путем захвата козьими антителами, специфичными к Fc фрагменту IgG человека (Jackson; Cat. 109-005-098), или мышиными антителами, специфичными к Fc фрагменту IgG человека (Jackson; Cat. 209-005-098), на планшетах Maxisorp (Nunc). Перед каждым циклом отбора фаги блокировали с помощью 0,1 мг/мл человеческого, козьего и мышиного иммуноглобулина в MPBST/BSA. После нескольких этапов промывки связанные фаги элюировали и амплифицировали путем заражения клеток TG1F + для следующего цикла отбора. После 3 циклов отбора ДНК фагмиды pJPd1 (показанной на фигуре 9) изолировали, и фрагменты, кодирующие Fab (модифицированный ompA-VL и модифицированный phoA-Fd), вырезали путем рестрикционного расщепления с помощью XbaI и EcoRI, и вшили в вектор экспрессии pJPx1 (показанный на фигуре 10), и трансформировали в TG1 F-. Инфицированные культуры затем поместили на большие LB/Cam/Gluc планшеты и оставили расти в течение ночи. Отдельные клоны изолировали и тестировали с помощью ELISA на продуктивность экспрессии Fab и связывание антигена. Экспрессию Fab обнаружили путем инкубирования Fab-содержащих клеточных экстрактов на ELISA планшете, покрытом овечьими антителами к Fd человека (The Binding Site Cat. PC075), с последующим обнаружением с помощью козьих антител, специфичных к человеческому IgG F(ab′)2-фрагменту, конъюгированных со щелочной фосфатазой (АР) (Jackson Cat. 109-055-097). Специфичность к антигену тестировали путем ELISA скрининга с Fab-содержащими клеточными экстрактами к антигену rhErbB4/Her4_Fc, иммобилизованному с помощью козьих антител к IgG человека (Jackson; Cat. 109-005-098), нанесенных на планшеты MaxiSorp. Первичные попадания определили как Fab, которые приводят к сигналу ELISA по меньшей мере в 5 превышающему фон. Специфичность к rhErbB4/Her4_Fc подтвердили во вторичном ELISA с захватывающим Fc, с rhErbB4/Her4_Fc в качестве родственного антигена и CD38_Fc в качестве негативного контрольного антигена.

Участки CDR3 тяжелой и легкой цепей 112, 61 и 95 клонов для подбиблиотек VH3-23/VK1-39, VH3-23/VL3-1 и HuCAL Pt VH3-23/kappa, соответственно, секвенировали с целью оценки вариабельности последовательности rhErbB4/Her4_Fc-связывающих антител. В целом, 31 из 106 успешных последовательностей (29%), 30 из 61 последовательности (49%) и 14 из 91 последовательности (15%) подбиблиотек VH3-23/VK1-39, VH3-23/VL3-1 и HuCAL-Pt VH3-23/kappa являлись разными, показывая, что созданные библиотеки содержали разнообразный репертуар связывающих антител. Вариабельность последовательностей показана в таблице 15.

Таблица 15
Her4_Fc
Библиотека Скринировано Попаданий Попаданий* Уровень попаданий [%] Выбрано для СР** Уникальные***
10×Bg 5×Bg 2×Bg 10×Bg 5×Bg 2×Bg Всего
18 794 112 150 92 262 33 86 19 7 112 31/106
119 1145 39 7 15 46 4 39 7 15 61 30/61
HuCAL-Pt VH3-23/k 1364 922 105 118 1027 75 95 0 0 95 1491
*Попадания определяют как реагирующие по меньшей мере в 5 раз сильнее, чем фон (Bg)
**Для компрессионных планшетов выбрали несколько клонов, которые реагировали только в 2 раза сильнее, чем фон (Bg)
***Уникальные последовательности на анализируемые последовательности

18 представляет VH3-23/VK1-39, и 119 представляет VH3-23/VL3-1.

Определение Biacore KnD (аффинности) посредством постановки антигенной ловушки формы Fab

Связывание фракций мономеров Fab (анализировали с помощью аналитической SEC; Superdex75, Amersham Pharmacia) для захвата антигенов анализировали следующим образом: На чип СМ5 (Biacore/GE Healthcare) ковалентно иммобилизовали соответствующее захватывающее антитело к антигенной метке, применяя EDC/NHS химию. Кинетические измерения проводили путем захвата антигена и последующей инъекции шести различных концентраций Fab (2n серийного разведения). После каждого цикла сенсорный чип восстанавливался. Холостые инъекции подвижного буфера применяли для двойного сравнения с образцом. Все сенсограммы установили с применением программного обеспечения BIA evaluation 3.2 (Biacore/GE Healthcare) для определения констант уровней kon и koff, которые применяли для расчета KD.

Определения Biacore KD провели следующим образом: подвижным буфером являлся PBST (фосфатно-солевой буферный раствор рН 7,2 GIBCO+0,05% Твин-20). Приблизительно 400 резонансных единиц (RU) антигена с Fc-связующей меткой (lot# FYY0310041) захватили, применяя антитело к Fc человека (Biacore/GE Healthcare). Применяли концентрации Fab в диапазоне от 15,6 до 500 нМ при скорости потока 20 мкл/мин, времени ввода пробы 30 с и времени диссоциации 100 с. Восстановление поверхности проводили с помощью 2 введений 15 мкл 3М MgCl2 реагента. Результаты показаны на фигуре 38.

Тестирование пригодности к разработке антител и фрагментов антител, идентифицированных против DKK3, rhErbB4/Her4 Fc слияния, rhFZD-4 Fc слияния и eGFP

Антитела или фрагменты, специфичные к антигенам, протестировали и в Fab, и в IgG1 форме на признаки пригодности к разработке, такие как термостабильность формы Fab, аффинность формы Fab, pi формы IgG1, продуктивность экспрессии и в Fab, и в IgG форме, термостабильность формы IgG1 и % мономера формы IgG1, определяемый с помощью SEC. Стабильности в сыворотке формы IgG1 тестировали как описано в примере 7.2. Тестирование термостабильности в Fab и IgG1 форме выполнили, как описано в примерах 9.1.2 и 9.2.2. pi в формате IgG1 выполнили, как описано в примере 9.2.4. Продуктивность экспрессии в формате IgG1 выполнили, как описано в примере 9.2.1. % мономера формы IgG1, определяемый с помощью SEC выполнили, как описано в примере 9.2.3. Результаты показаны на фигурах 37-39, 45-48 и 62.

Опять же, авторы настоящего изобретения полагают, что существует высокая корреляция между входом (коллекция антител, применяемая для выбора против антигена) и выходом (антитела, идентифицированные как специфические к антигену), в отношении тестируемых функциональных свойств. Следовательно, коллекции по настоящему изобретению включают антитела или фрагменты, которые включают, в частности, те же аминокислотные последовательности, что и протестированные конструкции, например, каркасные участки и/или определяющие комплементарность области. Участки CDR3 являются диверсифицированными. Так как в одном аспекте коллекции включают аминокислотные последовательности или нуклеиновые кислоты, кодирующие их, протестированных конструкций, считается, что коллекции включают антитела или их фрагменты, обладающие теми же превосходными функциональными свойствами, относящимися к пригодности к разработке, что и конструкции, протестированные в примере 9. Следовательно, ожидается, что многие из антител или фрагментов, впоследствии выбранных против антигена, также будут обладать теми же превосходными функциональными свойствами, относящимися к пригодности к разработке.

Данные, показанные на фигурах 37-39, 45-48 и 62А-С, подтверждают данный вывод. Фигура 39 показывает Fab-фрагменты, выбранные против антигена DKK3 или ErbB4/Her4_Fc из коллекций по настоящему изобретению, и как Fab-фрагменты обладают аналогичной термостабильностью, что и контроль, который являлся первоначально протестированной конструкцией, как описано в примере 9. В дополнение, фигуры 45-48 показывают IgG. специфичные к антигенам DKK3 или ErbB4/Her4_Fc, которые выбрали из коллекций по настоящему изобретению, и как IgG обладают аналогичными изоэлектрическими точками (pi), термостабильностью, продуктивностью экспрессии и содержанием мономера, что и контроли, которые являлись первоначально протестированными конструкциями, как описано в примере 9. Фигуры 62 А-С показывают IgG, выбранные против слияния rhErbB4/Her4_Fc, слияния rhFZD 4 FC и eGFP, и как IgG обладают аналогичными изоэлектрическими точками (pi), продуктивностью экспрессии, термостабильностью и содержанием мономера, что и контроли, которые являлись первоначально протестированными конструкциями, как описано в примере 9.

В целом, это показывает, что коллекции по настоящему изобретению включают антитела или фрагменты, обладающие превосходными свойствами, относящимися к пригодности к разработке, и поддерживает гипотезу авторов настоящего изобретения о том, что вход, коллекции, применяющие последовательности, например, каркасных участков и/или гипервариабельных участков, из белковых пар эмбрионального типа, протестированы и, как показано, обладают превосходными функциональными свойствами, хорошо коррелируют с выходом, антителами или фрагментами, подвергшимися селекции в отношении любого антигена, обладающими превосходными функциональными свойствами, относящимися к разработке.

Следует понимать, что описание, конкретные примеры и данные, наряду с тем, что указывают примеры вариантов осуществления, даны с целью иллюстрации и не предназначены для ограничения настоящего изобретения. Разнообразные изменения и модификации в пределах настоящего изобретения станут очевидными для специалиста в данной области из рассмотрения, описания и данных, содержащихся в данном документе, и, таким образом, рассматриваются как часть настоящего изобретения.

1. Коллекция синтетических антител или их функциональных фрагментов для идентификации антител против мишени, где антитела или функциональные фрагменты включают пары вариабельных участков тяжелых цепей и вариабельных участков легких цепей, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа, выбранные из 22 или более пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK1-39 (SEQ ID NO: 236); VH1-18 (SEQ ID NO: 204)/VK3-15 (SEQ ID NO: 238); VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-46 (SEQ ID NO: 205)/VL3-21 (SEQ ID NO: 257); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-16 (SEQ ID NO: 234); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK1-39 (SEQ ID NO: 236); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VK1-05 (SEQ ID NO: 230); VH3-11 (SEQ ID NO: 208)/VK1-39 (SEQ ID NO: 236); VH3-11 (SEQ ID NO: 208)/VK3-15 (SEQ ID NO: 238); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-16 (SEQ ID NO: 234); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11 (SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-40 (SEQ ID NO: 250); VH3-15 (SEQ ID NO: 209)/VL1-47 (SEQ ID NO: 251); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-15 (SEQ ID NO: 209)/VL2-14 (SEQ ID NO: 254); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-21 (SEQ ID NO: 210)/VK1-27 (SEQ ID NO: 235); VH3-21 (SEQ ID NO: 210)/VL2-11 (SEQ ID NO: 253); VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255); VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256); VH3-30 (SEQ ID NO: 212)/VK3-20 (SEQ ID NO: 239); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK1-27 (SEQ ID NO: 235); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH3-74 (SEQ ID NO: 214)/VL1-51 (SEQ ID NO: 252); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-15 (SEQ ID NO: 238); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

2. Коллекция синтетических антител или их функциональных фрагментов по п. 1, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа, выбранные из двадцати пяти или более пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK1-39 (SEQ ID NO: 236); VH1-18 (SEQ ID NO: 204)/VK3-15 (SEQ ID NO: 238); VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-46 (SEQ ID NO: 205)/VL3-21 (SEQ ID NO: 257); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-16 (SEQ ID NO: 234); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK1-39 (SEQ ID NO: 236); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VK1-05 (SEQ ID NO: 230); VH3-11 (SEQ ID NO: 208)/VK1-39 (SEQ ID NO: 236); VH3-11 (SEQ ID NO: 208)/VK3-15 (SEQ ID NO: 238); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-16 (SEQ ID NO: 234); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11 (SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-40 (SEQ ID NO: 250); VH3-15 (SEQ ID NO: 209)/VL1-47 (SEQ ID NO: 251); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-15 (SEQ ID NO: 209)/VL2-14 (SEQ ID NO: 254); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-21 (SEQ ID NO: 210)/VK1-27 (SEQ ID NO: 235); VH3-21 (SEQ ID NO: 210)/VL2-11 (SEQ ID NO: 253); VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255); VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256); VH3-30 (SEQ ID NO: 212)/VK3-20 (SEQ ID NO: 239); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK1-27 (SEQ ID NO: 235); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH3-74 (SEQ ID NO: 214)/VL1-51 (SEQ ID NO: 252); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-15 (SEQ ID NO: 238); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

3. Коллекция синтетических антител или их функциональных фрагментов по п. 1 или 2, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа, выбранные из тридцати или более пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK1-39 (SEQ ID NO: 236); VH1-18 (SEQ ID NO: 204)/VK3-15 (SEQ ID NO: 238); VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-46 (SEQ ID NO: 205)/VL3-21 (SEQ ID NO: 257); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-16 (SEQ ID NO: 234); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK1-39 (SEQ ID NO: 236); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VK1-05 (SEQ ID NO: 230); VH3-11 (SEQ ID NO: 208)/VK1-39 (SEQ ID NO: 236); VH3-11 (SEQ ID NO: 208)/VK3-15 (SEQ ID NO: 238); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-16 (SEQ ID NO: 234); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11 (SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-40 (SEQ ID NO: 250); VH3-15 (SEQ ID NO: 209)/VL1-47 (SEQ ID NO: 251); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-15 (SEQ ID NO: 209)/VL2-14 (SEQ ID NO: 254); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-21 (SEQ ID NO: 210)/VK1-27 (SEQ ID NO: 235); VH3-21 (SEQ ID NO: 210)/VL2-11 (SEQ ID NO: 253); VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255); VH3-23(SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256); VH3-30 (SEQ ID NO: 212)/VK3-20 (SEQ ID NO: 239); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK1-27 (SEQ ID NO: 235); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH3-74 (SEQ ID NO: 214)/VL1-51 (SEQ ID NO: 252); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-15 (SEQ ID NO: 238); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

4. Коллекция по п. 1, где антитела или функциональные фрагменты включают каркасные участки вариабельных участков тяжелых цепей и вариабельных участков легких цепей, включающие белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанная белковая пара эмбрионального типа имеет следующие свойства:
i) продуктивность экспрессии формы Fab по меньшей мере 2,5 мг/л;
ii) термостабильность формы Fab при 70°С или выше;
iii) содержание мономера (% мономера) формы Fab по меньшей мере 98%, определяемое с помощью SEC;
iv) продуктивность экспрессии формы IgG1 по меньшей мере 30 мг/л;
v) термостабильность формы IgG1 при 73°С или выше; и
vi) содержание мономера (% мономера) формы IgG1 по меньшей мере 99%, определяемое с помощью SEC.

5. Коллекция по п. 1, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11(SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255); VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

6. Коллекция синтетических антител или их функциональных фрагментов по п. 1, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11(SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11 (SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

7. Коллекция по п. 6, где антитела или функциональные фрагменты включают каркасные участки вариабельных участков тяжелых цепей и вариабельных участков легких цепей, включающих белковые последовательности эмбрионального типа белковой пары эмбрионального типа, где указанная белковая пара эмбрионального типа имеет следующие свойства:
i) продуктивность экспрессии формы Fab по меньшей мере 2,5 мг/л;
ii) термостабильность формы Fab при 70°С или выше;
iii) содержание мономера (% мономера) формы Fab по меньшей мере 99%, определяемое с помощью SEC;
iv) продуктивность экспрессии формы IgG1 по меньшей мере 30 мг/л;
v) термостабильность формы IgG1 при 73°С или выше; и
vi) содержание мономера (% мономера) формы IgG1 по меньшей мере 99%, определяемое с помощью SEC, и
vii) изоэлектрическая точка формы IgG1 по меньшей мере 8,3.

8. Коллекция по п. 7, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа, дополнительно выбранные из пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255) и VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256).

9. Коллекция по п. 1, где указанные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих белковые последовательности эмбрионального типа из соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

10. Коллекция по п. 1, где указанные антитела или их функциональные фрагменты включают области CDR1, включающие белковые последовательности эмбрионального типа из соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

11. Коллекция по п. 1, где указанные антитела или их функциональные фрагменты включают области CDR2, включающие белковые последовательности эмбрионального типа из соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

12. Коллекция по п. 1, где указанные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих аминокислотные модификации, которые удаляют потенциальные сайты посттрансляционных модификаций.

13. Коллекция по п. 12, где указанные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей тяжелых цепей, включающих последовательности определяющих комплементарность областей из соответствующих вариабельных участков тяжелых цепей, которые отображены в SEQ ID NO: 266-278.

14. Коллекция по п. 13, где указанные антитела или их функциональные фрагменты включают области HCDR1 из соответствующей области HCDR1, отображенной в SEQ ID NO: 266-278.

15. Коллекция по п. 13 или 14, где указанные антитела или их функциональные фрагменты включают области HCDR2 из соответствующей области HCDR2, отображенной в SEQ ID NO: 266-278.

16. Коллекция по п. 1, где указанные антитела или их функциональные фрагменты включают участок FR4, выбранный из группы, состоящей из JH4 (SEQ ID NO: 293), Jk1 (SEQ ID NO: 297) и Jλ2/3 (SEQ ID NO: 301).

17. Коллекция по п. 1, где указанные антитела или их функциональные фрагменты включают диверсифицированную область HCDR3.

18. Коллекция по п. 1, где указанные антитела или их функциональные фрагменты включают диверсифицированную область LCDR3.

19. Коллекция по п. 1, где коллекция включает по меньшей мере 1×104 антител или их функциональных фрагментов.

20. Коллекция по п. 1, где указанные антитела выбраны из группы, состоящей из IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM и IgD человека.

21. Коллекция по п. 1, где указанные функциональные фрагменты указанных антител выбраны из группы, состоящей из Fab, F(ab′)2, Fab′, Fv и scFv.

22. Коллекция нуклеиновых кислот, кодирующих коллекцию антител или их функциональных фрагментов по любому из предыдущих пунктов.

23. Коллекция векторов экспрессии или дисплейных векторов, содержащая коллекцию нуклеиновых кислот по п. 22.

24. Рекомбинантная клетка-хозяин для получения коллекции антител или их функциональных фрагментов по любому из пп. 1-21, содержащая коллекцию нуклеиновых кислот по п. 22 или коллекцию векторов по п. 23.

25. Способ получения коллекции синтетических антител или их функциональных фрагментов по п. 1, включающий:
a) идентификацию пар генов эмбрионального типа вариабельных участков тяжелых цепей и вариабельных участков легких цепей, присутствующих в человеческом иммунном репертуаре;
b) тестирование белковых пар эмбрионального типа вариабельных участков тяжелых цепей и вариабельных участков легких цепей, идентифицированных на этапе а), в отношении следующих свойств:
i) продуктивность экспрессии формы Fab по меньшей мере 2,5 мг/л;
ii) термостабильность формы Fab при 70°С или выше;
iii) содержание мономера (% мономера) формы Fab по меньшей мере 98%, определяемое с помощью SEC;
iv) продуктивность экспрессии формы IgG1 по меньшей мере 30 мг/л;
v) термостабильность формы IgG1 при 73°С или выше; и
vi) содержание мономера (% мономера) формы IgG1 по меньшей мере 99%, определяемое с помощью SEC; и
c) создание коллекции, где антитела или их функциональные фрагменты включают пары вариабельных участков тяжелых цепей и вариабельных участков легких цепей, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа белковых пар эмбрионального типа, которые имеют свойства этапа b).

26. Способ по п. 25, где этап а) дополнительно включает этапы:
aa) выделения В-клеток человека из образца;
ab) получения кДНК из В-клеток;
ac) амплификации при помощи ПЦР кДНК из В-клеток;
ad) секвенирования продуктов ПЦР; и
ae) идентификации генов эмбрионального типа каждого продукта ПЦР.

27. Способ по п. 25 или 26, где этап b) дополнительно включает этапы:
ba) синтеза ДНК, кодирующей антитела или их функциональные фрагменты, которые включают белковые пары эмбрионального типа вариабельных участков тяжелых цепей и вариабельных участков легких цепей, представляющие пары, которые присутствуют в человеческом иммунном репертуаре;
bb) экспрессии белковых пар эмбрионального типа, синтезированных в ba); и
bc) тестирования белковых пар эмбрионального типа из bb) в отношении каждого из свойств.

28. Способ по п. 25, где этап с) включает этапы:
ca) синтеза нуклеиновых кислот, кодирующих антитела или их функциональные фрагменты;
cb) клонирования нуклеиновых кислот в вектор;
cc) экспрессии антител или их функциональных фрагментов.

29. Способ по п. 25, где антитела или функциональные фрагменты включают пары вариабельных участков тяжелых цепей и вариабельных участков легких цепей, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11(SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255); VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

30. Способ по п. 25, где этап b) дополнительно характеризуется следующими свойствами:
i) содержание мономера (% мономера) формы Fab по меньшей мере 99%, определяемое с помощью SEC; и
ii) изоэлектрическая точка формы IgG1 по меньшей мере 8,3.

31. Способ по п. 25, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа, выбранные из пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11 (SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

32. Способ по п. 25, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей дополнительно включают белковые последовательности эмбрионального типа, выбранные из пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255) и VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256).

33. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих белковые последовательности эмбрионального типа из соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

34. Способ по п. 25, где антитела или функциональные фрагменты дополнительно включают области CDR1, включающие белковые последовательности эмбрионального типа из соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

35. Способ по п. 25, где антитела или функциональные фрагменты дополнительно включают области CDR2, включающие белковые последовательности эмбрионального типа из соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

36. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих аминокислотные модификации, которые удаляют потенциальные сайты посттрансляционных модификаций.

37. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих последовательности определяющих комплементарность областей из соответствующих вариабельных участков тяжелых цепей, отображенных в SEQ ID NO: 266-278.

38. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают области HCDR1 из соответствующей области HCDR1, отображенной в SEQ ID NO: 266-278.

39. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают области HCDR2 из соответствующей области HCDR2, отображенной в SEQ ID NO: 266-278.

40. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают участок FR4, выбранный из группы, состоящей из JH4 (SEQ ID NO: 293), Jk1 (SEQ ID NO: 297) и Jλ2/3 (SEQ ID NO: 301).

41. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают диверсифицированную область HCDR3.

42. Способ по п. 25, где указанные антитела или их функциональные фрагменты включают диверсифицированную область LCDR3.

43. Способ по п. 25, где коллекция включает по меньшей мере 1×104 антител или их функциональных фрагментов.

44. Способ по п. 25, где указанные антитела выбирают из группы, состоящей из IgG1, IgG2, IgG3, IgG4, IgD и IgM.

45. Способ по п. 25, где указанные функциональные фрагменты указанных антител выбирают из группы, состоящей из Fab, F(ab′)2, Fab′, Fv и scFv.

46. Способ идентификации антитела или фрагмента антитела, специфичного к антигену, включающий:
(a) приведение в контакт антигена с коллекцией антител или их функциональных фрагментов по п. 1, и
(b) отбор одного или нескольких антител или фрагментов антител, которые связываются с указанным антигеном.

47. Способ по п. 46, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа из VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11(SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255); VH3-23 (SEQ ID NO: 211)A/L3-1 (SEQ ID NO: 256); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

48. Способ по п. 46 или 47, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа из VH1-18 (SEQ ID NO: 204)/VK1-39 (SEQ ID NO: 236); VH1-18 (SEQ ID NO: 204)/VK3-15 (SEQ ID NO: 238); VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-46 (SEQ ID NO: 205)/VL3-21 (SEQ ID NO: 257); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-16 (SEQ ID NO: 234); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK1-39 (SEQ ID NO: 236); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO: 207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VK1-05 (SEQ ID NO: 230); VH3-11 (SEQ ID NO: 208)/VK1-39 (SEQ ID NO: 236); VH3-11 (SEQ ID NO: 208)/VK3-15 (SEQ ID NO: 238); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-16 (SEQ ID NO: 234); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11 (SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-40 (SEQ ID NO: 250); VH3-15 (SEQ ID NO: 209)/VL1-47 (SEQ ID NO: 251); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-15 (SEQ ID NO: 209)/VL2-14 (SEQ ID NO: 254); VH3-21 (SEQ ID NO: 210)/VK1-12 (SEQ ID NO: 233); VH3-21 (SEQ ID NO: 210)/VK1-27 (SEQ ID NO: 235); VH3-21 (SEQ ID NO: 210)/VL2-11 (SEQ ID NO: 253); VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255); VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256); VH3-30 (SEQ ID NO: 212)/VK3-20 (SEQ ID NO: 239); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK1-27 (SEQ ID NO: 235); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH3-74 (SEQ ID NO: 214)A/L1-51 (SEQ ID NO: 252); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-15 (SEQ ID NO: 238); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

49. Способ по п. 46, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа белковых пар эмбрионального типа, которые дополнительно характеризуются следующими свойствами:
i) содержание мономера (% мономера) формы Fab по меньшей мере 99%, определяемое с помощью SEC; и
ii) изоэлектрическая точка формы IgG1 по меньшей мере 8,3.

50. Способ по п. 49, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей включают белковые последовательности эмбрионального типа, выбранные из пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH1-18 (SEQ ID NO: 204)/VK3-20 (SEQ ID NO: 239); VH1-46 (SEQ ID NO: 205)/VK3-15 (SEQ ID NO: 238); VH1-46 (SEQ ID NO: 205)/VL1-51 (SEQ ID NO: 252); VH1-69*01 (SEQ ID NO: 206)/VL1-51 (SEQ ID NO: 252); VH3-07 (SEQ ID NO: 207)/VK1-12 (SEQ ID NO: 233); VH3-07 (SEQ ID NO: 207)/VK1-27 (SEQ ID NO: 235); VH3-07 (SEQ ID NO: 207)/VK3-15 (SEQ ID NO: 238); VH3-07 (SEQ ID NO:207)/VL1-47 (SEQ ID NO: 251); VH3-07 (SEQ ID NO: 207)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL1-40 (SEQ ID NO: 250); VH3-11 (SEQ ID NO: 208)/VL1-47 (SEQ ID NO: 251); VH3-11 (SEQ ID NO: 208)/VL1-51 (SEQ ID NO: 252); VH3-11 (SEQ ID NO: 208)/VL2-23 (SEQ ID NO: 255); VH3-15 (SEQ ID NO: 209)/VK1-05 (SEQ ID NO: 230); VH3-15 (SEQ ID NO: 209)/VK1-06 (SEQ ID NO: 231); VH3-15 (SEQ ID NO: 209)/VK1-12 (SEQ ID NO: 233); VH3-15 (SEQ ID NO: 209)/VK1-27 (SEQ ID NO: 235); VH3-15 (SEQ ID NO: 209)/VK3-11 (SEQ ID NO: 237); VH3-15 (SEQ ID NO: 209)/VL1-51 (SEQ ID NO: 252); VH3-21 (SEQ ID NO: 210)A/K1-12 (SEQ ID NO: 233); VH3-23 (SEQ ID NO: 211)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VK3-15 (SEQ ID NO: 238); VH3-53 (SEQ ID NO: 213)/VL2-11 (SEQ ID NO: 253); VH3-74 (SEQ ID NO: 214)/VK1-05 (SEQ ID NO: 230); VH3-74 (SEQ ID NO: 214)/VK1-06 (SEQ ID NO: 231); VH3-74 (SEQ ID NO: 214)/VK1-12 (SEQ ID NO: 233); VH3-74 (SEQ ID NO: 214)/VK3-20 (SEQ ID NO: 239); VH5-51 (SEQ ID NO: 215)/VK1-39 (SEQ ID NO: 236); VH5-51 (SEQ ID NO: 215)/VL1-40 (SEQ ID NO: 250); VH5-51 (SEQ ID NO: 215)/VL1-51 (SEQ ID NO: 252); VH6-1 (SEQ ID NO: 216)/VK1-09 (SEQ ID NO: 232); VH6-1 (SEQ ID NO: 216)/VK3-20 (SEQ ID NO: 239) и VH6-1 (SEQ ID NO: 216)/VL1-51 (SEQ ID NO: 252).

51. Способ по п. 50, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей дополнительно включают белковые последовательности эмбрионального типа, выбранные из пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH3-23 (SEQ ID NO: 211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255) и VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256).

52. Способ по п. 46, где указанные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих белковые последовательности эмбрионального типа из соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

53. Способ по п. 46, где антитела или функциональные фрагменты дополнительно включают области CDR1, включающие белковые последовательности эмбрионального типа соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

54. Способ по п. 46, где антитела или функциональные фрагменты дополнительно включают области CDR2, включающие белковые последовательности эмбрионального типа соответствующих пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей.

55. Способ по п. 46, где каркасные участки пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей дополнительно включают белковые последовательности эмбрионального типа, выбранные из пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей VH3-23 (SEQ ID NO:211)/VK1-39 (SEQ ID NO: 236); VH3-23 (SEQ ID NO: 211)/VL2-23 (SEQ ID NO: 255) и VH3-23 (SEQ ID NO: 211)/VL3-1 (SEQ ID NO: 256).

56. Способ по п. 46, где указанные экспрессированные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих аминокислотные модификации, которые удаляют потенциальные сайты посттрансляционных модификаций.

57. Способ по п. 46, где указанные экспрессированные антитела или их функциональные фрагменты включают одну или более определяющих комплементарность областей, включающих последовательности определяющих комплементарность областей из соответствующих вариабельных участков тяжелых цепей, отображенных в SEQ ID NO: 266-278.

58. Способ по п. 46, где указанные экспрессированные антитела или их функциональные фрагменты включают области HCDR1 из соответствующей области HCDR1, отображенной в SEQ ID NO: 266-278.

59. Способ по п. 46, где указанные экспрессированные антитела или их функциональные фрагменты включают области HCDR2 из соответствующей области HCDR2, отображенной в SEQ ID NO: 266-278.

60. Способ по п. 46, где указанные антитела или их функциональные фрагменты включают диверсифицированную область HCDR3.

61. Способ по п. 46, где указанные антитела или их функциональные фрагменты включают диверсифицированную область LCDR3.

62. Способ по п. 46, где коллекция включает по меньшей мере 1×104 антител или их функциональных фрагментов.

63. Способ по п. 46, где указанные антитела выбирают из группы, состоящей из IgG1, IgG2, IgG3, IgG4, IgD и IgM.

64. Способ по п. 46, где указанные функциональные фрагменты указанных антител выбирают из группы, состоящей из Fab, F(ab′)2, Fab′, Fv и scFv.



 

Похожие патенты:

Изобретение относится к биотехнологии и иммунологии. Изобретение относится к генетически модифицированным мышам, которые экспрессируют λ-вариабельные последовательности человека (hVλ), в том числе к мышам, которые экспрессируют последовательности hVλ из эндогенного локуса λ-легкой цепи мыши, мышам, которые экспрессируют последовательности hVλ из эндогенного локуса κ-легкой цепи мыши, и мышам, которые экспрессируют последовательности hVλ из трансгена или эписомы, при этом последовательность hVλ соединена с константной последовательностью мыши.

Изобретение относится к биохимии. Предоставлена композиция для осуществления реакции замещения цепей нуклеиновых кислот, содержащая первый и второй комплексы нуклеиновых кислот, каждый из которых содержит первую, вторую, третью и четвертую цепи нуклеиновых кислот, где каждая из цепей содержит последовательно первый, второй и третий фрагменты.

Изобретение относится к области биотехнологии и может быть использовано для рекомбинантного получения мутантов фототоксического флуоресцентного белка. Рекомбинантным путем получают мутанты фототоксического флуоресцентного белка KillerRed.

Изобретение относится к области иммунологии. Предложен способ скрининга молекулы, способной связываться с Ig-подобным доменом С2-типа 1 CD4 человека, а именно с аминокислотными остатками в положениях 148-154, 164-168 и 185-192.

Изобретение относится к биохимии. Описан способ получения интересующего белка, включающий введение по меньшей мере одного экспрессионного вектора, который содержит генный фрагмент, содержащий ДНК, кодирующую интересующий белок, и также пару транспозонных последовательностей Tol1 или Tol2 на обоих концах генного фрагмента, в суспензионную клетку млекопитающего СНО и суспензионное культивирование клетки млекопитающего, где суспензионная клетка млекопитающего представляет собой суспензионную клетку СНО, которая способна выживать и пролиферировать в бессывороточной среде.

Изобретение относится к области биотехнологии, конкретно к иммунологии, и может быть использовано в медицине. Композицию, основанную на совместном применении ApoA, интерлейкина 15 и домена Sushi альфа цепи рецептора IL15, используют для стимулирования противоопухолевого иммунного ответа у субъекта.

Изобретение относится к области биотехнологии и иммунологии. Описаны новые антитела или антиген-связывающие фрагменты, которые специфично связываются с сиглеком-15.

Настоящее изобретение относится к области иммунологии. Предложено выделенное антитело и его антигенсвязывающий фрагмент, которые специфически связываются с индуцируемым глюкокортикоидами рецептором TNF (GITR) человека; а также композиции, в том числе фармацевтическая композиция, и способ усиления иммунного ответа у человека.

Изобретение относится к области биотехнологии и иммунологии Описаны выделенные антитела и их фрагменты, которые связываются с опухолевыми антигенами. Также описаны композиции и агенты для доставки, которые включают раскрываемые антитела; клетки, которые продуцируют эти антитела; способы продуцирования этих антител; способы применения этих антител, нацеливания на опухоли и/или метастатические клетки, образуемые ими, и/или опухолевые стволовые клетки, и лечение опухолей и/или метастатических клеток, образуемых ими, и/или опухолевых стволовых клеток; и способы прогнозирования рецидива рака у субъекта.

Изобретение относится к области биотехнологии и клеточной инженерии. Предложен способ получения выделенного терапевтического рекомбинантного биологического полипептида или белка для лечения заболевания.

Изобретение относится к способам и композициям для терапевтического и диагностического применения в лечении заболеваний и нарушений, которые вызваны или ассоциированы с нейрофибриллярными клубками.

Изобретение относится к биотехнологии и иммунологии. Изобретение относится к генетически модифицированным мышам, которые экспрессируют λ-вариабельные последовательности человека (hVλ), в том числе к мышам, которые экспрессируют последовательности hVλ из эндогенного локуса λ-легкой цепи мыши, мышам, которые экспрессируют последовательности hVλ из эндогенного локуса κ-легкой цепи мыши, и мышам, которые экспрессируют последовательности hVλ из трансгена или эписомы, при этом последовательность hVλ соединена с константной последовательностью мыши.

Изобретение относится к области биохимии, в частности к лекарственному средству для лечения или профилактики CAPRIN-1 экспрессирующего рака. Также раскрыты антитела, обладающие иммунологической активностью по отношению к белку CAPRIN-1, лекарственное средство и лекарственная комбинация, содержащие указанные антитела, и моноклональное антитело, которое специфически связывается с белком CAPRIN-1.

Изобретение относится к области биохимии, в частности к лекарственному средству для лечения или профилактики CAPRIN-1 экспрессирующего рака. Также раскрыты антитела, обладающие иммунологической активностью по отношению к белку CAPRIN-1, лекарственное средство, содержащее указанные антитела, и моноклональное антитело, которое специфически связывается с белком CAPRIN-1.

Настоящее изобретение относится к биохимии, в частности к антителу против аннексина (Аnх-А1) человека, имеющему следующие гипервариабельные участки (CDR): VLCDR1 представляет собой KASENVVTYVS, VLCDR2 представляет собой GASNRYT, VLCDR3 представляет собой GQGYSYPYT, VHCDR1 представляет собой GYTFTNYWIG, VHCDR2 представляет собой DIYPGGDYTNYNEKFKG, и VHCDR3 представляет собой WGLGYYFDY.

Изобретение относится к области биотехнологии. Описан диагностический способ in vitro диагностики рака эндометрия.

Изобретение относится к области биотехнологии и иммунологии Описаны выделенные антитела и их фрагменты, которые связываются с опухолевыми антигенами. Также описаны композиции и агенты для доставки, которые включают раскрываемые антитела; клетки, которые продуцируют эти антитела; способы продуцирования этих антител; способы применения этих антител, нацеливания на опухоли и/или метастатические клетки, образуемые ими, и/или опухолевые стволовые клетки, и лечение опухолей и/или метастатических клеток, образуемых ими, и/или опухолевых стволовых клеток; и способы прогнозирования рецидива рака у субъекта.

Изобретение относится к области биотехнологии, генной и белковой инженерии. Предложены рекомбинантный полипептид, имеющий специфические иммуногенные свойства изоформ Oct-1, содержащий N-концевой участок Oct-1A человека, линкер и 6 остатков гистидина; а также способ получения поликлональных антител против изоформ Oct-1 с использованием такого полипептида.

Настоящее изобретение относится к области иммунологии и биотехнологии. Предложены антитела к А2 домену тенасцина-С (TNC A2), а также выделенный полинуклеотид, вектор экспрессии, клетка-хозяин и способы получения антитела по изобретению.

Изобретение относится к области иммунологии. Предложено моноклональное антитело, способное специфически связываться с молекулой С3 комплемента человека с экспонированной тиоэфирной связью, и штамм гибридомы мыши РККК(П)764Д.

Изобретение относится к области биотехнологии. Описаны мыши, содержащие ограниченный локус тяжелой цепи иммуноглобулина. Локус характеризуется единственным полиморфным генным сегментом VH человека, множеством генных сегментов DH человека и множеством генных сегментов JH. Также описаны способы получения последовательности антител, которые связываются с антигеном, предусматривающие иммунизацию мыши представляющим интерес антигеном. Предложенная группа изобретений может быть использована в медицине. 9 н. и 30 з.п. ф-лы, 24 ил., 9 табл., 4 пр.
Наверх