Рекомбинантные однодоменные антитела, специфически связывающие интерлейкин-6 человека, способ их получения и использования для детекции этого белка

Настоящее изобретение относится к области молекулярной иммунологии, биотехнологии и медицины. Предложены рекомбинантные варианты однодоменного антитела (VHH), специфически связывающего интерлейкин-6 (ИЛ-6, IL-6) человека и охарактеризованного аминокислотными последовательностями. Однодоменные антитела по настоящему изобретению получены на основе антиген-распознающих доменов антител ламы (Lama glama). Настоящее изобретение может найти дальнейшее применение в диагностике и терапии ИЛ-6-опосредованных заболеваний. 3 н.п. ф-лы, 4 ил.

 

Область техники, к которой относится изобретение

Изобретение относится к области молекулярной иммунологии, биотехнологии и медицины, а именно к получению рекомбинантных однодоменных наноантител (VHH), избирательно связывающих интерлейкин-6 (ИЛ-6).

Уровень техники

Интерлейкин-6 (ИЛ-6) - мультифункциональный провоспалительный цитокин, обладающий широким спектром иммунорегуляторных свойств, а также являющийся медиатором образования, роста и прогрессии опухолей различной природы и локализации. ИЛ-6 был открыт в 80-х годах в нескольких лабораториях под разными названиями (фактор-2, стимулирующий В-клетки; интерферон - бета-2; фактор роста гибридом; фактор стимуляции гепатоцитов), что отражает плейотропность этого цитокина [Hirano Т. et al., Complementary DNA for a novel human interleukin (BSF-2) that induces В lymphocytes to produce immunoglobulin. Nature, 324: 73-76, 1986. - Комплементарная ДНК для нового человеческого интерлейкина (BSF-2), который индуцирует продукцию иммуноглобулина В-лимфоцитами; Zilberstein A. et al., Structure and expression of cDNA and genes for human interferon-beta-2, a distinct species inducible by growth-stimulatory cytokines. EMBO J. 1986 Oct; 5(10): 2529-37. - Структура и экспрессия кДНК и генов интерферона-бета-2, различные виды индуцируются посредством ростстимулирующих цитокинов; Lansdorp, P. М. et al., A Growth-Factor Dependent B-Cell Hybridoma. Mechanisms in B-Cell Neoplasia. Current Topics in Microbiology and Immunology Volume 132, 1986, pp. 105-113- В клеточная гибридома, зависимая от ростового фактора. Механизмы в В-клеточной неоплазии].

Ген ИЛ-6 человека расположен на коротком плече 7-й хромосомы [Sehgal Р.В. Regulation of IL-6 gene expression. Res. Immunol., 1992. P. 724-734. - Регуляция экспрессии гена ИЛ-6]. ИЛ-6 человека представляет собой гликопротеин с молекулярной массой 26 кДа, состоящий из 184 аминокислот [Yao X. et al., Targeting interleukin-6 in inflammatory autoimmune diseases and cancers. Pharmacol Ther. 2014, 141(2), 125-139. - ИЛ-6 - терапевтическая мишень при воспалительных аутоиммунных и онкологических заболеваниях].

ИЛ-6 продуцируется макрофагами, Т- и В-лимфоцитами, фибробластами, эндотелиальными, эпидермальными и микроглиальными клетками, хондроцитами, остеоцитами, а также некоторыми опухолевыми клетками [Ohsugi Y. Recent advances in immunopathophysiology of interleukin-6: an innovative therapeutic drug, Tocilizumab (recombinant humanized anti-human interleukin-6 receptor antibody), unveils the mysterious etiology of immune-mediated inflammatory diseases. Biol. Pharm. Bull., 2007. P. 2001-2006. - Последние достижения в иммунопатофизиологии интерлейкина-6: инновационное терапевтическое лекарственное средство, Тоцилизумаб (рекомбинантное гуманизированное антитело к человеческому рецептору интерлейкина-6), раскрывает тайну этиологии иммуноопосредованных воспалительных заболеваний].

Биологическая активность ИЛ-6 реализуется посредством взаимодействия с мембранно-связанной субъединицей рецептора, которая не обладает сигнальной функцией с последующей передачей сигнала через трансмембранный гликопротеин gp130. Это классический путь передачи сигнала ИЛ-6 клеткам, экспрессирующим мембранно-связанную субъединицу рецептора ИЛ-6. Существует и альтернативный механизм передачи сигнала, в котором задействована растворимая субъединица рецептора ИЛ-6. Комплекс ИЛ-6 с растворимой субъединицей рецептора ИЛ-6 может активировать клетки, не экспрессирующие мембранно-связанную субъединицу рецептора ИЛ-6, но имеющие на своей поверхности гликопротеин gp130. Такой альтернативный механизм передачи сигнала существенно увеличивает число клеток-мишеней ИЛ-6 [Scheller J., Interleukin-6: from basic biology to selective blockade of pro-inflammatory activities. Semin Immunol. 2014. P. 2-12. - Интерлейкин-6: от основ биологии до селективной блокировки провоспалительной активности; Астраханцева И.В. и др. Современная антицитокиновая терапия аутоиммунных заболеваний. Биохимия, 2014, 79(12), 1607-1618].

ИЛ-6 является одним из ключевых факторов в развитии некоторых аутоиммунных заболеваний, а также некоторых видов неоплазий. Гиперэкспрессия этого цитокина приводит к запуску воспалительного каскада и повреждению тканей клетками иммунной системы. Блокировка ИЛ-6 с помощью рекомбинантных моноклональных антител показала высокую клиническую эффективность и является компонентом терапии ИЛ-6 зависимых заболеваний (ревматоидный артрит, ювенильный идиопатический артрит, болезнь Крона, язвенный колит, множественная миелома, болезнь Кастлемана, злокачественная лимфома, рак почек и др.) [Montero-Julian F.A. Pharmacokinetic study of anti-interleukin-6 (IL-6) therapy with monoclonal antibodies: enhancement of IL-6 clearance by cocktails of anti-IL-6 antibodies. Blood. 1995. P.917-924. - Фармакокинетическое исследование моноклональных антител для анти-ИЛ-6 терапии: усиление клиренса ИЛ-6 с помощью коктейля анти-ИЛ-6 антител; Trikha, M. et al., Targeted anti-interleukin-6 monoclonal antibody therapy for cancer: a review of the rationale and clinical evidence. Clin Cancer Res.; 2003. P. 4653-4665. - Использование моноклональных антител к ИЛ-6 для таргетированной терапии рака: обзор клинических данных; Woodrick, R. and Ruderman, Е.М. Anti-interleukin-6 therapy in rheumatoid arthritis. Bull NYU Hosp Jt Dis. 2010. P.211-217. - Анти-интерлейкин-6 терапия ревматоидного артрита].

Целый ряд рекомбинантных блокаторов ИЛ-6 успешно проходит клинические испытания при лечении аутоиммунных и неопластических заболеваний: агликозилированные, гуманизированные моноклональные антитела к ИЛ-6 Клазакизумаб (ALD518/BMS-945429), человеческие моноклональные антитела к α-субъединице ИЛ6Р Сарилумаб (Sarilumab, SAR15319/1REG), человеческие моноклональные антитела к растворимому ИЛ6 Сирукумаб (Sirukumab, CNTO 136), высокоаффинные моноклональные антитела ИЛ-6, которые блокируют финальный этап сборки комплекса ИЛ6/ИЛ6Р Олокизумаб (Olokizumab, CD6038). Успешно применяется в клинической практике для лечения ревматоидного артрита (при недостаточной эффективности или непереносимости ингибиторов ФИО) рекомбинантное гуманизированное моноклональное антитело к человеческому рецептору ИЛ-6 Тоцилизумаб (Actemra/Актемра).

Основным ограничением к широкому применению анти-ИЛ-6 терапии в Российской Федерации является ее высокая стоимость. Отсутствие на фармацевтическом рынке блокаторов ИЛ-6 отечественного производства приводит к тому, что терапия ингибиторами ИЛ-6 остается недоступной для большинства пациентов.

Примеры блокирующих ИЛ-6 антител широко отражены в международных и российских патентах, например в патенте WO/2010/056948 "Humanized anti-IL-6 antibodies" - «Гуманизированные анти-ИЛ-6 антитела»; в патенте US 8992920 В2 "Anti-IL-6 antibodies for the treatment of arthritis" - Анти-ИЛ-6 антитела для лечения артритов»; в патенте US 8623362 В2 "Anti-IL-6 antibodies" - «Анти-ИЛ-6 антитела»; в патенте RU 2550262 «Моноклональное антитело против интерлейкина-6 человека и гибридома, продуцирующая данное моноклональное антитело», в патенте RU 2532826 «Гуманизированные антитела против IL-6».

В качестве ближайшего аналога технического решения, составляющего основу настоящего изобретения, можно привести следующий пример.

Патент WO/2010/056948 "Humanized anti-IL-6 antibodies" - "Гуманизированные анти-ИЛ-6 антитела».

В данном патенте заявлено получение моноклональных гуманизированных антител против ИЛ-6. Данное техническое решение, как наиболее близкое к заявляемому по составу действующего вещества и способу его использования, выбрано авторами настоящего изобретения за прототип.

Недостатками прототипа являются:

- Относительно дорогостоящее производство антител, высокие требования к условиям культивирования и качеству используемых реактивов, сложность поддержания и хранения продуцента.

- Относительно большой размер получаемых антител, что обуславливает пониженную проницаемость тканей.

- Структурные особенности антител накладывают ограничение на узнавание некоторых «скрытых» эпитопов, находящихся, например, в углублениях, щелях малого размера в структуре белков.

- Ограниченность и относительная трудоемкость генно-инженерных манипуляций, адаптаций для конкретных задач, сложность создания многовалентных и многофункциональных производных заявленных антител.

Таким образом, существует потребность в разработке новых антител (антиген-узнающих молекул), лишенных указанных выше недостатков и специфически узнающих ИЛ-6.

Раскрытие изобретения

Задачей, на решение которой направлено заявляемое изобретение, является создание новых антител, способных специфически связываться с ИЛ-6 человека, не оказывая существенного влияния на его функционирование, получение этих антител, производство и хранение которых должно быть экономичным. Новые антитела должны быть эффективны и относительно просты; их размер должен быть в несколько раз меньше, чем у классических антител. Такие антитела в перспективе могут найти применение в биоинженерии молекулярных сенсоров ИЛ-6, которые позволят проводить системный и локальный мониторинг уровня ИЛ-6 в живых системах.

При этом способ получения однодоменных антител к белку ИЛ-6 включает в себя иммунизацию ламы (Lama glama) рекомбинантным аффинноочищенным ИЛ-6 человека, клонирование всего репертуара кДНК-последовательностей антиген-узнающих доменов антител ламы в фагмидный вектор, селекцию библиотеки последовательностей, кодирующих однодоменные антитела, специфически связывающиеся с рекомбинантным белком ИЛ-6, с помощью метода фагового дисплея, продукцию антител в бактериальной системе экспрессии и последующую очистку.

В основе настоящего изобретения находятся не классические бивалентные антитела, которые рассматриваются в качестве прототипа, а малые однодоменные антитела, которые имеют ряд преимуществ, что позволяет предполагать большой потенциал их будущего использования в различных исследованиях и при создании новых биотехнологических устройств, а также в клинических целях для диагностики и лечения заболеваний. Поскольку однодоменные антитела (молекулярная масса около 12-15 кДа) на порядок меньше по размеру традиционных классических антител, они приобретают ряд новых положительных качеств, имеющих практическую значимость. Однодоменные антитела могут обладать новыми структурными особенностями, в принципе позволяющими им узнавать некоторые «скрытые» для обычных антител эпитопы.

Способ получения однодоменных антител, связывающих антигенные эпитопы белка ИЛ-6 человека, включает следующие принципиальные этапы:

1) индукция образования специфических антител в результате иммунизации ламы рекомбинантным белком ИЛ-6;

2) клонирование последовательностей антиген-узнающих доменов особых одноцепочечных антител, синтезирующихся в лимфоцитах иммунизированного животного, в фагмидном векторе (использующимся в последующей процедуре фагового дисплея), получение специфически обогащенной библиотеки последовательностей, кодирующих наноантитела;

3) селекция методом фагового дисплея клонов наноантител, связывающихся с заданным антигеном, белком ИЛ-6, из полученной библиотеки антител;

4) проведение переклонирования и генно-инженерных модификаций кодирующих последовательностей отобранных наноантител с целью их эффективной наработки в бактериальной системе экспрессии и последующей эффективной очистки (в качестве продуцента действующего вещества используются бактерии E.coli).

В качестве антигена для иммунизации и селекции использовали рекомбинантный белок ИЛ-6, наработанный в бактериях E.coli. Колонии E.coli штамм BL21-DE3-pLysS были трансформированы экспрессионным вектором pRSET, содержащим кДНК ИЛ-6 человека. Экспрессию гена и выделение белка проводили по ранее описанному протоколу [van Dam et al. Structure-function analysis of interleukin-6 utilizing human/murine chimeric molecules. Involvement of two separate domains in receptor binding. J Biol Chem 1993, 268(20), 15285-15290. - Структурно-функциональный анализ интерлейкина-6, используя человеческие/мышиные химерные молекулы. Участие двух отдельных доменов в связывании рецептора]. Чистота рекомбинантного белка ИЛ-6 составляла более 95%. Чистоту белка ИЛ-6 проверяли с помощью денатурирующего электрофореза в ПААГ и гель-фильтрации (Описанный рекомбинантный белок был любезно предоставлен проф. Rose-John S., Department of Biochemistry, University of Kiel, Germany).

Способ получения однодоменных антител описан в примерах 1 и 2. Возможность использования полученных антител для детекции белка ИЛ-6 и их функциональные характеристики показаны в примерах 3-5.

Краткое описание чертежей

Фиг. 1. Очищенные форматированные однодоменные антитела, специфически узнающие белок ИЛ-6 человека, фракционированные в 14% SDS-полиакриламидном геле.

Фиг. 2. Результаты иммуноферментного анализа узнавания рекомбинантного белка ИЛ-6 человека, иммобилизованного в лунках иммунологической плашки, отобранными тремя однодоменными форматированными антителами (обозначены в нижней части рисунка под номером от 1 до 3). Контрольные лунки не содержали антиген, но далее были блокированы и процессированы параллельно с экспериментальными ячейками (с антигеном). Ось ординат соответствует данным поглощения в экспериментальных ячейках при длине волны 405 нм. Представлены усредненные результаты трех повторов данного анализа (с указанными диапазонами разброса полученных значений).

Фиг. 3. Измерение константы связывания и диссоциации однодоменных антител к ИЛ-6 с рекомбинантным белком ИЛ-6 человека методом поверхностного-плазмонного резонанса. На рисунке показаны сенсограммы, полученные в результате 5 взаимодействий для каждого из антител. Результаты анализировались с помощью ProteOn Manager Software (Bio-Rad) с использованием модели Ленгмюра.

Фиг. 4. Отобранные однодоменные антитела (VHH 44, VHH 87) не влияют на пролиферацию клеток, зависимую от IL-6. Для третьего антитела (VHH 49) данные были аналогичны (не показано). Клеточную линию Ba/F3-gp130-hIL-6R стимулировали рекомбинатным IL-6 человека (10 нг/мл) в присутствии различных концентраций анти-IL-6 антител. Пролиферативную активность оценивали с помощью МТТ-теста. Активность МТТ в присутствии IL-6 без ингибитора была принята за 100%. В качестве положительного контроля использовали коммерческие анти- hIL-6 антитела (MQ2-13A5, eBioscience), которые блокируют IL-6 и подавляют пролиферацию клеток.

Осуществление настоящего изобретения

Пример 1. Получение библиотеки вариабельных доменов одноцепочечных антител.

Для генерирования in vivo однодоменных антител, специфически узнающих белок ИЛ-6, была проведена иммунизация ламы (Lama glama).

В качестве антигена для иммунизации использовали специально синтезированный для этой цели рекомбинантный белок ИЛ-6, который был экспрессирован в прокариотической системе. Препарат рекомбинантного белка ИЛ-6 разделили на 6 равных частей по 0,5 мг (первые 5 частей - для 5 последовательных инъекций, а также оставили аликвоту для последующих этапов селекции и анализа заданных наноантител). Все аликвоты замораживали для хранения при -70°С. Перед проведением каждого этапа иммунизации одну из хранящихся при -70°С аликвот препарата размораживали и непосредственно перед инъекцией смешивали в равных пропорциях с адъювантом LQ (фирмы Gerbu, Heidelberg, Германия). Перед 1-й иммунизацией от ламы отбирали кровь для получения преиммунной сыворотки, которая впоследствии использовалась в качестве негативного контроля. Пятикратную иммунизацию проводили путем подкожных инъекций рекомбинантного белка ИЛ-6 человека, смешанного в равных пропорциях с адъювантом. Вторую иммунизацию проводили через 4 недели после первой, а последующие 3 с интервалом 10 дней. Заключительное взятие крови проводили через 5 дней после последней иммунизации. Для предотвращения свертывания взятой крови добавляли 50 мл стандартного фосфатно-солевого раствора (PBS), содержащего гепарин (50 ед./мл) и ЭДТА (2 мМ).

Кровь разводили в 2 раза раствором PBS, содержащим 1 мМ ЭДТА. 35 мл разбавленного раствора крови наслаивали на ступеньку специальной среды (Histopaque-1077, Sigma) с плотностью 1,077 г/мл объемом 15 мл и проводили центрифугирование в течение 20 мин при 800×g. Мононуклеарные клетки (лимфоциты и моноциты) отбирали из интерфазной зоны плазма/Histopaque, после чего промывали раствором PBS, содержащим 1 мМ ЭДТА.

Суммарную РНК из В-лимфоцитов выделяли с помощью реагента TRIzol (Invitrogen). Затем на колонке с олиго(dT)-целлюлозой из тотальной РНК очищали поли(А)-содержащую РНК. Концентрацию РНК определяли с помощью биофотометра (Eppendorf) и проверяли качество выделенной РНК с помощью электрофореза в 1,5%-ном агарозном геле с формальдегидом.

Реакцию обратной транскрипции проводили по стандартному протоколу [Sambrook et al., 1989] с использованием обратной транскриптазы HM-MuLV и праймера олиго(dT)15 в качестве затравки.

Продукты обратной транскрипции использовали в качестве матрицы в двухступенчатой полимеразной цепной реакции и полученные продукты амплификации клонировали по сайтам Ncol(Pstl) и NotI в плазмидный вектор pHEN4, как описано ранее [Hamers-Casterman С. et al. Naturally occurring antibodies devoid of light chains, Nature, 1993; 363: 446-448. - Существующие в природе антитела без легких цепей. Nguyen V.K. et al. Functional heavy-chain antibodies in camelidae. Adv. Immunol., 2001, 79, 261-296. - Функциональные антитела, состоящие только из тяжелых цепей, у Верблюдовых. Saerens D. et al. Single domain antibodies derived from dromedary lymph node and peripheral blood lymphocytes sensing conformational variants of prostate-specific antigen. J. Biol. Chem., 2004, 279, 51965-51972. - Однодоменные антитела, полученные из лимфатического узла или лимфоцитов периферической крови верблюда, распознают конформационные варианты простата-специфического антигена. Rothbauer U. et al. Targeting and tracing antigens in live cells with fluorescent nanobodies. Nature Methods., 2006, 3, 887-889. - Таргетирование и наблюдение антигенов в живых клетках с помощью флуоресцентных нанотел].

Пример 2. Селекция однодоменных антител, специфически узнающих ИЛ-6. Селекцию однодоменных антител проводили методом фагового дисплея с использованием рекомбинантного белка ИЛ-6, иммобилизованного на дне лунок 96-луночного ИФА-планшета. Использовали полистироловые иммунологические плашки с высокой сорбцией MICROLON 600 (Greiner Bio-One). Для блокировки использовали 1% БСА (Sigma-Aldrich, США) и/или 1% обезжиренное молоко (Bio-Rad, США) в PBS. Процедуру селекции и последующей амплификации отбираемых фаговых частиц повторяли последовательно три раза. Все манипуляции проводили, как описано в публикациях [Тиллиб C.B. и др. Фингерпринтный анализ селекции «наноантител» методом фагового дисплея с использованием двух вариантов фагов-помощников. Acta Natura, 2010, 2 (3), 100-108. Hamers-Casterman С. et al. Naturally occurring antibodies devoid of light chains, Nature, 1993; 363, 446-448. - Существующие в природе антитела без легких цепей. Nguyen V.K. et al. Functional heavy-chain antibodies in camelidae. Adv. Immunol., 2001, 79, 261-296. - Функциональные антитела, состоящие только из тяжелых цепей, у Верблюдовых. Saerens D. et al. Single domain antibodies derived from dromedary lymph node and peripheral blood lymphocytes sensing conformational variants of prostate-specific antigen. J. Biol. Chem., 2004, 279, 51965-51972. - Однодоменные антитела, полученные из лимфатического узла или лимфоцитов периферической крови верблюда, распознают конформационные варианты простата-специфического антигена]. Последовательности клонов отобранных антител группировали по схожести их фингерпринтов, получаемых при электрофоретическом разделении продуктов гидролиза амплифицированных последовательностей однодоменных антител параллельно тремя частощепящими рестрикционными эндонуклеазами (Hinfl, Mspl, Rsal). Были определены последовательности кДНК однодоменных антител к ИЛ-6. Из них были выведены соответствующие аминокислотные последовательности 3 клонов антител к ИЛ-6: SEQ ID NO: 1 (VHH 44); SEQ ID NO: 2 (VHH 49) и SEQ ID NO: 3 (VHH 87).

Продукция наноантител

Последовательности кДНК 3 отобранных клонов наноантител переклонировали в экспрессионный модифицированный плазмидный вектор pHEN6 [Conrath K.Е. et al. Betalactamase inhibitors derived from single-domain antibody fragments elicited in the Camelidae. Antimicrob Agents Chemother., 2001, 45, 2807-2812. - Ингибиторы бета-лактамазы, выделенные из однодоменных фрагментов антител Верблюдовых], позволяющий присоединение к С-концу однодоменного нано-антитела (His)6-эпитопа. Благодаря наличию на N-конце экспрессируемой последовательности сигнального пептида (peIB) нарабатываемый рекомбинантный белок (однодоменное наноантитело) накапливается в периплазме бактерий, что позволяет эффективно его выделять методом осмотического шока, не разрушая собственно бактериальные клетки. Продукцию однодоменных антител проводили в Е.coli (штамм BL21). Экспрессию индуцировали добавлением 1 мМ индолил-бета-О-галактопиранозида и клетки инкубировали при интенсивном перемешивании в течение 7 часов при 37°С или в течение ночи при 29°С. Однодоменное антитело выделяли из периплазматического экстракта с использованием аффинной хроматографии на Ni-NTA-агарозе с использованием системы для очистки QIAExpressionist (QIAGEN, США).

На ФИГ. 1 представлена электрофореграмма полиакриламидного геля с наработанными и очищенными однодоменными антителами (одАТ), специфически узнающими ИЛ-6 человека.

Структура трех однодоменных антител к ИЛ-6 приведена в разделе «Перечень последовательностей». В указанных последовательностях выделены и подчеркнуты гипервариабельные участки CDR1, CDR2 и CDR3 (соответственно, слева направо, от N- к С-концу).

Пример 3. Детекция рекомбинантного белка ИЛ-6 с помощью отобранных клонов однодоменных антител

Полученный в результате описанной процедуры периплазматический экстракт, содержащий мини-антитело с НА-тагом, использовали для оценки специфичности и эффективности связывания соответствующего мини-антитела с препаратом рекомбинантного белка-антигена с помощью метода иммунофлуоресцентного анализа.

В ячейки стандартной 96-луночной иммунологической плашки (из полистирола, Microlon 600 hi-binding, фирмы Greiner bio-one) наносили в объеме 50 мкл разбавленный (в PBS) до концентрации примерно 2 мкг/мл рекомбинантный белок ИЛ-6. Иммобилизацию проводили в течение ночи при +4°С. Затем ячейки отмывали (в PBS) от несвязавшегося антигена и блокировали лунки раствором 1% бычьего сывороточного альбумина (БСА) в PBS в течение 2 часов при комнатной температуре. Ячейки отмывали в PBS и PBS с 0.05% Твеен-20, после чего добавляли проверяемые однодоменные форматированные антитела, содержащие НА-таг на С-конце, в количестве примерно 500 нг в 50 мкл PBS, содержащим 0,1% БСА. После инкубации (при перемешивании) в течение 2 часов при комнатной температуре ячейки вновь отмывали, как описано выше, и затем инкубировали с разведенными в 2000 раз (в PBS с 0.1% БСА) вторичными антителами цыпленка к НА-тагу, конъюгированными с пероксидазой хрена (CHGT-45P-Z, ICL, Inc., USA). Инкубацию проводили в течение 1 часа при комнатной температуре. После тщательной отмывки проводили детекцию активности фермента пероксидазы хрена, используя в качестве хромогенного субстрата ABTS (2,2′-азино-бис 3-этилбензотиазолин-6-сульфонат). Оптическую плотность измеряли при длине волны 405 нм с помощью планшетного флюориметра. Контрольные лунки не содержали антиген, но далее были блокированы и процессированы параллельно с экспериментальными ячейками (с антигеном).

На ФИГ. 2 представлены результаты иммуноферментного анализа, из которых следует, что все изучаемые клоны однодоменных антител специфически связываются с рекомбинантным белком ИЛ-6. Величина столбцов на рисунке соответствует относительным величинам поглощения при длине волны 405 нм, количественно отражающим эффективность связывания наноантитела с ИЛ-6.

Пример 4. Измерение константы связывания и диссоциации однодоменных антител против ИЛ-6 с рекомбинантным белком ИЛ-6 методом поверхностного-плазмонного резонанса.

Измерения кинетики связывания: скорости ассоциации, скорости диссоциации и константы диссоциации однодоменных антител с рекомбинантным белком ИЛ-6 проводились с помощью прибора поверхностного плазмонного резонанса Proteon XPR36 (Bio-Rad). Измерения проводились при 20°С в качестве буфера использовался фосфатно-солевой буфер рН 7.4, 0.005% Tween 20.

Для этого препарат рекомбинантного ИЛ-6 человека в ацетатном буфере (рН=5.0) был иммобилизован на GLM-чипе (Bio-Rad) (на этом чипе поверх слоя золота, в котором происходит эффект поверхностного плазмонного резонанса, нанесен слой полимера альгиновой кислоты, содержащий свободные карбоксильные группы) в концентрации 1 мкг/мл. Перед иммобилизацией поверхность чипа была активирована смесью 1-Этил-3-(3-диметиламинопропил) карбодиимида в концентрации 6.66 мМ и N-Гидроксисукцинимида в концентрации 1.33 мМ в течение 30 с при скорости потока 30 мкл/мин. Препарат рекомбинантного ИЛ-6 человека наносился в вертикальной ориентации в два этапа 100 с и 300 с при скорости 30 мкл/мин. Оставшиеся свободными карбоксильные группы были инактивированы этаноламином. Суммарный уровень иммобилизации составил 800 RU. После промывки фосфатно-солевым буфером, содержащим 0.005% Tween (100 мкл/мин, 660 с) ориентация была изменена на горизонтальную. Затем была проведена дополнительная промывка фосфатно-солевым буфером (100 мкл/мин, объем 100 мкл, диссоциация 600 с), после чего установилась базовая линия. Затем также в горизонтальной ориентации был нанесен препарат однодоменных антител против IL-6 в фосфатно-солевом буфере в двукратно убывающих концентрациях 200 - 12.5 нМ в течение 245 с при скорости 100 мкл/мин. Диссоциация измерялась в течение 2000 с. Сенсограммы, полученные в результате 5 взаимодействий для каждого из антитела, анализировались с помощью ProteOn Manager Software (Bio-Rad) с использованием модели Ленгмюра.

На ФИГ. 3 представлены кривые взаимодействия (сенсограммы), полученные в результате 5 взаимодействий с рекомбинантным ИЛ-6 для каждого из антител.

Представленные данные демонстрируют, что константы связывания и диссоциации у однодоменных антител VHH 49 и VHH 87 заметно отличаются от VHH 44, что возможно, обусловлено узнаванием этими антителами менее доступного (при используемом способе иммобилизации антигена) эпитопа ИЛ-6. Однако опыты по сравнительному параллельному связыванию всех трех антител с иммобилизованным антигеном в ИФА указывают на сравнимую силу связывания антигена для всех трех вариантов антител.

Пример 5. Определение способности однодоменных антител нейтрализовать биологическую активность ИЛ-6 человека.

Анализ возможной нейтрализующей активности полученных антител определяли по блокировке клеточной пролиферации на ИЛ-6-зависимой клеточной линии Ba/F3-gp130-hIL-6R в присутствии 10 нг/мл рекомбинатного ИЛ-6 человека. В результате проведенных исследований было установлено, что однодоменные антитела VHH 44, VHH 49, VHH 87 не блокируют биологическую активность IL-6 человека (ФИГ.4). Данный факт свидетельствует о способности однодоменных антител узнавать «скрытые» для классических антител эпитопы белка.

Приведенные примеры с фигурами доказывают выполнение поставленной данным изобретением задачи, а именно создание новых однодоменных антител, способных эффективно связывать ИЛ-6 человека. Эти антитела обладают следующими преимуществами по отношению к прототипу (моноклональные гуманизированные антитела против ИЛ-6 человека): их получение, производство и хранение более экономично, эффективно и относительно просто; их получение включает стадию иммунизации и аффинного дозревания in vivo, что обычно способствует более высокой аффинности и существенному повышению эффективности селекции заданных однодоменных антител, они хорошо растворимы, обладают новыми структурными особенностями, позволяющими им потенциально узнавать некоторые «скрытые» для обычных антител эпитопы. Поскольку эти антитела не нейтрализуют биологическую активность ИЛ-6 человека, при их использовании не будет искажаться баланс, связанный с эффектами этого цитокина. Антитела VHH44, VHH49, VHH87 представляют собой антиген-связывающие модули, подходящие для создания молекулярных сенсоров ИЛ-6, что в будущем позволит проводить системный и локальный мониторинг уровня ИЛ-6 in vivo.

Таким образом, задача, поставленная в данном изобретении, решена.

Перечень последовательностей

Аминокислотные последовательности трёх отобранных однодоменных антител (наноантител), способных специфически связывать белок IL-6 человека. В указанных последовательностях выделены и подчеркнуты гипервариабельные участки CDR1, CDR2 и CDR3 (соответственно, слева направо, от N- к С-концу). Ниже указана дополнительная последовательность (*), содержащая линейный линкерный участок, а также последовательности НА-тага и His-тага, добавляемая (в результате «форматирования») на С-конец кодирующей последовательности исходно отбираемого клона антитела с целью его более эффективной очистки и детекции.

SEQ ID NO: 1

Malqevqlvesggglvqpggslrlscaas gniariavmg wyrqapgkqrelva hifsggntiyvdsvkg

rftisranaqntvylqmnslkpedtavyyc narvvtsgtyny wgqgtqvtvss

SEQ ID NO: 2

Malqevqlvesggglvqaggslrlscaas gsirsiirma wyrqapgkrrelva hiisggstnvadsvkg

rftisrdgakntvhlqmnslkpedtaiyyc nvrdlysttyey wgqgtqvtvss

SEQ ID NO: 3

Malqevqlvesggglvqaggslrlscaas gtirsiirva wyrqapgkqrelva hiisggstgyadsvkg

rftisrdgakntvylqmnslkpedtaiyyc nvrdlystsyey wgrgtqvtvss

*epkipqpqpkpqpqpqpqpkpqpkpepesgrypydvpdyasgrgshhhhhh

1. Рекомбинантное однодоменное антитело, специфически связывающее ИЛ-6 человека и имеющее аминокислотную последовательность SEQ ID NO: 1.

2. Рекомбинантное однодоменное антитело, специфически связывающее ИЛ-6 человека и имеющее аминокислотную последовательность SEQ ID NO: 2.

3. Рекомбинантное однодоменное антитело, специфически связывающее ИЛ-6 человека и имеющее аминокислотную последовательность SEQ ID NO: 3.



 

Похожие патенты:

Данное изобретение относится к области иммунологии. Представлены моноклональное антитело и его фрагмент, которые связываются с K11-связанным полиубиквитином, охарактеризованные аминокислотными последовательностями гипервариабельных участков (HVR).

Изобретение относится к области иммунологии. Предложен способ скрининга молекулы, способной связываться с Ig-подобным доменом С2-типа 1 CD4 человека, а именно с аминокислотными остатками в положениях 148-154, 164-168 и 185-192.

Настоящее изобретение относится к области биотехнологии и иммунологии. Предложен способ получения полиспецифичного антитела, включающего полноразмерное антитело, специфически связывающееся с первым антигеном и состоящее из двух тяжелых цепей антитела и двух легких цепей антитела, и один или несколько одноцепочечных фрагментов Fab, связывающихся с одним или несколькими дополнительными антигенами, в котором указанные одноцепочечные Fab-фрагменты соединены с указанным полноразмерным антителом через пептидный коннектор с С-конца тяжелой или легкой цепи указанного полноразмерного антитела, причем пептидный коннектор имеет структуру (GxS)n или (GxS)Gm, где G = глицин, S = серин, и (х = 3, n = 3, 4, 5 или 6 и m = 0, 1, 2 или 3) или (х = 4, n = 2, 3, 4 или 5 и m = 0, 1, 2 или 3).

Изобретение относится к области биохимии, в частности к биспецифическому двухвалентному антителу, которое специфично связывается с фактором роста эндотелия сосудов человека (VEGF) и с ангиопоэтина-2 человека (ANG-2).

Настоящее изобретение относится к области иммунологии. Предложено выделенное антитело и его антигенсвязывающий фрагмент, которые специфически связываются с индуцируемым глюкокортикоидами рецептором TNF (GITR) человека; а также композиции, в том числе фармацевтическая композиция, и способ усиления иммунного ответа у человека.

Изобретение относится к области биохимии, в частности к антителу против TNF(фактор некроза опухоли)-α или анти-TNF-α-связывающему фрагменту антитела. Также раскрыта фармацевтическая композиция для лечения патологий и заболеваний, связанных с TNF-α, содержащая терапевтически эффективное количество вышеуказанного антитела или его фрагмент.

Изобретение относится к области биохимии. Заявлено антитело, связывающееся с рецептором клеточной поверхности DR5.

Изобретение относится к биотехнологии. Предложено выделенное антитело, которое специфически связывается по меньшей мере с одним из собачьего интерлейкина-31 (IL-31) или кошачьего IL-31.

Настоящее изобретение относится к области иммунологии. Предложено выделенное биспецифическое антитело, которое связывается с двумя различными областями белка 6 рецептора липопротеинов низкой плотности (LRP6).

Данное изобретение относится к области иммунологии. Предложено выделенное моноклональное антитело к FcRH5 человека, охарактеризованное последовательностями гипервариабельных участков (HVR), и его антигенсвязывающий фрагмент.

Изобретение относится к области биотехнологии и иммунологии. Описаны антитела, которые специфически связываются с Р-селектином, блокируют связывание PSGL-1 с Р-селектином и вызывают диссоциацию ранее образовавшихся комплексов Р-селектин/PSGL-1.

Изобретение относится к области биотехнологии и иммунологии. Описан способ выделения и очистки антител против IL-13, где использование стадии аффинной хроматографии приводит к получению, по существу, чистой композиции антитела для фармацевтического применения.

Изобретение относится к области биохимии. Заявлено выделенное IL-17-связывающее антитело.

Изобретение относится к области биохимии, в частности к антителу против TNF(фактор некроза опухоли)-α или анти-TNF-α-связывающему фрагменту антитела. Также раскрыта фармацевтическая композиция для лечения патологий и заболеваний, связанных с TNF-α, содержащая терапевтически эффективное количество вышеуказанного антитела или его фрагмент.

Изобретение относится к биотехнологии. Предложено выделенное антитело, которое специфически связывается по меньшей мере с одним из собачьего интерлейкина-31 (IL-31) или кошачьего IL-31.

Изобретение относится к области биохимии. Представлено гуманизированное антитело или его фрагмент, способные связываться с интерлейкином-10 (IL-10).

Изобретение относится к области биохимии. Представлены варианты гуманизированного или химерного антитела или его фрагмента, способные связываться с интерлейкином-10 (IL-10), где указанное антитело или его фрагмент можно вводить субъекту в отсутствие неприемлемого повышения уровня провоспалительных цитокинов.

Изобретение относится к области биотехнологии и иммунологии. Раскрыт стабильный водный препарат, включающий антитело или его фрагмент, которые специфично связываются с α-интерфероном человека.

Настоящее изобретение относится к области иммунологии. Предложено моноклональное антитело и его антигенсвязывающий фрагмент, обладающие способностью специфически связываться с IL-17А человека и охарактеризованные последовательностями CDR.

Настоящее изобретение относится к области иммунологии. Предложены моноклональное антитело, которое связывается с по меньшей мере тремя CC-хемокинами, такими как RANTES/CCL5, MIP-1α/CCL3 или MIP-1β/CCL4, и его антигенсвязывающий фрагмент.

Изобретение относится к области биохимии. Представлены варианты моноклонального антитела против CD52 человека. Также представлены выделенные нуклеиновые кислоты и рекомбинантные векторы экспрессии, кодирующие антитело или легкую цепь или тяжелую цепь антитела против CD52 человека, клетки-хозяева, а также способ получения указанного антитела. Антитела против CD52 человека могут использоваться в терапевтических целях для лечения, например, аутоиммунного заболевания, рака, неходжкинской лимфомы, рассеянного склероза и хронического лимфоцитарного лейкоза. Изобретение позволяет повысить антителозависимую клеточно-опосредованную цитотоксичность антител к CD52 человека. 19 н. и 26 з.п. ф-лы, 246 ил., 29 табл., 70 пр.
Наверх