Варианты плазминогена и плазмина

Изобретение относится к области биотехнологии и может быть использовано для получения вариантов плазминогена и плазмина. Получают вариант плазминогена, содержащий в своем каталитическом домене замену глутаминовой кислоты на глутамин в положении 138 каталитического домена плазмина человека или в положении, соответствующем таковому в каталитическом домене плазмина, отличного от плазмина человека, где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека с SEQ ID NO: 1. При этом указанный вариант плазминогена может также содержать замену лизина на глутаминовую кислоту или гистидин в положении 147 и/или замену аргинина на гистидин в положении 158 каталитического домена плазмина человека. Изобретение позволяет получить аутопротеолитически стабильный вариант плазмина. 12 н. и 11 з.п. ф-лы, 14 ил., 2 табл., 2 пр.

 

Область изобретения

Настоящее изобретение относится к вариантам плазминогена и плазмина, содержащим одну или несколько точечных мутаций в каталитическом домене, которые снижают или предотвращают аутокаталитическую потерю протеазной активности плазмина. Также раскрыты композиции, применения и способы применения указанных вариантов плазминогена и плазмина.

Предпосылки настоящего изобретения

Активация зимогена плазминогена приводит к образованию фибринолитически/тромболитически активной сериновой протеиназы - плазмина. Активация эндогенного плазминогена может быть запущена или усилена введением активатора плазминогена, такого как урокиназа, стрептокиназа, стафилокиназа или tPA, или любого их варианта. При активации белок-плазминоген протеолитически расщепляется до тяжелой цепи, содержащей 5 доменов “двойная петля”, и легкой цепи, содержащей каталитический домен. Обе цепи удерживаются вместе посредством 2 дисульфидных связей. После активации в результате аутолитического расщепления происходит удаление N-концевого сегмента из тяжелой цепи (78 аминокислот плазмина человека; 77 аминокислот бычьего плазмина), и тяжелая цепь бычьего плазмина может быть дополнительно аутокаталитически расщеплена между доменами “двойная петля” 3 и 4, таким образом давая в результате бычий мидиплазмин (Christensen et al. 1995, Biochem J 305, 97-102). Активация плазминогена до плазмина, запущенная с помощью расщепления пептидной связи R561-V562 в плазминогене человека, вызывает большое конформационное изменение в легкой цепи, причем указанное изменение приводит к стимуляции или активации каталитической триады внутри указанной легкой цепи. Бактериальные активаторы плазминогена, такие как стрептокиназа и стафилокиназа, формируют комплекс с плазминогеном, и без расщепления пептидной связи R561-V562 плазминогена каталитический сайт плазминогена активируется посредством конформационных изменений при образовании комплекса активатор-плазминоген (механизмы активации плазминогена подытожены, например, в разделе Введение Terzyan et al. 2004; Proteins 56: 277-284).

Поскольку активаторы плазминогена действуют как непрямые тромболитические средства, то альтернативно было предложено применение плазмина самого по себе в качестве непосредственного фибринолитического/тромболитического средства. Такое непосредственное применение, однако, затрудняется из-за того факта, что плазмин, подобно многим протеазам, подвергается аутокаталитическому протеолитическому распаду, который характеризуется кинетикой уравнения реакции второго порядка при условии ингибирования продукта (Jespersen et al. 1986, Thrombosis Research 41, 395-404).

В начале 1960-х было установлено, что плазмин может быть стабилизирован в кислом pH, или, альтернативно, в нейтральном pH, при условии присутствия аминокислоты, такой как лизин. Тем не менее, сообщалось, что имело место аутолитическое расщепление после Lys104, Arg189 и Lys622 (нумерация относительно Lys-плазмина) даже если плазмин хранили при pH 3,8 (WO 01/36608). При хранении плазмина при еще более низком pH, равном 2,2, неаутолитическое кислотное расщепление происходит между Asp-Pro (D-P) в положениях Asp62, Asp154 и Asp346 (WO 01/36608). Это иллюстрирует, что pH может быть понижен до точки, где больше не возникает очевидный аутокаталитический распад, но в которой кислотный гидролиз становится фактором дестабилизации. Отсутствует информация в WO 01/36608 в отношении того, что пептидные связи в плазмине являются чувствительными к (аутокаталитическому) гидролизу при нейтральном pH. Известные стабилизаторы плазмина включают глицерин, достаточно высокую ионную силу, фибриноген и ε-аминокапроновую кислоту (EACA), как раскрывается Jespersen et al. (1986, Thromb Res 41, 395-404). Лизин и лизиновые производные (такие как EACA и транексамовая кислота) и p-аминометилбензойная кислота (PAMBA) являются некоторыми дополнительными известными стабилизаторами (Uehsima et al. 1996, Clin Chim Acta 245, 7-18; Verstraete 1985, Drugs 29, 236-261). В патенте США №4462980 сообщалось об образовании плазминовых агрегатов, которые вносили свой вклад в распад плазмина, несмотря на хранение в кислотных условиях. Решение этой проблемы было представлено в патенте США №4462980 посредством добавления полигидроксидного соединения. Другие пути стабилизации плазмина включают добавление олигопептидных соединений (например, патент США №5879923). Альтернативно, каталитический сайт плазмина может быть обратимо блокирован посредством дериватизации, например, ацилирования (европейский патент №EP 0009879). В качестве средства стабилизации фермента также было предложено пегилирование плазмина (WO 93/15189).

Описан ряд вариантов плазмина, отличных от процессированных форм плазмина, и он включает химерный микроплазмин (WO 2004/045558) и варианты с точечной мутацией в сайте расщепления двух цепей (патент США №5087572) или в аминокислоте каталитической триады (Mhashilkar et al. 1993, Proc Natl Acad Sci USA 90, 5374-5377; Wang et al., 2001, J Mol Biol 295, 903-914). Wang et al. (1995, Protein Science 4, 1758-1767 and 1768-1779) сообщали о широком ряде мутантов микроплазминогена по аминокислотным положениям 545, 548, 550, 555, 556, 558, 560-564, 585, 740 и 788. Двойной мутант, где цистеины в аминокислотных положениях 558 и 566 были заменены на серины, описан Linde et al. (1998, Eur J Biochem 251, 472-479). Takeda-Shitaka et al. (1999, Chem Pharm Bull 47, 322-328) приводят вариант плазмина с уменьшенной активностью, где изменение включает замену аланина в аминокислотном положении 601 на треонин. Все приведенные выше аминокислотные положения считаются относительно Glu-плазминогена, начиная с Glu в аминокислотном положении 1. Нерасщепляемый вариант плазминогена (расщепление между тяжелой и легкой цепью нарушено) описан в WO 91/08297. Dawson et al. (1994, Biochemistry 33, 12042-12047) описывают уменьшенную аффинность для стрептокиназы варианта Glu-плазминогена с Glu вместо Arg в положении 719 (R719E). Jespers et al. (1998, Biochemistry 37, 6380-6386) получили при сканировании по Ala ряд полученных с помощью фагового дисплея моносайтовых мутантов микроплазминогена H569A, R610A, K615A, D660A, Y672A, R712A, R719A, T782A, R789A и обнаружили, что аргинин в положении 719 является ключевым для взаимодействия со стафилокиназой; мутант D660A не был дополнительно охарактеризован из-за очень низкой экспрессии; только мутант R719A был дополнительно получен в растворимой форме. Ни один из мутантов не показал существенного изменения в протеолитической активности (субстрат S-2403). Jespers et al. (1998) также включили в их анализ мутанта с активным сайтом S741A; кристаллическая структура этого мутанта раскрыта в Wang et al. (2000, J Mol Biol 295, 903-914). В дальнейших попытках обнаружить сайты взаимодействия стрептокиназа/плазминоген, Terzyan et al. (2004, Proteins 56, 277-284) сообщали о ряде мутантов микроплазминогена (K698M, D740N, S741A) в уже мутированном окружении (R561A), последнее подавляло протеолитическую активацию плазминогена и, таким образом, подавляло образование активного микроплазмина (что будет затруднять изучение механизма контакт-активации комплекса стрептокиназа-микроплазминоген). Terzyan et al. (2004) дополнительно упоминают “произвольный” тройной мутант R561A/H569Y/K698M, функционально очевидно не отличающийся от двойного мутанта R561A/K698M. Wang et al. (2000, Eur J Biochem 267, 3994-4001) при изучении взаимодействия стрептокиназа/плазмин(плазминоген) получили набор мутантов микроплазминогена (аминокислоты 530-791 Glu-плазминогена) в Cys536Ala и Cys541Ser окружении. Эти мутанты включают мутацию R561A, которая описана выше (Terzyan et al. (2004)), а также двойные мутанты R561A/K698G, R561A/K698A и R561A/K698Q. В такое же C536A/C541S окружении были введены также отдельные мутации K698G и K698A, из которых K698G не была в дальнейшем охарактеризована из-за трудностей с очисткой. Описанные выше исследования были направлены на достижение лучшего понимания характеристик молекулы плазминогена/плазмина и не сообщают о какой-либо клинической пользе или преимуществе или предполагаемых клинических преимуществах мутантов плазминогена/плазмина. Peisach et al. (1999, Biochemistry 38, 11180-11188) добились успеха в определении кристаллической структуры микроплазминогена, содержащего мутации M585Q, V673M и M788L.

Nguyen и Chrambach (1981, Preparative Biochem 11, 159-172) сообщили о присутствии “минорного и неидентифицированного белкового компонента” 10,0 кДа, исходя из результатов SDS-PAGE в восстанавливающих условиях неочищенного коммерческого препарата урокиназа-активированный плазмин (гомолизин). Отличия в аутолизе плазмина человека в зависимости от pH были описаны детально Shi и Wu (1988, Thrombosis Research 51, 355-364). Ohyama et al. (2004, Eur J Biochem 271, 809-820) предложили применение нелизиновых аналоговых модуляторов плазминогена при лечении рака благодаря усилению аутопротеолиза плазмина такими соединениями, которые приводят к усиленному образованию ангиостатинов (в присутствии урокиназного активатора плазминогена). В таблице 3 в Ohyama et al. (2004) приведено по меньшей мере 15 сайтов расщепления в плазмине, подвергнутом действию усиливающих аутопротеолиз соединений. При обсуждении их наблюдений в свете ранее проведенных исследований можно предположить, что усиливающие аутопротеолиз соединения являются более или менее избирательно усиливающими протеолиз B/легкой цепи, поскольку при отсутствии усиливающих аутопротеолиз соединений был обнаружен минимальный распад как A/тяжелой, так и B-цепи.

Ясно, что ни один из описанных выше способов/вариантов не решал проблему получения плазмина, стабилизированного на молекулярном уровне. Получение варианта плазмина (или соответствующего варианта плазминогена, из которого может быть получен плазмин) с каталитическим доменом, по сути устойчивым к аутокаталитическому распаду, будет значительным шагом вперед по направлению к эффективному и безопасному длительному хранению, а также по направлению к эффективному и безопасному терапевтическому применению плазмина, например при тромболитической терапии или при индукции заднего отслоения стекловидного тела или разжижения стекловидного тела глаза.

Краткое описание настоящего изобретения

Настоящее изобретение относится к выделенным вариантам плазминогена и полученным из него плазминам, или к выделенным вариантам плазмина, или к протеолитически активным или обратимо неактивным производным любого из указанных плазминов, которые отличаются тем, что:

(i) они содержат в своем каталитическом домене лизин или аргинин в положении Р и мутацию по меньшей мере одной аминокислоты в положении [P+/-n], где n равно 1, 2, 3, 4 или 5, и где аминокислота в положении [P+/-n] не является лизином и не является аргинином; и

(ii) мутация из (i) уменьшает степень аутопротеолитического распада указанного варианта плазмина по сравнению со степенью аутопротеолитического распада плазмина дикого типа, которая, например, определена с помощью хромогенного анализа или анализа биологической активности к субстрату.

Настоящее изобретение дополнительно относится к описанным выше вариантам плазминогена, вариантам плазмина или производным плазмина, содержащим в своем каталитическом домене мутацию по меньшей мере двух внутренних аминокислот:

- в положениях [P+/-n] и [P+/-n']; где n и n' равны 1, 2, 3, 4 или 5; где аминокислоты в положениях [P+/-n] и [P+/-n'] не являются лизином и не являются аргинином; и где n и n' отличаются друг от друга, если оба либо прибавлены, либо вычтены из P; или

- в положениях [P+/-n] и [P'+/-n]; где P' является большей величиной из P и P'; где аминокислота в положении P' является лизином или аргинином; где n равно 1, 2, 3, 4 или 5; где аминокислота в положении [P'+/-n] не является лизином и не является аргинином; и где, при наличии, исключены положения, перекрывающиеся между [P+n] и [P'-n];

и где мутация указанных по меньшей мере двух внутренних аминокислот уменьшает степень аутопротеолитического распада указанного варианта плазмина по сравнению со степенью аутопротеолитического распада плазмина дикого типа, которая, например, может быть определена с помощью хромогенного анализа или анализа биологической активности к субстрату.

Любой из вышеуказанных вариантов плазминогена, вариантов плазмина или производных плазмина могут дополнительно содержать мутацию любой одной или нескольких аминокислот лизин или аргинин каталитического домена, включая аминокислоты лизин или аргинин в любом из положений P и P', в аминокислоту, не являющуюся лизином, аргинином.

В любом из вышеуказанных плазминогенов, плазминов или производных плазмина указанная внутренняя аминокислота в положении P или P' может быть выбрана, в частности, из:

(i) лизина в положении 137 каталитического домена плазмина человека или соответствующего лизина или аргинина каталитического домена плазмина, отличного от плазмина человека;

(ii) лизина в положении 147 каталитического домена плазмина человека или соответствующего лизина или аргинина каталитического домена плазмина, отличного от плазмина человека; или

(iii) аргинина в положении 158 каталитического домена плазмина человека или соответствующего аргинина или лизина каталитического домена плазмина, отличного от плазмина человека;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

В частности, у плазминогенов, плазминов или производных плазмина по настоящему изобретению указанная аминокислота в положении [P+/-n] является аминокислотой глутамат в положении 138 каталитического домена плазмина человека или соответствующего аминокислотного остатка каталитического домена плазмина, отличного от плазмина человека.

Любой из вариантов плазминогена, вариантов плазмина или производных плазмина по настоящему изобретению может дополнительно отличаться тем, что его константа аутолиза составляет не более 95% от константы аутолиза плазмина дикого типа. Данный признак также может служить в качестве определения сниженного аутопротеолитического распада описанного выше варианта плазминогена или варианта плазмина по сравнению с аутопротеолитическим распадом соответствующего плазминогена или плазмина дикого типа.

Любой из вариантов плазминогена, вариантов плазмина или производных плазмина по настоящему изобретению может дополнительно отличаться тем, что каталитическая константа kкат находится в диапазоне 10% - 200% от kкат плазмина дикого типа.

Любой из вариантов плазминогена, вариантов плазмина или производных плазмина по настоящему изобретению может дополнительно отличаться тем, что его константа аутолиза составляет не более 95% от константы аутолиза плазмина дикого типа, и его каталитическая константа kкат находится в диапазоне 10% - 200% от kкат плазмина дикого типа.

Без какого-либо ограничения любой из перечисленных выше вариантов плазминогена, вариантов плазмина или производных плазмина по настоящему изобретению может быть одним из следующего: Glu-плазминоген или Glu-плазмин, Lys-плазминоген или Lys-плазмин, мидиплазминоген или мидиплазмин, миниплазминоген или миниплазмин, микроплазминоген или микроплазмин, дельтаплазминоген или дельтаплазмин.

Настоящее изобретение дополнительно относится к выделенным вариантам плазминогена, вариантам плазмина или производным плазмина, описанным выше, или комбинации любых из них для применения в качестве лекарственного препарата.

Настоящее изобретение также относится к композициям, содержащим выделенный вариант плазминогена, вариант плазмина или производное плазмина, которые описаны выше, или комбинацию любых из них и по меньшей мере одно из следующего: фармацевтически приемлемый разбавитель, носитель или вспомогательное средство. Такая композиция может необязательно дополнительно содержать по меньшей мере одно из следующего: антикоагулянт, тромболитическое средство, противовоспалительное средство, противовирусное средство, антибактериальное средство, противогрибковое средство, антиангиогенное средство, антимитотическое средство, антигистамин или анестетик.

Настоящее изобретение также включает любое полезное применение выделенного варианта плазминогена, варианта плазмина или производного плазмина, которые описаны выше. Без какого-либо ограничения они включают следующее: индуцирование или стимулирование лизиса патологического отложения фибрина у субъекта, индуцирование заднего отслоения стекловидного тела глаза и/или индуцирование разжижения стекловидного тела глаза, облегчение хирургической витрэктомии глаза у субъекта, ферментное очищение раны поврежденной ткани субъекта, снижение циркулирующего фибриногена у субъекта, снижение уровней α2-антиплазмина у субъекта, снижение риска патологического отложения фибрина.

Настоящее изобретение дополнительно относится к способам скрининга в отношении аутопротеолитически стабильных вариантов плазмина, причем указанные способы включают этапы следующего:

(i) мутирование аминокислоты в положении [P+/-n], где аминокислота в положении P является аргинином или лизином, и где n равно 1, 2, 3, 4 или 5;

(ii) определение аутопротеолитической стабильности мутанта, полученного из (i), например, определенной посредством хромогенного анализа или анализа биологической активности к субстрату;

(iii) сравнение аутопротеолитической стабильности мутанта, определенного в (ii), с аутопротеолитической стабильностью плазмина дикого типа; и

(iv) отбор из (iii) мутанта, который является аутопротеолитически более стабильным, чем плазмин дикого типа, в качестве аутопротеолитически стабильного варианта.

В вышеприведенном способе аминокислота в положении [P+/-n] предпочтительно не является лизином и не является аргинином.

В альтернативном способе скрининга в отношении аутопротеолитически стабильных вариантов плазмина указанный способ включает следующие этапы:

(i) мутирование аминокислоты глутамат в положении 138 каталитического домена плазмина человека или соответствующего аминокислотного остатка плазмина, отличного от плазмина человека, в аминокислоту, отличающуюся от природной аминокислоты,

(ii) определение аутопротеолитической стабильности мутанта, полученного из (i), например, определенной посредством хромогенного анализа или анализа биологической активности к субстрату, и

(iii) отбор из (ii) мутанта, который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта плазмина;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

Любой из перечисленных выше способов скрининга может необязательно дополнительно включать этап, на котором определяют протеолитическую активность аутопротеолитически стабильного варианта плазмина.

Настоящее изобретение дополнительно включает способы улучшения стабильности при длительном хранении плазмин-содержащей композиции, при этом указанные способы включают этап определения аутопротеолитически стабильного варианта плазмина, способного храниться в течение длительного периода времени без существенной потери протеолитической активности.

Настоящее изобретение дополнительно включает способы получения варианта плазминогена по настоящему изобретению, при этом указанные способы включают этапы следующего:

(i) введение нуклеиновой кислоты, кодирующей плазминоген по настоящему изобретению, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;

(ii) выращивание клетки-хозяина, полученной в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине; и

(iii) сбор плазминогена, экспрессированного в (ii).

Такие способы могут необязательно дополнительно включать этап (iv), на котором очищают плазминоген, собранный в (iii).

Настоящее изобретение аналогично включает способы получения варианта плазмина по настоящему изобретению, при этом указанные способы включают этапы следующего:

(i) введение нуклеиновой кислоты, кодирующей плазминоген по настоящему изобретению, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;

(ii) выращивание клетки-хозяина, полученной в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине;

(iii) сбор плазминогена, экспрессированного в (ii);

(iv) активация плазминогена из (iii) до плазмина.

Такие способы могут дополнительно необязательно включать этап, на котором плазминоген, собранный в (iii), очищают до активации в (iv). Дополнительно, в любом способе получения варианта плазмина по настоящему изобретению активный плазмин, полученный в (iv), можно необязательно очистить. Также, дополнительно активный вариант плазмина, полученный согласно способу настоящего изобретения, можно необязательно дериватизировать и/или обратимо инактивировать.

Любой из вариантов плазминогена, вариантов плазмина или производных плазмина по настоящему изобретению предпочтительно получают в свободной, или растворимой, форме, например, не прикрепленной к поверхности хозяина (как, например, у фагового дисплея).

Настоящее изобретение дополнительно относится к выделенным последовательностям нуклеиновых кислот, кодирующим вариант плазминогена или вариант плазмина по настоящему изобретению. Рекомбинантные векторы, содержащие такие нуклеиновые кислоты, также являются частью настоящего изобретения, равно как и клетки-хозяева, трансформированные такой нуклеиновой кислотой или рекомбинантным вектором.

УСЛОВНЫЕ ОБОЗНАЧЕНИЯ НА ФИГУРАХ

ФИГУРА 1. Аминокислотная последовательность с двойной нумерацией аминокислотных положений Glu-плазминогена дикого типа человека (1-791) и каталитического домена плазмина (1-230, аминокислотная последовательность и нумерация выделены жирным шрифтом). Микроплазминоген, используемый для демонстрации настоящего изобретения, начинается в аминокислотном положении 543 (нумерация относительно Glu-плазминогена). Домены “двойная петля” (полученные из информации, включенной в GenBank по номером доступа AAA36451) заключены в рамки и их аминокислотные последовательности напечатаны с заменой букв нормального шрифта на курсив. Аминокислоты каталитической триады обведены кружком.

ФИГУРА 2. Выравнивание аминокислотной последовательности белков плазминогена млекопитающих, полученных из GenBank. Выравнивание последовательностей проводили с помощью программного обеспечения COBALT (Constraint-based Multiple Alignment Tool (инструмент для множественного выравнивания с комплексной увязкой параметров); Papadopolous & Aagarwala, Bioinformatics, 23:1073-79, 2007), доступного с сайта Национального центра биотехнологической информации (NCBI) с установками по умолчанию. ▼: обозначение начала Glu-плазминогена. Аминокислотная нумерация дана по отношению к плазминогену человека.

ФИГУРА 3. SDS-PAGE-анализ в восстанавливающих условиях иллюстративного варианта микроплазмина E138Q. Левая дорожка: маркер молекулярного веса с указанием молекулярного веса. Дорожка 1: микроплазминоген E138Q до активации. Дорожка 2: микроплазмин E138Q, тот же материал, что и в дорожке 1, но после активации. Гель красили с помощью красителя кумасси бриллиантового голубого.

Детальное описание изобретения

Настоящее изобретение основано на результатах исследования механизмов, лежащих в основе естественной аутоинактивации протеолитической активности плазмина при нейтральном pH, исследования, для которого изобретатель сфокусировался на микроплазмине, который состоит, главным образом, из каталитического домена плазмина. Пептидные связи, подверженные расщеплению плазмином, расположены на C-конце лизина или аргинина (Weinstein and Doolittle, 1972, Biochim Biophys Acta 258, 577-590). Приблизительно 10% (22 из 230) аминокислот каталитического домена плазмина (начиная с аминокислотного положения 562, валин, в Glu-плазминогене человека) представляют собой лизины или аргинины. Теоретически, все пептидные связи, С-концевые для этих лизинов и аргининов, независимо от структуры аминокислоты, С-концевой по отношению к указанному лизину или аргинину, в одной молекуле плазмина могут протеолитически расщепляться другой молекулой плазмина. Кроме того, теоретически, мутация любого одного или нескольких из этих лизинов или аргининов в аминокислоту, не являющуюся лизином, аргинином, сделает молекулу плазмина более устойчивой к аутопротеолитическому распаду. Было доказано, что данная теория верна, как описано в международной патентной заявке №PCT/EP2010/059902 (WO 2011/004011). Основанием для настоящего изобретения является неожиданное наблюдение, что мутация аминокислоты дикого типа рядом с лизином или аргинином в каталитическом домене плазмина в аминокислоту, отличную от аминокислоты дикого типа, и без необходимости мутирования указанного лизина или аргинина, также значительно повышает устойчивость полученного мутантного плазмина к аутопротеолитическому распаду.

Один аспект настоящего изобретения, таким образом, относится к молекулам плазмина и к молекулам плазминогена, в частности, к молекулам плазминогена, которые являются активируемыми/могут потенциально быть активированы до плазмина, содержащим в своем каталитическом домене одну или несколько мутаций аминокислот, так чтобы пептидные связи, восприимчивые к аутопротеолитическому распаду в плазмине или плазминогене дикого типа, были менее восприимчивы или не восприимчивы к аутопротеолитическому распаду в молекулах плазмина и плазминогена - объектах настоящего изобретения.

Иными словами, настоящее изобретение относится к выделенным вариантам плазминогена и полученным из него плазминам, или к выделенным вариантам плазмина, или к протеолитически активным или обратимо неактивным производным любого из указанных плазминов, которые отличаются тем, что:

(i) они содержат в своем каталитическом домене лизин или аргинин в положении Р и мутацию по меньшей мере одной аминокислоты в положении [P+n] или [P-n] (далее обозначаемой как [P+/-n]) в аминокислоту, отличную от аминокислоты дикого типа (или в аминокислоту, отличную от природной аминокислоты или встречающейся в природе аминокислоты), где n равно 1, 2, 3, 4 или 5, и где аминокислота в положении [P+/-n] не является лизином и не является аргинином; и

(ii) мутация (ее наличие) из (i) уменьшает степень (или чувствительность к, или восприимчивость к, или подверженность к) аутопротеолитического распада указанного варианта плазмина по сравнению со степенью аутопротеолитического распада плазмина дикого типа, которая, например, может быть определена с помощью, например, хромогенного анализа или анализа биологической активности к субстрату (см. далее).

Таким образом, целью настоящего изобретения является получение выделенных вариантов плазмина (таких, как полученные из вариантов плазминогена) или протеолитически активных или обратимо неактивных производных любого из указанных плазминов, которые отличаются тем, что указанные варианты плазмина или их производные обладают более высокой устойчивостью/более устойчивы к аутопротеолизу по сравнению с плазмином дикого типа. Некоторые аспекты, касающиеся определения аутопротеолитической устойчивости/восприимчивости, приведены далее.

Мутацию аминокислоты в заданном положении в "аминокислоту, отличную от аминокислоты дикого типа" или в "аминокислоту, отличную от природной аминокислоты" рассматривают как изменение аминокислоты в указанном заданном положении плазминогена или плазмина дикого типа в любую аминокислоту, отличную от природной аминокислоты или аминокислоты дикого типа, в таком указанном заданном положении такого указанного плазминогена или плазмина дикого типа. Некоторые аспекты, касающиеся выбора мутаций, приведены далее.

В частности, указанная внутренняя аминокислота в положении P представляет собой лизин или аргинин. Как указано в данном документе ниже (если не указано иное), каталитический домен плазмина (также называемого в литературе "легкой цепью" или "В-цепью") будет нумероваться по отношению к плазмину человека, который начинается с валина в положении P=1, что является таким же, как валин в положении 562 Glu-плазминогена человека (смотри Фигуру 1). В данном контексте могут упоминаться два различных аминокислотных положения в каталитическом домене плазмина, которые далее называют [P+/-n] (с лизином или аргинином в положении P) и [P'+/-n] (с лизином или аргинином в положении P'), соответственно. Для полной ясности, положения P, P', [P+/-n], [P'+/-n] и т. д. выражены целыми числами. Положение [P+n], [P'+n] и т. д. имеет целочисленное значение P, P' и т. д., увеличенное на величину n (при этом n равно 1, 2, 3, 4 или 5); положение [P-n], [P'-n] и т.д. имеет целочисленное значение P, P' и т. д., уменьшенное на величину n (при этом n равно 1, 2, 3, 4 или 5); положение [P+/-n], [P'+/-n] и т. д. имеет целочисленное значение P, P' и т. д., увеличенное (+) или уменьшенное (-) на величину n (при этом n равно 1, 2, 3, 4 или 5). Таким образом, например, если [P+1]=20, то P=19, а [P-2]=17; или, например, если P'=49, то [P'-5]=44, а [P'+3]=52. Два различных аминокислотных положения в каталитическом домене плазмина могут быть также обозначены как, например, [P+/-n] и [P+/-n'], где как n, так и n' имеют значение 1, 2, 3, 4 или 5; и где n и n' отличаются друг от друга в случае, когда как n, так и n' либо прибавлены (+), либо вычтены (-). В последнем случае, если Р равно, например, 19, если как n, так и n' нужно прибавить, при этом, например, n = 1 и n' = 3, то [P+n] = 20 и [P+n'] = 22. Или, если n необходимо вычесть, а n' необходимо прибавить, при этом, например, n = n' = 1, то [P-n] = 18 и [P+n'] = 20.

Настоящее изобретение дополнительно относится к описанным выше вариантам плазминогена, вариантам плазмина или производным плазмина, содержащим в своем каталитическом домене мутацию в аминокислоты, отличные от аминокислот дикого типа (или в аминокислоты, отличные от природных аминокислот или от встречающихся в природе аминокислот), по меньшей мере двух внутренних аминокислот:

- в положениях [P+/-n] и [P+/-n']; где n и n' равны 1, 2, 3, 4 или 5; где аминокислоты в положениях [P+/-n] и [P+/-n'] не являются лизином и не являются аргинином; и где n и n' отличаются друг от друга, если оба либо прибавлены, либо вычтены из P; или

- в положениях [P+/-n] и [P'+/-n]; где P' является большей величиной из P и P'; где аминокислота в положении P' является лизином или аргинином; где n равно 1, 2, 3, 4 или 5; где аминокислота в положении [P'+/-n] не является лизином и не является аргинином; и где, при наличии, исключены положения, перекрывающиеся между [P+n] и [P'-n];

и где мутация (ее наличие) указанных по меньшей мере двух внутренних аминокислот уменьшает степень аутопротеолитического распада указанного варианта плазмина по сравнению со степенью аутопротеолитического распада плазмина дикого типа, которая, например, может быть определена с помощью хромогенного анализа или анализа биологической активности к субстрату.

Альтернативно, вариант плазминогена, вариант плазмина или производное плазмина по настоящему изобретению, таким образом, может содержать в своем каталитическом домене мутацию любого лизина или аргинина в любом положении, в том числе в одном или нескольких из положений P, P', P” и т. д., в аминокислоту, не являющуюся лизином, аргинином.

Специалист в данной области сможет легко решить, в какую другую аминокислоту можно мутировать аминокислоту дикого типа. Такое решение может, но не обязательно должно, следовать критериям, таким как размер аминокислоты, заряд аминокислоты, полярность аминокислоты и/или индекс гидрофобности аминокислоты (смотри Таблицу 1). Более того, наличие кристаллической структуры плазминогена и микроплазмина (MMDB ID: 12717; PDB ID: 1DDJ; Wang et al., 2001, J Mol Biol 295, 903-914) значительно помогает определению мутантных аминокислот, так что полученная мутантная молекула плазмина или плазминогена сохраняет протеолитическую активность. Кроме того, можно ожидать, что мутация аминокислоты дикого типа в заданном положении [P+/-n] и, в некоторых случаях, дополнительно в одном или нескольких из заданных положений P, P', P” и т. д. в любую из аминокислот данной группы будет давать похожие результаты. На основе Таблицы 1 указанные данные группы могут быть обозначены следующим образом:

- гидрофобные алифатические аминокислоты: Met, Ile, Leu и Val;

- гидрофобные ароматические аминокислоты: Phe;

- гидрофильные кислые аминокислоты: Asp, Glu, Asn и Gln;

- гидрофильные основные аминокислоты: Arg, Lys и His;

- умеренно гидрофобные алифатические аминокислоты: Gly, Ala, Ser, Thr, Cys, Pro;

- умеренно гидрофобные ароматические аминокислоты: Tyr и Trp.

Из них, и с целью мутации, Cys и Pro могут быть менее предпочтительными аминокислотами-заменителями аминокислот дикого типа плазмина или плазминогена из-за создания возможной свободной тиольной группы с помощью Cys или из-за более обширного нарушения белковой структуры с помощью Pro. Другие аминокислотные замены включают мутацию аминокислоты дикого типа в положении [P+/-n] и, в некоторых случаях, дополнительно в одном или нескольких из положений P, P', P” и т. д. каталитического домена плазмина(плазминогена) в неприродную или неканоническую аминокислоту или в аналоги аминокислот, такие как норлейцин, норвалин, орнитин или цитруллин (более обширный перечень смотри, например, в Hendrickson et al. 2004, Annu Rev Biochem 73, 147-176).

Таблица 1. Характеристики аминокислот

Аминокислота Полярность боковой цепи Заряд боковой цепи
(при pH 7)
Индекс гидрофобности
Аланин Ala A неполярная нейтральный 1,8
Аргинин Arg R полярная положительный -4,5
Аспарагин Asn N полярная нейтральный -3,5
Аспарагиновая кислота Asp D полярная отрицательный -3,5
Цистеин Cys C неполярная нейтральный 2,5
Глутаминовая кислота Glu E полярная отрицательный -3,5
Глутамин Gln Q полярная нейтральный -3,5
Глицин Gly G неполярная нейтральный -0,4
Гистидин His H полярная положительный -3,2
Изолейцин Ile I неполярная нейтральный 4,5
Лейцин Leu L неполярная нейтральный 3,8
Лизин Lys K полярная положительный -3,9
Метионин Met M неполярная нейтральный 1,9
Фенилаланин Phe F неполярная нейтральный 2,8
Пролин Pro P неполярная нейтральный -1,6
Серин Ser S полярная нейтральный -0,8
Треонин Thr T полярная нейтральный -0,7
Триптофан Trp W неполярная нейтральный -0,9
Тирозин Tyr Y полярная нейтральный -1,3
Валин Val V неполярная нейтральный 4,2

При тестовых условиях (непринудительный аутопротеолитический распад при нейтральном рН), которые описаны в международной патентной заявке № PCT/EP2010/059902, в каталитическом домене плазмина происходит ограниченное количество аутопротеолитических расщеплений. Эти расщепления происходили по лизину 137 каталитического домена плазмина человека, по лизину 147 каталитического домена плазмина человека и по аргинину 158 каталитического домена плазмина человека. Это, однако, не исключает возможности существования других пептидных связей, которые поддаются аутопротеолитическому расщеплению.

Таким образом, в отношении вариантов плазминогена, вариантов плазмина или производных плазмина по настоящему изобретению указанная внутренняя аминокислота в положении Р или Р' может быть выбрана из следующего:

(i) лизин в положении 137 каталитического домена плазмина человека или соответствующий лизин или аргинин плазмина, отличного от плазмина человека;

(ii) лизин в положении 147 каталитического домена плазмина человека или соответствующий лизин или аргинин плазмина, отличного от плазмина человека; и/или

(iii) аргинин в положении 158 каталитического домена плазмина человека или соответствующий лизин или аргинин плазмина, отличного от плазмина человека;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека. Для ясности нумерации аминокислот в плазминогене человека и каталитическом домене плазмина человека в данном документе сделана ссылка на Фигуру 1.

В частности, в вышеупомянутом указанная по меньшей мере одна внутренняя аминокислота в положении Р является лизином в положении 137 каталитического домена плазмина человека или соответствующим лизином или аргинином плазмина, отличного от плазмина человека, а указанная внутренняя аминокислота в положении [P+/-n] является аминокислотой в положении [P+1], т. е. глутаматом в положении 138 каталитического домена плазмина человека или соответствующим аминокислотным остатком плазмина, отличного от плазмина человека. Более конкретно, указанный глутамат мутируют в другую гидрофильную кислую аминокислоту, например аспартат, аспарагин или глутамин.

Определение аминокислоты в последовательности плазмина(плазминогена), отличного от плазмина(плазминогена) человека, которая “соответствует” (т. е. определение “соответствующей” аминокислоты) аминокислоте в плазмине(плазминогене) человека, в первую очередь подразумевает выравнивание обеих аминокислотных последовательностей. Такое выравнивание может требовать некоторой оптимизации, такой как введение минорных гэпов в одну или обе выравниваемые последовательности, для получения наивысшей идентичности и гомологии. Во-вторых, аминокислота в плазмине(плазминогене), отличном от плазмина(плазминогена) человека, выравнивающаяся с аминокислотой в плазмине(плазминогене) человека, определяется и называется в данном документе как “соответствующая” аминокислота. На фигуре 2 в данном документе изображено такое выравнивание общедоступных последовательностей белка плазминогена млекопитающих и выделены аминокислоты, представляющие особый интерес для настоящего изобретения, в последовательности плазминогена человека (линия 1) вместе с соответствующими аминокислотами в последовательностях плазминогена, отличного от плазминогена человека (линии 2-18). Аминокислотами Р, Р' и т. д., представляющими особый интерес, являются Lys в положении 698 (положение 137 в каталитическом домене, смотри Фигуру 1), Lys в положении 708 (положение 147 в каталитическом домене, смотри Фигуру 1) и Arg в положении 719 (положение 158 в каталитическом домене, смотри Фигуру 1).

“Плазмин”, также известный как фибринолизин или лизофибрин, представляет собой протеазу серинового типа, которая является результатом активации зимогена плазминогена. Активация является результатом протеолитического расщепления между аминокислотами 561 и 562 (нумерация относительно Glu-плазминогена человека). Плазмин несет тяжелую цепь, содержащую 5 доменов “двойная петля”, и легкую цепь, содержащую каталитический домен. Плазминоген может быть получен из плазмы крови, например, посредством аффинной к лизину хроматографии (Deutsch and Mertz, 1970, Science 170, 1095-1096). Процессинг молекулы плазмина (снаружи и/или внутри каталитического домена плазмина) возможен при условии, что каталитический домен остается функциональным, поэтому, такой процессинг приводит к образованию “протеолитически активного производного” плазмина. В связи с этим, один или несколько из 5 доменов “двойная петля” могут быть удалены полностью или частично. Процессированные плазмины, в которых не достает одного или нескольких доменов “двойная петля” и/или не достает частей одного или нескольких доменов “двойная петля”, следовательно, рассматриваются настоящим изобретением как примеры протеолитически активных производных плазмина. Примеры процессированных вариантов плазмина включают, но без ограничений, следующее: “мидиплазмин”, “миниплазмин”, “микроплазмин” и “дельта-плазмин”. Мидиплазмин, в основном, не содержит домены “двойная петля” 1-3 (например, Christensen et al., 1995, Biochem J 305, 97-102). Миниплазмин изначально получали путем ограниченного расщепления плазмина эластазой, и он, в основном, не содержит домены “двойная петля” 1-4 (например, Christensen et al., 1979, Biochim Biophys Acta 567, 472-481; Powell and Castellino, 1980, J Biol Chem 255, 5329). Миниплазмин был впоследствии получен рекомбинантно (WO 2002/050290). Микроплазмин изначально был получен путем инкубации плазмина при повышенном pH, и он, в основном, не содержит все домены “двойная петля” (например, WO 89/01336). Тогда как микроплазмин, полученный в результате инкубации плазмина при повышенном pH, содержит 30-31 C-концевых аминокислот тяжелой цепи, рекомбинантно полученный вариант микроплазмина содержит 19 C-концевых аминокислот тяжелой цепи (WO 2002/050290). Это иллюстрирует допустимую молекулярную изменчивость в данном семействе плазминов, таком как семейство микроплазминов (например, множество видов образуют семейство микроплазминов). Дельта-плазмин представляет собой рекомбинантную версию плазмина, в котором домен “двойная петля” 1 или домен “двойная петля” 4 связан непосредственно с каталитическим доменом (WO 2005/105990). Вышеописанные процессированные варианты плазмина получают путем активации “мидиплазминогена”, “миниплазминогена”, “микроплазминогена” и “дельтаплазминогена”, соответственно. Для того, чтобы быть активируемым, процессированный плазминоген должен содержать минимальное количество аминокислот линкера между доменом “двойная петля” (таким как домен “двойная петля” 5 у миниплазмина) и каталитическим доменом или С-концом каталитического домена в случае плазмина с удаленной в результате процессинга “двойной петлей” (смотри, например, Wang et al., 1995, Protein Science 4, 1758-1767). В контексте настоящего изобретения может быть желательным, чтобы плазминоген содержал “интактный сайт активации”, который предполагает, что присутствуют по меньшей мере аминокислоты 561 и 562 (относительно Glu-плазминогена человека; или соответствующие аминокислоты в плазминогене, отличного от плазминогена человека) и присутствуют в молекулярном контексте такими, чтобы могла проходить активация/превращение плазминогена в плазмин, хотя возможно с различной кинетикой, как это происходит в плазмине дикого типа. Как альтернативу плазмину или его активному процессированному варианту в контексте настоящего изобретения можно применять активируемый плазминоген или его процессированный вариант (смотри, например, EP 0480906, US 5304383, EP 0631786, US 5520912, US 5597800, US 5776452). “Плазминоген” относится к любой форме плазминогена, например, Glu-плазминогену или Lys-плазминогену (начинающихся с Arg в положении 68 или Lys в положениях 77 или 78). Если используют активируемый плазминоген или его активируемый процессированный вариант, то активация до плазмина может быть отсрочена и будет, как правило, происходить после его контакта с органом, тканью или жидкостью организма, т. е. после введения субъекту. В еще одной альтернативе плазмином или его активным процессированным вариантом в контексте настоящего изобретения можно заменить активируемый плазминоген или его активируемый процессированный вариант совместно с активатором плазминогена (таким как тканевой активатор плазминогена (tPA), урокиназа, стрептокиназа или стафилокиназа или любой их вариант; смотри, например, US 6733750, US 6585972, US 6899877, WO 03/33019). В еще одной дополнительной альтернативе смесь любого из следующего: (i) плазмин или его производное, (ii) активируемый плазминоген или его активируемое производное и, необязательно, (iii) активатор плазминогена можно применять в контексте настоящего изобретения (смотри, например, US 2004/0081643). Чтобы обеспечить стабильность плазмина (или плазминогена), его будут, как правило, хранить при пониженных температурах (например,+4 градуса Цельсия или -20 градусов Цельсия). Композицией для хранения может быть стабилизирующая композиция, такая как композиция с низким рН (pH 4 или ниже; полученная, например, с применением 1 мМ - 250 мМ кислоты, такой как лимонная кислота, смотри, например, Castellino and Sodetz, 1976, Methods Enzymol 45, 273-286; WO 01/36608; WO 01/36609; WO 01/36611), или композиция с высоким содержанием глицерина (30-50% объемного содержания, например, Castellino and Sodetz, 1976, Methods Enzymol 45, 273-286) альтернативно в или совместно с одной или несколькими дополнительными композициями стабилизаторов, содержащими, например, аминокислоту (например, лизин или его аналог, такой как EACA или транексамовая кислота), сахар (например, маннит) или любой стабилизатор, который известен в данном уровне техники (например, дипептиды, WO 97/01631). Дополнительно в семейство “плазмина” включают любое его (или активного процессированного варианта плазмина) активное производное или сходное производное активируемого плазминогена (или его активируемого процессированного варианта). Такие производные включают, например, меченный плазмин или плазминоген (или их процессированные варианты), такой как Tc99-меченный плазмин (Deacon et al., 1980, Br J Radiol 53, 673-677) или пегилированный или ацилированный плазмин или плазминоген (или их процессированные варианты; EP 9879, WO 93/15189). Также можно использовать любую другую метку (радиоактивную, флюоресцентную и т. п.) для получения производного плазмина или плазминогена. Указанные производные дополнительно включают гибридные или химерные молекулы плазмина или плазминогена, содержащие, например, процессированный плазмин или плазминоген по настоящему изобретению, слитый, например, с фибрин-связывающей молекулой (такой как “двойная петля” 2 tPA, аполипопротеиновая “двойная петля”, пальцеобразный домен tPA или фибронектин или Fab домен фибрин-связывающего антитела).

Сравнение аутопротеолитической устойчивости (т.е. стабильности) плазмина дикого типа и вариантов плазмина или производных плазмина по настоящему изобретению может быть проведено сходным образом, как для сравнения протеолитической активности, например, при хромогенном анализе активности или анализе биологического субстрата на основе, например, фибрина, фибриногена фибронектина, желатина, ламинина или коллагена.

Для того, чтобы определить аутопротеолитическую устойчивость, может быть определена константа скорости аутолиза. Предусматривается, что варианты плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любое из производных плазмина по настоящему изобретению могут характеризоваться константой скорости аутолиза, которая по меньшей мере на 5% или по меньшей мере на 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 75%, 80%, 90%, 95%, 99% или 99,5% ниже константы скорости аутолиза плазмина дикого типа, или, альтернативно, константой скорости аутолиза, которая составляет не более 95% или не более 0,5%, 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 75%, 80% или 90% константы скорости аутолиза плазмина дикого типа. Для того, чтобы определить указанный процент, расчет может быть произведен на основе абсолютных значений константы скорости аутолиза. Например, для микроплазмина дикого типа была определена константа скорости аутолиза 123 M-1 с-1, в то время как для варианта микроплазмина E138Q была определена константа скорости аутолиза 4 M-1 с-1 (см. Пример 1/Таблицу 2). Константа скорости аутолиза варианта E138Q, следовательно, составляет 3,25% константы скорости аутолиза микроплазмина дикого типа.

Дополнительно, любой из вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или производные любого из указанных плазминов могут сохранять протеолитическую активность, отличную (выше или ниже) от протеолитической активности плазмина дикого типа, которую определяют с помощью, например, анализа хромогенной активности или анализа биологического субстрата на основе, например, фибрина, фибриногена, фибронектина, желатина, ламинина или коллагена.

Протеолитические активности вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любое из производных плазмина по настоящему изобретению можно сравнить с протеолитической активностью плазмина дикого типа посредством каталитической константы kкат, которая является мерой числа молекул субстрата, которые каждый сайт фермента превращает в продукт за единицу времени. Таким образом, любой из вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любое из производных плазмина по настоящему изобретению может характеризоваться значением kкат, которое находится в диапазоне от+100% до -90% или от+50% до -50% значения kкат плазмина дикого типа, т. е. характеризоваться значением kкат в диапазоне от 10% до 200% или от 50% до 150% значения kкат плазмина дикого типа. Для определения указанного процента производят расчет на основании абсолютных значений kкат. Например, микроплазмин дикого типа имеет kкат 46 с-1, тогда как вариант микроплазмина K137M имеет kкат 36 с-1 (смотри Пример 4/Таблицу 3 международной патентной заявки №PCT/EP2010/059902). Значение kкат варианта K137M, следовательно, составляет 78,3% kкат микроплазмина дикого типа.

Другой способ сравнения протеолитической активности вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любые из производных плазмина по настоящему изобретению с протеолитической активностью плазмина дикого типа включает сравнение kкат/Kм. Несмотря на то, что могут быть предпочтительны более высокие, сравнимые или более низкие значения kкат/Kм, до 1000-раз или до 500-раз более низкое kкат/Kм вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любого из производных плазмина по настоящему изобретению по сравнению с kкат/Kм плазмина дикого типа все еще может быть приемлемым (смотри далее). К примеру, определили, что kкат/Kм варианта микроплазмина E138Q составлял 9,5x105, тогда как определили, что kкат/Kм плазмина дикого типа составлял 6,9x105 (см. Пример 1/Таблицу 2), т.е. значение kкат/Kм микроплазмина E138Q в 1,38 раза выше значения kкат/Kм микроплазмина дикого типа.

Альтернативно, любой из вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любое из производных плазмина по настоящему изобретению можно сравнить с плазмином дикого типа путем объединения данных по константе скорости аутолитической реакции и данных по kкат/Kм. Например, вариант плазмина с константой скорости аутолитической реакции, которая в 20 раз ниже по сравнению с плазмином дикого типа, и с kкат/Kм, которое в 10 раз ниже по сравнению с плазмином дикого типа, будет в 2 раза лучше, чем плазмин дикого типа. Разумеется, в зависимости от конечного применения, может быть весьма желателен очень стабильный плазмин (т.е. нет или почти нет аутопротеолитического распада) с низкой протеолитической активностью, например, в случаях, где низкая, но пролонгированная активность плазмина желательна или даже необходима для достижения предполагаемого клинического эффекта. Такие высоко стабильные варианты плазмина с низкой протеолитической активностью будут, по сути, фактически равными составам замедленного высвобождения без действительной необходимости фактического применения носителя или вспомогательного средства для замедленного высвобождения.

Еще одна другая альтернатива для сравнения любого из вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любого из производных плазмина по настоящему изобретению может заключаться в сравнении с плазмином дикого типа путем объединения данных по константе скорости аутолитической реакции и данных по kкат.

Дополнительно, любой из вариантов плазмина по настоящему изобретению, включая плазмины, полученные из вариантов плазминогена по настоящему изобретению, или любое из производных плазмина по настоящему изобретению может характеризоваться любой комбинацией определенных выше константы скорости аутолиза, каталитической константы kкат и/или kкат/kм.

Разумеется, для любых сравнительных измерений, таких, которые описаны выше, необходимо сравнивать варианты плазмина с их ближайшим плазмином дикого типа, например, сравнивать вариант микроплазмина с микроплазмином дикого типа или вариант миниплазмина с миниплазмином дикого типа. Кроме того, ясно, что для любого измерения активности обратимо инактивированное производное варианта плазмина по настоящему изобретению следует сначала активировать путем устранения причины обратимой инактивации (например, ацилирование или неоптимальный pH).

Любой из вариантов плазминогена по настоящему изобретению или плазминов, полученных из них, вариантов плазмина по настоящему изобретению может быть следующим: Glu-плазминоген или Glu-плазмин, Lys-плазминоген или Lys-плазмин, мидиплазминоген или мидиплазмин, миниплазминоген или миниплазмин, микроплазминоген или микроплазмин, дельтаплазминоген или дельтаплазмин.

Существует множество анализов для определения того, является или нет вид плазмина протеолитически активным. Простые и прямые анализы основаны на расщеплении хромогенного субстрата плазмином, присутствующим в образце; хромогенные субстраты включают S-2403 (Glu-Phe-Lys-pNA) и S-2251 (Val-Leu-Lys-pNA), которые высвобождают p-нитроанилин (pNA) при протеолитическом расщеплении. Количество образованного pNA может быть измерено с помощью поглощения света при 405 нм. Альтернативным анализом для определения активности плазмина является потенциометрический анализ. Колориметрические (с использованием хромогенного субстрата) и потенциометрические анализы описаны, например, в Castellino и Sodetz (1976, Methods Enzymol 45, 273-286). Следующим альтернативным анализом для определения активности плазмина является казеинолитический анализ (например, Robbins and Summaria, 1970, Methods Enzymol 19, 184-199; Ruyssen and Lauwers, 1978, Chapter IX - Plasmin, In “Pharmaceutical Enzymes”, Story-Scientia, Gent, Belgium, pp. 123-131). Еще одним альтернативным анализом для определения активности плазмина является фибринолитический анализ (например, Astrup and Mullertz, 1952, Arch Biochem Biophys 40, 346-351). Можно легко разработать дополнительные анализы активности с применением других белковых субстратов. Ясно, что такие анализы также можно применять для отслеживания исчезновения протеолитической активности плазмина с течением времени вследствие аутопротеолитического распада фермента. В качестве альтернативы оценке стабильности варианта плазмина или любого его активного процессированного варианта или их производного по настоящему изобретению можно проинкубировать указанный вариант плазмина в присутствии плазмина дикого типа и можно отследить устойчивость варианта плазмина к расщеплению плазмином дикого типа.

Применение плазмина при удалении некротических элементов или инородных остатков из повреждений, ран, изъязвляющихся ран (таких как изъязвляющиеся зашитые раны) и т.д. было описано, например, в патенте США №3208908. Аналогично, местное нанесение плазмин-содержащих терапевтических препаратов для лечения ожогов было раскрыто, например, в патенте США №4122158. Обработка раны относится к удалению мертвой, поврежденной и/или инфицированной ткани для того, чтобы улучшить или повысить заживление оставшейся здоровой ткани. Такое удаление может быть достигнуто с помощью хирургических, механических или химических средств или посредством определенных видов живых личинок, которые избирательно поедают некротическую ткань (терапия личинками). Обработка раны может также быть проведена с использованием ферментов или может быть выполнена с помощью ферментов; этот способ называется ферментативным очищением раны. Обработка раны является важным аспектом в процессе заживления ожогов и других серьезных ран, и ее также применяют при лечении некоторых типов укусов змей. Применение плазмина (или любого его варианта, или производного, или, соответственно, альтернативы, как описано выше) при ферментативном очищении раны (отдельно или в комбинации с другими типами обработки раны) является особенно пригодным при стимулировании или облегчении заживления раны и в качестве вспомогательного средства в хирургических процедурах, таких как пересадка кожи.

Более общеизвестное применение плазмина (или любого его варианта, или производного, или, соответственно, альтернативы, как описано выше) относится, в общих чертах, к лечению патологического(патологических) отложения(отложений) фибрина. Отложения фибрина могут быть результатом широкого спектра патологических ситуаций в организме. Например, содержащие фибрин кровяные сгустки могут формироваться в сосудах ткани, приводя к закупорке или тромбозу глубоких вен, коронарной артерии, мозговой артерии или ретинальной вены. Небольшие скопления фибрина предшествуют и могут обуславливать признак приближающегося катастрофического тромбоза. Примеры включают нестабильную стенокардию, что рассматривается как признак приближающегося коронарного тромбоза и транзиторных ишемических атак, которые могут предшествовать инсультам. Фибрин, кроме того, часто откладывается в ткани в связи с воспалением, связанным со многими патологическими процессами, включая инфекцию, аутоиммунное заболевание и рак. Другая ситуация, при которой откладывается фибрин, связана с абсцессами, вызванными инфицированием микроорганизмами. Фибриновые отложения, кроме того, часто обнаруживаются связанными с определенными солидными опухолями. Фибриновое отложение может также происходить во время заживления любого типа раны, включая полученные в результате хирургического вмешательства, в том числе, например, трабекулэктомию. Еще одна ситуация отложения фибрина - это накопление фибрина в ретинальной вене, что может привести к дегенерации сетчатки, нарушенному зрению или даже потере зрения. Выражение патологическое отложение фибрина дополнительно включает такие отложения, как сформированные или как присутствующие в или на кончике катетера, катетерного устройства или другого имплантата, такого как протезные сосуды и трансплантаты синтетического, человеческого или животного происхождения, и эффективно блокируемые закупоркой, содержащей фибрин. Выражение "катетерное устройство" относится к любому катетеру или трубко-подобному устройству, которое может проникать в организм, включая артериальные катетеры, сердечные катетеры, центральные венозные катетеры, внутривенные катетеры, периферически вводимые центральные катетеры, катетеры легочных артерий, туннельные центральные венозные катетеры и артериально-венозные шунты.

Среди различных факторов, вовлеченных в процесс тромбоза, т. е. образование тромба или гемостатической пробки, имеют место следующие: (1) повреждение выстилки эндотелиальных клеток пораженного кровеносного сосуда, (2) повышение свертывающих свойств крови и (3) застой крови в пораженном кровеносном сосуде. Тромбоз может начинаться как очень маленький комочек, прикрепленный к поврежденной части выстилки кровеносного сосуда. Его присутствие стимулирует дальнейшее протекание тромбоза и вызывает замедление потока крови путем уменьшения внутреннего диаметра сосуда. Дальнейший рост изначально небольшого тромба часто ведет к полной или почти полной закупорке пораженного кровеносного сосуда. Если тромбоз имеет место в одной из артерий, то ткани, которые снабжаются этой артерией, могут быть лишены кислорода и питательных веществ, что приводит к повреждению или смерти ткани (гангрене). Тяжесть повреждения зависит от положения и размера тромбоза, скорости, с которой он растет, и того, имеет ли пораженная область только одну артерию или снабжается коллатеральными кровеносными сосудами. Если поражен сосуд к жизненно важному органу, например, сердцу или мозгу, то индивидуум может получить тяжелые увечья или умереть. Иногда тромб может содержать инфекционные организмы, такие как бактерии, может иметь место и септический тромбоз с образованием гноя и инфицированием окружающих тканей.

Дополнительные применения плазмина (или любого его варианта, или производного, или, соответственно, альтернативы, как описано выше) включают снижение уровня циркулирующего фибриногена (например, WO 93/07893) и его применение как ингибитора α2-антиплазмина (который, как сообщалось, снижает размер церебрального инфаркта после ишемического инсульта; WO 00/18436).

Еще одно применение плазмина (или любого его варианта, или производного, или, соответственно, альтернативы, как описано выше) связано с индукцией заднего отслоения стекловидного тела (PVD) и/или разжижения стекловидного тела глаза в качестве альтернативы механической витрэктомии или в качестве вспомогательного средства для механической витрэктомии (WO 2004/052228, US 6733750, US 6585972, US 6899877, WO 03/33019, WO 2006/122249, WO 2007/047874, US 5304118, US 2006/0024349, US 2003/0147877). Витрэктомия и/или разжижение стекловидного тела является предпочтительным для ряда состояний глаза, таких как плавающие помутнения стекловидного тела (подвижные инородные остатки/отложения стекловидного тела внутри жидкости стекловидного тела с нормальной прозрачностью, которые могут нарушать зрение), отслоение сетчатки (ведущее к слепоте состояние, который может быть вызвано витреальной тракцией), макулярная складчатость (рубцовая ткань на желтом пятне; желтое пятно необходимо для острого центрального зрения; макулярная складчатость также известна как эпи- или преретинальная мембрана, целлофановая макулопатия, складка сетчатки, ретинопатия с образованием поверхностных складок, премакулярный фиброз или заболевание внутренней ограничивающей мембраны), диабетическая ретинопатия (пролиферативная или непролиферативная), которая может приводить к кровоизлиянию в стекловидное тело и/или образованию фиброзной рубцовой ткани на сетчатке (которая может вызывать отслоение сетчатки), макулярные отверстия (макулярное отверстие, приводящее к образованию слепого пятна и вызванное витреальной тракцией, травмой или травматичным событием), кровоизлияние в стекловидное тело (вызванное диабетической ретинопатией, травмами, отслоением сетчатки или разрывами сетчатки, субарахноидальные кровоизлияния (синдром Терсона) или закупоренные сосуды), субгиалоидная гемморагия (кровоизлияние под гиалоидной мембраной, покрывающей стекловидное тело), макулярная эдема (скопление жидкости и белка на желтом пятне глаза или под ним) и дегенерация желтого пятна (начиная с образования друзы; встречается в сухой и мокрой форме; при корреляции с возрастом вызывала возрастную макулярную дегенерацию). Другие применения плазмина для глаз включают поддержание или восстановление фильтрационной подушки после трабекулоэктомической операции (проведенной для снижения внутриглазного давления), смотри, например, WO 2011/023805.

Другое дополнительное применение плазмина (или любого его варианта, или производного, или, соответственно, альтернативы, которые описаны выше) принадлежит к диагностике, более конкретно, подходящим образом меченный (например, Tc99-меченный, смотри выше) плазмин (или любой его вариант, или производное, или, соответственно, альтернатива, как описано выше) можно применять для обнаружения патологических отложений фибрина. При применении процессированного плазмина или варианта плазминогена согласно настоящему изобретению в таких диагностиках следует проявлять осторожность, так как указанный вариант все еще содержит фибрин-связывающий сайт (вне зависимости от того, происходит ли он из плазмина самого по себе или добавлен, например, к каталитическому домену плазмина путем создания гибридной молекулы).

Плазмин или любой его вариант, или производное, или, соответственно, альтернатива по настоящему изобретению могут храниться в фармацевтически приемлемом носителе, разбавителе или вспомогательном средстве. Такой носитель, разбавитель или вспомогательное средство может содержать или состоять из кислого буфера с низким рН, такого как 1-100 мМ ацетат или цитрат. Если он кислый, то фармацевтически приемлемый носитель, разбавитель или вспомогательное средство может иметь pH 2,5-5,0, такой как pH 2,5-4,0, или такой как pH 3,0-3,5, или такой как pH 3,1, или 3,2, или 3,3, или 3,4. Пригодные кислые соединения включают уксусную кислоту, лимонную кислоту, соляную кислоту, молочную кислоту, яблочную кислоту, винную кислоту или бензойную кислоту. Можно использовать муравьиную кислоту, но следует проявлять осторожность, так как это соединение не индуцирует протеолитическое расщепление на C-конце Asp-остатков. Фармацевтически приемлемый носитель, разбавитель или вспомогательное средство, если оно либо кислое, либо нейтральное, либо основное, может содержать одну или несколько аминокислот, таких как серин, треонин, метионин, глутамин, глицин, изолейцин, валин, аланин, аспарагиновая кислота, лизин, гистидин или любые их производные или аналоги. Фармацевтически приемлемый носитель, разбавитель или вспомогательное средство может содержать углевод, такой как моносахарид, дисахарид, полисахарид или многоатомный спирт. Примеры включают сахара, такие как сахароза, глюкоза, фруктоза, лактоза, трегалоза, мальтоза и манноза, сахарные спирты, такие как сорбит и маннит, и полисахариды, такие как декстрины, декстраны, гликоген, крахмалы и целлюлозы. Фармацевтически приемлемый носитель, разбавитель или вспомогательное средство может включать соединения, такие как глицерин, ниацинамид, глюкозамин, тиамин, цитруллин, неорганические соли (такие как хлорид натрия, хлорид калия, хлорид магния, хлорид кальция), бензиловый спирт или бензойную кислоту. Фармацевтически приемлемый носитель, разбавители или вспомогательное средство может включать соединения, такие как ε-аминокапроновая кислота (EACA) и/или транексамовая кислота (смотри также выше и раздел Предпосылки изобретения). Некоторые из этих соединений можно применять в качестве стабилизатора плазмина или любого его варианта, или производного, или, соответственно, альтернативы, как описано выше.

В свете описанного выше, другой аспект настоящего изобретения относится к выделенному плазминогену, плазмину, или любому их варианту или производному, или, соответственно, альтернативе по настоящему изобретению, или комбинации любых из них для применения в качестве лекарственного препарата.

Дополнительный аспект настоящего изобретения относится к композициям, содержащим выделенный плазминоген, плазмин, или любой их вариант или производное, или, соответственно, альтернативы по настоящему изобретению, или комбинации любых из них, и по меньшей мере одного из фармацевтически приемлемого разбавителя, носителя или вспомогательного средства. В следующем варианте осуществления указанная композиция может дополнительно содержать по меньшей мере одно из следующего: антикоагулянт, дополнительное тромболитическое средство, противовоспалительное средство, противовирусное средство, антибактериальное средство, противогрибковое средство, антиангиогенное средство, антимитотическое средство, антигистамин или анестетик.

В варианте осуществления к описанным выше двум аспектам настоящего изобретения выделенный плазминоген, плазмин, или любой их вариант, или производное, или, соответственно, альтернативу по настоящему изобретению, или комбинацию любых из них, или композицию по настоящему изобретению можно применять в любой клинически важной установке, такой как для лечения патологического отложения фибрина, для индуцирования заднего отслоения стекловидного тела глаза, для индуцирования разжижения стекловидного тела глаза, как вспомогательное вещество для и облегчения витрэктомии глаза, для индуцирования заднего отслоения стекловидного тела, для расщепления витреомакулярной адгезии, для закрытия макулярных отверстий, для ферментного очищения раны, для снижения циркулирующего фибриногена, для снижения уровней α2-антиплазмина или совместно с трабекулэктомией.

В другом варианте осуществления для описанных выше двух аспектов настоящего изобретения выделенный плазминоген, плазмин, или любой их вариант или производное, или, соответственно, альтернативу по настоящему изобретению, или комбинацию любых из них, или композицию по настоящему изобретению можно применять для профилактических целей или в способах профилактического лечения. Профилактические применения включают снижение риска развития патологического отложения фибрина у млекопитающего с повышенным риском его развития (такого как страдающее ожирением млекопитающее, млекопитающее, которое не делает достаточных физических упражнений или млекопитающее, которому предписано серьезное хирургическое вмешательство или операция). Другие профилактические применения включают индукцию заднего отслоения стекловидного тела и/или разжижения стекловидного тела в явно здоровом глазу млекопитающего, у которого другой глаз, как показывает(показывала) диагностика, нуждается в индукции заднего отслоения стекловидного тела и/или разжижения стекловидного тела.

Альтернативно, настоящее изобретение относится к способам лечения, растворения, разрыхления, размягчения, лизирования, индуцирования или активации лизиса патологического отложения фибрина у субъекта, при этом указанные способы включают приведение в контакт указанного отложения фибрина с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного, или, соответственно, альтернативы по настоящему изобретению, или комбинации любых из них, при этом указанное приведение в контакт приводит к лечению, растворению, разрыхлению, размягчению, лизису или индукции или активации лизиса указанного патологического отложения фибрина.

Настоящее изобретение дополнительно относится к способам индуцирования заднего отслоения стекловидного тела глаза и/или индуцирования разжижения стекловидного тела глаза, или облегчения хирургической витрэктомии глаза у субъекта, при этом указанные способы включают приведение в контакт глаза указанного субъекта, нуждающегося в таком лечении, с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного, или, соответственно, альтернативы по настоящему изобретению, или комбинации любых из них, при этом указанное приведение в контакт приводит к индукции указанного заднего отслоения стекловидного тела и/или указанного разжижения стекловидного тела или к облегчению указанной хирургической витрэктомии.

Настоящее изобретение также относится к способам ферментного очищения раны поврежденной ткани субъекта, при этом указанный способ включает приведение в контакт указанной поврежденной ткани с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного, или, соответственно, альтернативы по настоящему изобретению, или комбинации любых из них, при этом указанное приведение в контакт приводит к указанному ферментному очищению раны указанной поврежденной ткани.

Другие способы настоящего изобретения представляют собой лечение или профилактику любого другого клинически важного симптома, включая способы снижения циркулирующего фибриногена или снижения уровней α2-антиплазмина у субъекта, при этом указанные способы включают приведение в контакт субъекта, нуждающегося в таком лечении, с эффективным количеством выделенного плазминогена, плазмина, или любого их варианта или производного, или, соответственно, альтернативы по настоящему изобретению, или комбинации любых из них, при этом указанное приведение в контакт приводит к указанному снижению циркулирующего фибриногена или указанных уровней α2-антиплазмина.

В основном, лекарственный препарат или композиция настоящего изобретения, что содержит плазмин (или любой его вариант или производное, или, соответственно, альтернативу) по настоящему изобретению, в зависимости от их конечного применения и способа введения, могут содержать один или несколько дополнительных активных ингредиентов, таких как антикоагулянт, дополнительное тромболитическое средство, противовоспалительное средство, противовирусное средство, антибактериальное средство, противогрибковое средство, антиангиогенное средство, антимитотическое средство, антигистамин или анестетик.

“Антикоагулянты” включают гирудины, гепарины, кумарины, низкомолекулярный гепарин, ингибиторы тромбина, ингибиторы тромбоцитов, ингибиторы агрегации тромбоцитов, ингибиторы фактора коагуляции, антитела к фибрину и ингибиторы фактора VIII (такие как те, что описаны в WO 01/04269 и WO 2005/016455).

“Тромболитические средства” включают плазмин дикого типа, плазминоген дикого типа, урокиназу, стрептокиназу, активатор плазминогена тканевого типа (tPA или альтеплаза), активатор плазминогена урокиназного типа (uPA) и стафилокиназу или любой вариант или производное любого из них, например, APSAC (анизоилированный активаторный комплекс стрептокиназы и плазминогена), ретеплаза, тенектеплаза, scuPA (одноцепочечный uPA) или комбинацию любых из них.

“Противовоспалительные средства” включают стероиды (например, преднизолон, метилпреднизолон, кортизон, гидрокортизон, преднизон, триамцинолон, дексаметазон) и нестероидные противовоспалительные средства (NSAID, например, ацетаминофрен, ибупрофен, аспирин).

“Противовирусные средства” включают трифлуридин, видарабин, ацикловир, валацикловир, фамцикловир и доксуридин.

“Антибактериальные средства” или антибиотики включают ампициллин, пенициллин, тетрациклин, окситетрациклин, фрамицетин, гатифлоксацин, гентамицин, тобрамицин, бацитрацин, неомицин и полимиксин.

“Антимикотические/фунгистатические/противогрибковые средства” включают флюконазол, амфотерицин, клотримазол, эконазол, итраконазол, миконазол, 5-фторцитозин, кетоконазол и натамицин.

“Антиангиогенные средства” включают антитела (или их фрагменты), такие как антитела к VEGF (фактор роста эндотелия сосудов) или к PlGF (плацентарный фактор роста), и средства, такие как макуген (пегаптаниб натрия), триптофанил-тРНК-синтаза (TrpRS), анекортав ацетат, пролекарство комбрестатин A4, AdPEDF (аденовектор, способный экспрессировать полученный из пигментного эпителия фактор), VEGF-ловушка, ингибитор VEGF рецептора-2, ингибиторы VEGF, PlGF или TGF-β, сиролимус (рапамицин) и эндостатин.

“Антимитотические средства” включают митомицин C и 5-фторурацил.

“Антигистаминное средство” включает кетитофена фумарат и фенирамина малеат.

“Анестетики” включают бензокаин, бутамбен, дибукаин, лидокаин, оксибупрокаин, прамоксин, пропаракаин, проксиметакаин, тетракаин и аметокаин.

“Приведение в контакт” в контексте данного документа означает любой способ введения, который приводит к взаимодействию между композицией, такой как лекарственный препарат, и тканью, жидкостью организма, органом, организмом и т. д., с которым указанная композиция контактирует. Взаимодействие между композицией и тканью, жидкостью организма, органом, организмом и т. д. может происходить, начинаясь немедленно или почти немедленно с введением композиции, может происходить в течение длительного периода времени (начинаясь немедленно или почти немедленно с введением композиции) или может быть отсроченным по отношению ко времени введения композиции.

Можно применять любой способ приведения в контакт патологического отложения фибрина, который обеспечивает (либо немедленно, либо отсрочено, либо в течение длительного периода времени) эффективное количество плазмина (или любого его варианта или производного, или, соответственно, альтернативы) для такого отложения фибрина. Если такое отложение фибрина связано со сгустком крови, то плазмин (или любой его вариант или производное, или, соответственно, альтернатива) может быть доставлен внутриартериально, внутривенно или местно (на малое расстояние от сгустка или даже в сгусток) посредством инъекции, и/или инфузии, и/или катетера.

При применении плазмина (или любого его варианта или производного, или, соответственно, альтернативы) в ферментативной обработке раны он может быть включен в гелеподобную композицию, которая может быть нанесена местно, или может быть нанесен в жидкой форме.

Можно применять любой способ приведения в контакт стекловидного тела глаза и/или водянистой влаги, который обеспечивает (ибо немедленно, либо отсрочено, либо в течение длительного периода времени) эффективное количество плазмина (или любого его варианта или производного, или, соответственно, альтернативы) к стекловидному телу и/или водянистой влаге. Один способ приведения в контакт стекловидного тела и/или водянистой влаги достигается одной или несколькими внутриглазными инъекциями непосредственно в стекловидное тело и/или водянистую влагу. Альтернативно, указанное приведение в контакт может включать субконъюктивальные, внутримышечные или внутривенные инъекции. Дополнительный альтернативный способ приведения в контакт включает помещение интравитреального имплантируемого устройства, такого как OCUSERT® (Alza Corp., Пало-Альто, Калифорния) или VITRASERT® (Bausch & Lomb Inc., Рочестер, Нью-Йорк). Приведение в контакт стекловидного тела и/или водянистой влаги с эффективным количеством плазмина (или любого его варианта или производного, или, соответственно, альтернативы) может происходить непрерывным способом с помощью состава пролонгированного, замедленного высвобождения или любого подходящего для этого имплантируемого устройства.

Выражение “эффективное количество” относится к режиму дозирования лекарственного препарата по настоящему изобретению, в частности, активного ингредиента лекарственного препарата по настоящему изобретению, т. е. плазмина или его активного процессированного варианта (или, следовательно, любой альтернативы, которая описана выше). Эффективное количество будет, как правило, зависеть от и нуждаться в регулировании относительно способа приведения в контакт или введения и состояния, которое подлежит лечению. Эффективное количество лекарственного препарата, более конкретно, его активного ингредиента, представляет собой количество, необходимое для получения желательного клинического результата или терапевтического или профилактического эффекта, не вызывая значительных или нежелательных токсических эффектов. Для получения или поддержания эффективного количества лекарственный препарат может быть введен как одна доза или в множественных дозах. Эффективное количество может дополнительно варьировать в зависимости от тяжести состояния, которое необходимо лечить, или предполагаемой тяжести состояния, которое необходимо предотвратить; оно может зависеть от общего состояния здоровья и физического состояния пациента, и обычно для установления того, каким является эффективное количество, необходима оценка лечащего врача или терапевта. Эффективное количество дополнительно может быть получено путем комбинации различных типов введения. Лекарственный препарат может быть введен в виде раствора (жидкого или полужидкого, например, гелеподобного или в дисперсии или суспензии, коллоидного, в эмульсии, суспензии наночастиц) или в виде твердой формы (например, таблетка, минитаблетка, капсулы с твердой или мягкой оболочкой).

При тромболизе дозировка плазмина и длительность терапии плазмином будет, как правило, зависеть от размера и расположения кровяного сгустка, а также от размера, веса и возраста пациента. Если сгусток является венозным, то лечение плазмином может продолжаться в течение нескольких дней, тогда как если сгусток является артериальным, то может быть необходимо лишь несколько часов терапии плазмином. Инфаркт миокарда можно лечить коротким лечением однократными дозами, тогда как состояния, такие как тромбофлебит и эмболия сосудов легких, могут требовать более длительного лечения многократными дозами. Пролонгированную непрерывную и/или периодическую тромболитическую терапию плазмином можно применять для лечения коронарной окклюзии или в случае профилактической терапии для того, чтобы снизить риск образования сгустка у субъектов, для которых известно, что они имеют повышенный риск развития образования сгустка. Дополнительный фактор, влияющий на дозировку плазмина, включает уровни циркулирующих в крови ингибиторов плазмина, таких как α2-антиплазмин и/или α2-макроглобулин, начальный уровень которых, при этом, зависит от пациента. Для достижения эффективной тромболитической терапии может быть целесообразно откорректировать дозировку плазмина так, чтобы оставалось не более 15% общего циркулирующего α2-антиплазмина. С целью индуцирования тромболиза может быть выгоден контактный способ доставки плазмина, или любого его варианта или производного, или, соответственно, альтернативы близко к тромбу, поскольку воздействие сывороточных ингибиторов снижается. Такой контактный способ, как правило, включает доставку посредством катетерного устройства. Для применения в тромболизе типичные дозировки плазмина находятся в диапазоне от 500 микрограмм/кг веса тела до 10 миллиграмм/кг веса тела, вводимые как одноразовая ударная доза вещества или разделенные на 1 начальную инъекцию ударной дозы вещества с последующей 1 или несколькими повторными инъекциями ударной дозы вещества. Альтернативно, плазмин можно вводить в течение длительного периода времени, например, путем инфузии или с помощью микронасоса для доставки лекарственного средства. Дозировки плазмина для продолжительного введения могут находиться в диапазоне от 1 до 10 мг/кг/час.

Типичная дозировка плазмина для индуцирования задней отслойки стекловидного тела, разжижения стекловидного тела, очищения от крови в стекловидном теле или кровоизлияний или очищения от токсичных материалов или посторонних веществ из полости стекловидного тела может быть в диапазоне от приблизительно 0,1 микрограмма до приблизительно 250 микрограмм на глаз на дозу, которая может быть доставлена в объеме разбавителя или носителя от приблизительно 50 микролитров до приблизительно 300 микролитров на глаз на дозу. Разбавитель или носитель может, например, быть стерильным сбалансированным солевым раствором (BSS или BSS Plus), физиологическим солевым раствором или раствором, содержащим 1-10 мМ кислоты, такой как лимонная кислота. В одном варианте осуществления плазмин доставляют к глазу в дозе 125 микрограмм, содержащихся в 0,1 мл разбавителя или носителя. В случае запланированной хирургической витрэктомии указанный плазмин может быть доставлен к глазу за 15-300 минут или 15-120 минут до витрэктомии. В альтернативном случае, целью введения плазмина в глаз является попытка избежать хирургической витрэктомии или облегчение последующей хирургической витрэктомии в случае, если сама по себе обработка плазмином не будет способна достигнуть полного заднего отслоения стекловидного тела. При применении плазминогена в качестве альтернативного источника плазмина (смотри определение “плазмин”) на каждый глаз можно ввести до 250 микрограмм плазминогена, и указанный плазминоген может сопровождаться до 2000 IU урокиназы или стрептокиназы в качестве активатора плазминогена или до 25 микрограмм tPA. При применении в глазу введение плазмина или плазминогена может дополнительно сопровождаться введением газообразного вспомогательного средства, такого как воздух, расширяющийся газ или сжижаемый газ, или их смеси при условии, что он не токсичен для глаза. Другие подходящие газообразные материалы включают SF6 (гексафторид серы) и перфторуглероды, такие как C2F6 (гексафторэтан), C3F8 (октафторпропан), C4F8 (октафторциклобутан), кислород, азот, диоксид углерода, аргон и другие инертные газы. Объем вводимого в глаз газообразного материала может изменяться в зависимости от газообразного материала, пациента и желаемого результата. Например, объем воздуха, который впрыскивают в заднюю камеру, может находиться в диапазоне от приблизительно 0,5 мл до приблизительно 0,9 мл. Другие газообразные материалы, такие как SF6 и газы-перфторуглероды, могут находиться в диапазоне от приблизительно 0,3 мл до 0,5 мл. Предпочтительно, газообразный материал вводят в заднюю камеру глаза в количестве, достаточном для сжатия стекловидного тела напротив задней гиалоидной мембраны и образования полости в стекловидном теле без повреждения глаза. В предпочтительных вариантах осуществления газообразное вспомогательное средство вводят в стекловидное тело с образованием полости, которая заполняет от приблизительно 40% до приблизительно 60% внутреннего объема внутриглазной полости.

Перечисленные выше дозировки являются показательными значениями, не подразумевающими, что они являются каким-либо образом ограничивающими. Указанные дозировки, кроме того, относятся к плазмину или плазминогену дикого типа или любому их активному или активируемому процессированному варианту. При применении плазмина с повышенной стабильностью по настоящему изобретению (или любого его варианта или производного, или, соответственно, альтернативы) и в зависимости от конечной стабильности и остаточной активности плазмина по настоящему изобретению дозировки могут быть сходными, более высокими или более низкими для того, чтобы получить такой же или лучший суммарный клинический эффект, чем получаемый с плазмином дикого типа. Дозировка плазмина по настоящему изобретению может также зависеть от скорости ингибирования эндогенными ингибиторами, такими как α2-антиплазмин.

В соответствии с раскрытой в данном документе работой настоящее изобретение дополнительно относится к способам скрининга в отношении аутопротеолитически стабильных вариантов плазмина, причем указанные способы включают этапы следующего:

(i) мутирование аминокислоты в положении [P+/-n] в аминокислоту, отличную от природной аминокислоты в положении [P+/-n], где аминокислота в положении P является аргинином или лизином, и где n равно 1, 2, 3, 4 или 5;

(ii) определение аутопротеолитической стабильности мутанта, полученного из (i), например, определенной как описано выше, например, посредством хромогенного анализа или анализа биологической активности к субстрату;

(iii) сравнение аутопротеолитической стабильности мутанта, определенного в (ii), с аутопротеолитической стабильностью плазмина дикого типа; и

(iv) отбор из (iii) мутанта, который является аутопротеолитически более стабильным, чем плазмин дикого типа, в качестве аутопротеолитически стабильного варианта;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

В вышеприведенном способе аминокислота в положении [P+/-n] предпочтительно не является лизином и не является аргинином.

Настоящее изобретение аналогично относится к способам скрининга в отношении аутопротеолитически стабильного варианта плазмина, причем указанные способы включают:

(i) мутирование аминокислоты глутамат в положении 138 каталитического домена плазмина человека или соответствующего глутамата плазмина, отличного от плазмина человека, в аминокислоту, отличающуюся от природной аминокислоты в указанном положении 138;

(ii) определение аутопротеолитической стабильности мутанта, полученного из (i), например, определенной или проанализированной как описано выше, например, посредством хромогенного анализа или анализа биологической активности к субстрату; и

(iii) отбор из (ii) мутанта, который является аутопротеолитически стабильным, в качестве аутопротеолитически стабильного варианта плазмина;

где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека.

В любом из вышеописанных способов скрининга указанный каталитический домен может дополнительно содержать мутацию лизина или аргинина дикого типа в одном или нескольких из положений P, P', P'' и т. д. в аминокислоту, не являющуюся лизином, аргинином.

Описанные выше способы скрининга могут дополнительно включать этап, где определяют протеолитическую активность аутопротеолитически стабильного варианта плазмина.

Многие продукты, включая медикаменты (здесь понимаемые, в частности, как готовый к применению активный ингредиент, т. е. в конечном составе для введения пациенту) и хранящиеся навалом активные ингредиенты медикаментов, обычно хранят в течение значительного количества времени перед применением. Необходимо увеличить срок хранения продуктов как можно дольше. Под сроком хранения подразумевают время, в течение которого продукт можно безопасно применять и в течение которого продукт сохраняет свою эффективную применимость, т. е. свою активность в случае медикамента и/или его активного ингредиента. Как правило, срок хранения указан на продукте или его упаковке. По истечению срока хранения безопасная и эффективная применимость продукта больше не гарантируется. Дополнительным важным аспектом в хранении продуктов является температура хранения, при которой может быть достигнут желательный срок хранения. Например, срок хранения продукта, хранящегося при+4°C или средней температуре холодильника, может составлять до 12 месяцев, тогда как срок хранения того же продукта, хранящегося при -20°C или средней температуре морозильной камеры, может составлять до 36 месяцев. Логично, однако, что поддержание холодовой цепи при температурах замораживания, например, -20°C, является более сложным, трудным и дорогим, чем поддержание холодовой цепи при+4°C. Таким образом, по-прежнему может быть желательно получение более короткого, но достаточно длительного срока хранения в сочетании с возможностью хранить продукт при+4°C. Настоящее изобретение предлагает решение для продления, увеличения или повышения срока хранения или стабильности при длительном хранении плазмина или любого его активного фрагмента или производного, или композиции, содержащей плазмин или любое его активное производное. Решение заключается в получении описанных в данном документе вариантов плазмина, при этом указанные варианты имеют увеличенную стабильность, которая, в сущности, повышает, увеличивает или продлевает их срок хранения.

Настоящее изобретение аналогично относится к способам увеличения стабильности при длительном хранении содержащей плазмин композиции, при этом указанные способы включают этап определения аутопротеолитически стабильного варианта плазмина, способного храниться в течение длительного периода времени без существенной потери протеолитической активности. Для определения долговременной стабильности отбирают аликвоту препарата плазмина по настоящему изобретению и многократно проводят измерения активности во время предусмотренного срока хранения. Если предусмотренный срок хранения составляет, например, 24 месяца, то измерения активности можно проводить, например, ежемесячно. Допустимая потеря протеолитической активности в конце предусмотренного срока хранения будет в большей степени зависеть от предусмотренного клинического применения, но, как правило, может быть не более, например, 10% - 15%.

Настоящее изобретение, кроме того, относится к способам получения варианта плазминогена по настоящему изобретению, т. е. получения плазминогена, содержащего в своем каталитическом домене мутацию по меньшей мере одной внутренней аминокислоты в положении [P+/-n] (где n является целым числом, выбранным из группы, состоящей из 1, 2, 3, 4 и 5), пептидная связь которой с внутренней аминокислотой в положении P склонна к аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P является менее склонной или не склонной к аутопротеолизу. Такие способы включают этапы слудующего:

(i) введения в подходящую клетку-хозяина нуклеиновой кислоты, кодирующей вариант плазминогена по настоящему изобретению, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;

(ii) выращивание клетки-хозяина, полученной в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине; и

(iii) сбор плазминогена, экспрессированного в (ii).

В конечном итоге, к таким способам может быть добавлен этап (iv), который включает очистку плазминогена, собранного в (iii).

Подходящие клетки-хозяева и способы экспрессии и получения раскрыты, например, в WO 90/13640 (клетки насекомых), WO 2002/050290 и WO 03/066842 (дрожжевые клетки), WO 2008/054592 (бактериальные клетки/процесс рефолдинга) и WO 2005/078109 (трансгенные растения ряски или клетки трансгенного растения).

Настоящее изобретение дополнительно охватывает способы получения варианта плазмина по настоящему изобретению, т. е. получения плазмина, содержащего в своем каталитическом домене мутацию по меньшей мере одной внутренней аминокислоты в положении [P+/-n] (где n является целым числом, выбранным из группы, состоящей из 1, 2, 3, 4 и 5), пептидная связь которой с внутренней аминокислотой в положении P склонна к аутопротеолизу, в аминокислоту, пептидная связь которой с внутренней аминокислотой в положении P является менее склонной или не склонной к аутопротеолизу. Такие способы, как правило, включают этапы получения плазминогена по настоящему изобретению, которые описаны выше, и дополнительно включают этап активирования плазминогена по настоящему изобретению до плазмина по настоящему изобретению с помощью подходящего активатора плазминогена (такого как tPA, uPA, урокиназа, стрептокиназа, стафилокиназа или любой его вариант). В конечном итоге могут быть добавлены один или несколько этапов, где плазминоген очищают до активации, очищают активированный плазмин и/или получают производные активного плазмина, как описано выше, и/или обратимо инактивируют, и/или, факультативно, доводят до подходящих условий хранения (например, стабилизирующий раствор, лиофилизация и/или низкая температура).

В любом из вышеописанных способов получения указанный каталитический домен может дополнительно содержать мутацию лизина или аргинина дикого типа в одном или нескольких из положений P, P', P'' и т. д. в аминокислоту, не являющуюся лизином, аргинином.

Любой из описанных выше вариантов плазминогена, вариантов плазмина или производных плазмина предпочтительно получают в свободной, или растворимой, форме, например, не прикрепленной к поверхности или не связанной с поверхностью экспрессирующего хозяина (как, например, в случае фагового дисплея).

Настоящее изобретение также относится к выделенной последовательности(ям) нуклеиновой кислоты, кодирующей вариант плазминогена или вариант плазмина по настоящему изобретению. Настоящее изобретение также относится к рекомбинантному вектору(ам), содержащему такую нуклеиновую кислоту. Настоящее изобретение также относится к клетке-хозяину(хозяевам), трансформированной такой нуклеиновой кислотой или таким рекомбинантным вектором.

ПРИМЕРЫ

ПРИМЕР 1. Построение, экспрессия и очистка вариантов плазминогена и активация до плазмина.

Вектор экспрессии

Вектор секреции pPICZαA, приобретенный у Invitrogene Corporation (Карлсбад, Калифорния), использовали для прямой экспрессии и секреции рекомбинантного микроплазминогена человека в Pichia pastoris.

Этот вектор содержит сигнал секреции препропептида α-фактора Saccharomyces cerevisiae. Последовательность распознавания XhoI присутствует на COOH-конце сигнала секреции α-фактора, непосредственно перед сайтом Lys-Arg, который расщепляется Kex2 с удалением сигнала секреции из зрелого белка. Этот сайт рестрикции XhoI можно применять для клонирования представляющего интерес гена наравне с сайтом расщепления Kex2 путем синтеза гена с сайтами распознавания XhoI и Kex2 на его 5' конце. Представляющий интерес рекомбинантный ген будет затем экспрессироваться с нативным NH2-концом. Сконструированный непосредственно ниже сигнала секреции α-фактора в pPICZαA вектор является сайтом множественного клонирования с сайтами распознавания для ферментов рестрикции EcoRI, SfiI, KpnI, SacII и XbaI для облегчения клонирования гетерологичных генов.

Синтез генов

Для увеличения экспрессии микроплазминогена человека в Pichia pastoris гены, кодирующие микроплазминоген человека и его варианты, синтезировали de novo, принимая во внимание предпочтительную частоту использования кодонов Pichia pastoris.

Для конструирования кодон-оптимизированной последовательности гена аминокислотную последовательность (SEQ ID NO:19) микроплазминогена человека вносили в программу Gene Designer, которая разработана DNA2.0 (Менло-Парк, Калифорния) и находится в свободном доступе в интернете. Эту последовательность обратно считали в последовательность ДНК с использованием предоставленной с программой таблицы частоты использования кодонов Pichia pastoris. Нуклеотидную последовательность затем проверяли вручную и доводили до лучшего соответствия частоты использования кодонов Escherichia coli. Кроме того, по возможности удаляли палиндромные последовательности из 6 пар оснований и нуклеотидные повторы. На 5' конце добавляли сайт рестрикции XhoI и сайт расщепления Kex2 и на 3' конце добавляли сайт рестрикции XbaI. Полученная последовательность раскрыта в международной патентной заявке №PCT/EP2010/059902.

Для изменения аминокислотных остатков вводили мутации сайт-направленным мутагенезом с помощью набора для сайт-направленного мутагенеза QuikChange II от Agilent (Ла-Хойя, Калифорния) в последовательность микроплазминогена дикого типа или в последовательности вариантного микроплазминогена, у которых уже были изменены специфические сайты аутокаталитического расщепления (см. международную патентную заявку №PCT/EP2010/059902). Штамм E.coli TOP10 (Invitrogen) трансформировали смесью для сайт-направленного мутагенеза и отбирали устойчивые к ампициллину клоны. Определение последовательности полученных плазмидных клонов подтверждало точный мутагенез целевой кодирующей области микроплазминогена, а также отсутствие нежелательных мутаций в кодирующей области.

Для сайт-направленного мутагенеза применяли следующие праймеры:

Мутация Glu138Gln

GTTCGGTGCTGGTCTGTTGAAACAGGCACAATTACCTGTGATTG (смысловая; SEQ ID NO:20) и

CAATCACAGGTAATTGTGCCTGTTTCAACAGACCAGCACCGAAC) (антисмысловая; SEQ ID NO:21).

В первом варианте глутамат в положении 138 заменен на глутамин. Glu138 кодируется кодоном GAA в положениях 481-483. Нуклеотиды GAA (положения 481-483) изменяли на CAG, изменяя Glu138 на Gln в белке микроплазминогена (нуклеотидная последовательность приведена в SEQ ID NO:22 и расшифрованная аминокислотная последовательность в SEQ ID NO:23).

Во втором варианте глутамат в положении 138 заменен на глутамин, как описано выше, у вариантного микроплазминогена, у которого лизин в положении 147 уже был заменен на глутамат (нуклеотидная последовательность приведена в SEQ ID NO:24 и расшифрованная аминокислотная последовательность в SEQ ID NO:25).

В третьем варианте глутамат в положении 138 заменен на глутамин, как описано выше, у вариантного микроплазминогена, у которого лизин в положении 147 уже был заменен на гистидин, и аргинин в положении 158 уже был заменен на гистидин (нуклеотидная последовательность приведена в SEQ ID NO:26 и расшифрованная аминокислотная последовательность в SEQ ID NO:27).

Экспрессия вариантов микроплазминогена и активация до плазмина

До активации мутанты микроплазминогена очищали с помощью иммуноаффинности непосредственно из супернатантов Pichia pastoris. Мышиное антитело к микроплазмину человека (индуцируемое у мышей Balb/c при применении микроплазмина в качестве антигена; продуцируемое гибридомной клеточной линией 5D10A4, доступной от ThromboGenics N.V.) связывали на сефарозных бусинах согласно протоколу № 71500015AD от GE Healthcare. Согласно этому протоколу 7,5 мл смолы для иммуноаффинной хроматографии получали из 45 мг антитела и упаковывали в колонку XK 16/20. На аффинную колонку 5D10A4 непосредственно нагружали 200-400 мл неочищенного супернатанта (отфильтрованного через фильтр 0,2 мкм из культуры Pichia/pH 6,0). После этапа промывки (100 мM KH2PO4, 0,5 M NaCl, pH 6,2, 10 объемов колонки) вариант микроплазминогена элюировали при помощи 0,2 M буфера глицин-HCl, pH 3,0, и элюат нейтрализовали и диализировали против 25 мM натрий-фосфатного буфера, pH 7,2).

Варианты микроплазмина активировали, следуя, по сути, процедуре, которая описана в Примере 2 WO 02/50290.

К примеру, вышеописанный мутантный микроплазминоген E138Q и соответствующий активированный микроплазмин показаны на Фигуре 3.

Аминокислотные последовательности и нуклеотидные последовательности описанных выше видов микроплазминогена дикого типа и вариантного микроплазминогена перечислены ниже.

SEQ ID NO:19 - Аминокислотная последовательность человеческого микроплазминогена дикого типа

apsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqstelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwiegvmrnn

SEQ ID NO:22 - Вариант микроплазминогена с заменой Glu138Gln (мутированный кодон показан жирным подчеркнутым курсивом, XhoI и XbaI подчеркнуты)

CTCGAGAAAAGAGCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGTTGAAACAGGCACAATTACCTGTGATTGAGAACAAGGTTTGTAACAGATACGAGTTCCTGAATGGTCGTGTTCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAATCTAGA

SEQ ID NO:23 - Расшифрованная аминокислотная последовательность SEQ ID NO:22 (подчеркнутые N-концевые аминокислоты “LEKR” кодируются введенными сайтами расщепления XhoI+Kex2; введенная мутация по аминокислоте указана жирным шрифтом/курсивом и подчеркнута)

LEKRAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKQAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN

SEQ ID NO:24 - Вариант микроплазминогена с заменами Glu138Gln и Lys147Glu (мутированные кодоны показаны жирным подчеркнутым курсивом, XhoI и XbaI подчеркнуты)

CTCGAGAAAAGAGCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGTTGAAACAGGCACAATTACCTGTGATTGAGAACGAAGTGTGTAACAGATACGAGTTCCTGAATGGTCGTGTTCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAATCTAGA

SEQ ID NO:25 - Расшифрованная аминокислотная последовательность SEQ ID NO:24 (подчеркнутые N-концевые аминокислоты “LEKR” кодируются введенными сайтами расщепления XhoI+Kex2; введенные мутации по аминокислотам указаны жирным подчеркнутым курсивом)

LEKRAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKQAQLPVIENEVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN

SEQ ID NO:26 - Вариант микроплазминогена с заменами Glu138Gln, Lys147His и Arg158His (мутированные кодоны показаны жирным подчеркнутым курсивом, XhoI и XbaI подчеркнуты)

CTCGAGAAAAGAGCACCTTCATTCGACTGTGGTAAGCCTCAGGTCGAACCTAAGAAGTGTCCAGGTCGTGTTGTCGGTGGCTGTGTGGCTCATCCTCATTCTTGGCCTTGGCAAGTGTCTCTTAGAACTAGATTTGGTATGCACTTCTGTGGTGGCACCTTGATCTCACCTGAATGGGTCTTAACCGCAGCTCATTGTCTGGAGAAGTCACCACGTCCATCTTCATACAAGGTCATCCTTGGCGCACATCAGGAAGTCAATCTTGAGCCTCATGTTCAGGAGATCGAAGTCTCTCGTTTGTTCTTGGAACCAACTCGTAAAGACATTGCTCTTCTGAAGCTGTCATCTCCTGCCGTGATTACCGACAAGGTAATTCCTGCCTGCTTGCCTAGTCCTAATTACGTCGTTGCCGACCGTACCGAATGCTTCATTACTGGTTGGGGTGAGACTCAAGGTACGTTCGGTGCTGGTCTGTTGAAACAGGCACAATTACCTGTGATTGAGAACCACGTGTGTAACAGATACGAGTTCCTGAATGGACACGTGCAGTCCACTGAGTTGTGTGCAGGTCACCTTGCAGGTGGTACTGATAGTTGTCAAGGTGATTCTGGTGGACCACTGGTGTGCTTCGAGAAGGATAAGTACATCTTACAAGGTGTTACGTCTTGGGGTCTTGGATGTGCTCGTCCTAACAAGCCAGGTGTCTACGTCAGAGTCTCCAGATTCGTAACTTGGATCGAAGGTGTCATGCGTAACAACTAATCTAGA

SEQ ID NO:27 - Расшифрованная аминокислотная последовательность SEQ ID NO:26 (подчеркнутые N-концевые аминокислоты “LEKR” кодируются введенными сайтами расщепления XhoI+Kex2; введенные мутации по аминокислотам указаны жирным подчеркнутым курсивом)

LEKRAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKQAQLPVIENHVCNRYEFLNGHVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN

Константы скорости аутолиза и кинетические параметры вариантов микроплазмина

Значения kкат/Km и константы скорости аутолиза, полученные для различных мутантов микроплазмина, приведены в Таблице 2 ниже. Эти значения получали, следуя, по сути, способам, описанным в Примерах 3 и 4 международной патентной заявки № PCT/EP2010/059902.

Таблица 2

Вариант микроплазмина Кинетические параметры
Kкат/Kм (M-1 с-1)
Константа скорости аутолиза
k (M-1 с-1)
Дикий тип 6,9x105 123
K147E 8,5x105 24
E138Q 9,5x105 4
E138Q K147E 10,9x105 2
E138Q K147H R158H 5,5x105 6

ПРИМЕР 2. Терапевтическая эффективность вариантов плазмина в моделях in vitro или in vivo.

2.1 Влияние вариантов плазмина на размер церебрального инфаркта.

Эффективность вариантов плазмина настоящего изобретения в снижении размера церебрального инфаркта может быть продемонстрирована в мышиной модели церебрального инфаркта, как, например, описанной в Примере 2 WO 00/18436 или согласно Welsh et al. (1987, J Neurochem 49, 846-851). Благоприятное влияние плазмина дикого типа на размер церебрального инфаркта было продемонстрировано в Примере 5 WO 00/18436. Сходный эксперимент проводят с любым из вариантов плазмина настоящего изобретения и благоприятное влияние этих вариантов плазмина измеряют и сравнивают с благоприятным влиянием плазмина дикого типа.

2.2 Тромболитическая активность вариантов плазмина in vivo

Для демонстрации in vivo тромболитической активности вариантов плазмина настоящего изобретения может быть использована кроличья модель тромболиза с экстракорпоральной петлей (Пример 6 WO 02/50290; Hotchkiss et al., 1987, Thromb Haemost 58, 107 - Abstract 377), модель тромбоза, индуцированного медной спиралью в огибающей ветви коронарной артерии собаки (Пример 8 WO 02/50290; Bergmann et al., 1983, Science 220, 1181-1183) или модель тромбоза яремной вены кролика (Collen et al., 1983, J Clin Invest 71, 368-376). С помощью этих моделей было продемонстрировано благоприятное влияние плазмина дикого типа на тромболиз, как описано в Примерах 7 и 9 WO 00/18436 и Collen et al. (1983). Сходные эксперименты проводят с любым из вариантов плазмина настоящего изобретения и благоприятное влияние этих вариантов плазмина измеряют и сравнивают с благоприятным влиянием плазмина дикого типа.

2.3 Тромболитическая активность вариантов плазмина in vitro

Модель закупорки периферической артерии (P AO) in vitro описана в Примере 6 WO 01/36609, и в этой модели была продемонстрирована тромболитическая эффективность плазмина дикого типа. Сходный эксперимент проводят с любым из вариантов плазмина настоящего изобретения и благоприятное влияние этих вариантов плазмина на тромболиз закупорок периферических артерий измеряют и сравнивают с благоприятным влиянием плазмина дикого типа.

2.4 Разжижение стекловидного тела глаза и заднее отслоение стекловидного тела, индуцированные вариантами плазмина

В Примере 5 WO 2004/052228 раскрыт анализ для определения эффективности, а также эффективность микроплазмина в разжижении стекловидного тела в глазах свиньи после смерти. В Примере 6 WO 2004/052228 раскрыт анализ для определения эффективности, а также эффективность микроплазмина в индукции заднего отслоения стекловидного тела (PVD) в глазах человека после смерти. Индукция разжижения стекловидного тела и PVD с помощью вариантов плазмина настоящего изобретения продемонстрирована в сходных посмертных моделях.

2.5 PVD in vivo, индуцированное вариантами плазмина

В Примере 7 WO 2004/052228 раскрыт анализ для определения эффективности, а также эффективность микроплазмина в индукции PVD в кошачьей модели in vivo. Индукция PVD вариантами плазмина настоящего изобретения показана в сходной модели in vivo.

1. Выделенный вариант плазминогена для получения аутопротеолитически стабильного плазмина, отличающийся тем, что он содержит в своем каталитическом домене замену глутаминовой кислоты на глутамин в положении 138 каталитического домена плазмина человека или в положении, соответствующем таковому в каталитическом домене плазмина, отличного от плазмина человека;
при этом указанный вариант плазминогена необязательно дополнительно содержит замену лизина на глутаминовую кислоту или гистидин в положении 147 каталитического домена плазмина человека или в положении, соответствующем таковому в каталитическом домене плазмина, отличного от плазмина человека; и/или
замену аргинина на гистидин в положении 158 каталитического домена плазмина человека или в положении, соответствующем таковому в каталитическом домене плазмина, отличного от плазмина человека;
при этом указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека с SEQ ID NO: 1.

2. Вариант плазминогена по п. 1, где указанный каталитический домен плазмина человека представляет собой каталитический домен, содержащийся в SEQ ID NOs: 1, 23, 25 или 27.

3. Вариант плазминогена по п. 1, где указанный плазминоген представляет собой Glu-плазминоген, Lys-плазминоген, мидиплазминоген, миниплазминоген, микроплазминоген, дельтаплазминоген.

4. Аутопротеолитически стабильный вариант плазмина, полученный из варианта плазминогена по любому из пп. 1-3.

5. Вариант плазмина по п. 4, дополнительно отличающийся тем, что его константа аутолиза составляет не более 95% константы аутолиза плазмина дикого типа.

6. Вариант плазмина по п. 4, дополнительно отличающийся тем, что каталитическая константа kкат находится в диапазоне от 10% до 200% kкат плазмина дикого типа.

7. Вариант плазмина по п. 4, дополнительно отличающийся тем, что его константа аутолиза составляет не более 95% константы аутолиза плазмина дикого типа, и его каталитическая константа kкат находится в диапазоне от 10% до 200% kкат плазмина дикого типа.

8. Вариант плазмина по пп. 4-7, где указанный плазмин представляет собой Glu-плазмин, Lys-плазмин, мидиплазмин, миниплазмин, микроплазмин или дельтаплазмин.

9. Вариант плазмина по любому из пп. 4-7, где указанный вариант плазмина находится в форме протеолитически активного или обратимо неактивного производного.

10. Способ получения варианта плазминогена по любому из пп. 1-3, при этом указанный способ включает этапы:
(i) введения нуклеиновой кислоты, кодирующей плазминоген по любому из пп. 1-3, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;
(ii) выращивания клетки-хозяина, полученной в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине; и
(iii) сбора плазминогена, экспрессированного в (ii).

11. Способ по п. 10, дополнительно включающий этап (iv), где плазминоген, собранный в (iii), очищают.

12. Способ получения варианта плазмина по любому из пп. 4-8, при этом указанный способ включает этапы:
(i) введения нуклеиновой кислоты, кодирующей плазминоген по любому из пп. 1-3, в подходящую клетку-хозяина, способную экспрессировать указанный плазминоген;
(ii) выращивания клетки-хозяина, полученной в (i), в условиях и в течение времени, достаточных для экспрессии указанного плазминогена в указанной клетке-хозяине;
(iii) сбора плазминогена, экспрессированного в (ii);
(iv) активации плазминогена из (iii) до плазмина.

13. Способ по п. 12, где плазминоген, собранный в (iii), очищают перед активацией в (iv).

14. Способ по п. 12 или 13, где активный плазмин, полученный в (iv), очищают.

15. Способ по любому из пп. 12 или 13, где получают производные активного плазмина и/или активный плазмин обратимо инактивируют.

16. Выделенная нуклеиновая кислота, кодирующая вариант плазминогена по любому из пп. 1-3.

17. Рекомбинантный вектор экспрессии, содержащий нуклеиновую кислоту по п. 16.

18. Клетка-хозяин, трансформированная нуклеиновой кислотой по п. 16, для экспрессии плазминогена, который кодируется указанной нуклеиновой кислотой.

19. Клетка-хозяин, трансформированная вектором по п. 17, для экспрессии плазминогена, который кодируется указанной нуклеиновой кислотой.

20. Выделенная нуклеиновая кислота, кодирующая вариант плазмина по любому из пп. 4-8.

21. Рекомбинантный вектор экспрессии, содержащий нуклеиновую кислоту по п. 20.

22. Клетка-хозяин, трансформированная нуклеиновой кислотой по п. 20, для экспрессии плазмина, который кодируется указанной нуклеиновой кислотой.

23. Клетка-хозяин, трансформированная вектором по п. 21, для экспрессии плазмина, который кодируется указанной нуклеиновой кислотой.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к получению вариантов плазминогена и плазмина, содержащих одну или несколько точковых мутаций в каталитическом домене, которые снижают или предотвращают аутокаталитическую потерю протеазной активности плазмина, и может быть использовано в медицине.

Изобретение относится к биотехнологии и представляет собой иммобилизованную на матрице стрептокиназу, активирующую плазминоген в плазмин. Такая стрептокиназа устойчива к расщеплению плазмином по сравнению с соответствующей ей стрептокиназой дикого типа и содержит аминокислотную последовательность, имеющую аспарагин в положениях, соответствующих положениям 85 и 412 в SEQ ID NO:1.

Изобретение относится к области биотехнологии и может быть использовано для выделения плазминогена или плазмина. .

Изобретение относится к получению высокоочищенных высокоактивных ферментных препаратов-активаторов плазминогена, которые могут быть использованы в биохимии и медицине.

Изобретение относится к области биохимии и может быть использовано в фармацевтической промышленности для очистки смесей природного происхождения, содержащих плазминоген и фибриноген, от плазминогена.
Изобретение относится к области физиологии и биохимии свертывания крови и цитологии и может быть применено в фармакологии и экспериментальной медицине. .

Изобретение относится к области биохимии, в частности к агенту для придания растению устойчивости к ингибитору 4-HPPD, включающему ДНК, кодирующую белок, обладающий активностью, придающей растению устойчивость к ингибитору 4-HPPD.

Данное изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий фрагмент, которые связываются с CD70 человека, охарактеризованные аминокислотными последовательностями CDR вариабельных доменов тяжелой и легкой цепи.

Настоящее изобретение относится к области биоинженерии и иммунологии. Предложен способ получения биспецифического антигенсвязывающего белка, включающего модифицированную тяжелую цепь первого антитела, которое специфически связывается с первым антигеном, С-конец которой дополнительно слит с N-концом VH-CH1 доменов первого антитела через пептидный коннектор; две легкие цепи первого антитела; модифицированную тяжелую цепь второго антитела, которое специфически связывается со вторым антигеном, в котором СН1-домен заменен на CL-домен второго антитела и С-конец дополнительно слит с N-концом VH-CL второго антитела через пептидный коннектор; и две модифицированные легкие цепи второго антитела, в которых CL-домен заменен на СН1-домен второго антитела, причем СН3-домены тяжелых цепей соприкасаются друг с другом по принципу "выступ-впадина" ("knobs-into-holes").

Изобретение относится к биотехнологии. Описан способ получения зрелых мегакариоцитарных клеток.

Данное изобретение относится к области иммунологии. Представлены моноклональное антитело и его фрагмент, которые связываются с K11-связанным полиубиквитином, охарактеризованные аминокислотными последовательностями гипервариабельных участков (HVR).

Изобретение относится к области биотехнологии. Описаны мыши, содержащие ограниченный локус тяжелой цепи иммуноглобулина.

Изобретение относится к области биотехнологии. Описана коллекция пар вариабельных участков тяжелых цепей и вариабельных участков легких цепей, включающих, в частности, белковые последовательности эмбрионального типа, которые предварительно отобраны по функциональным свойствам, относящимся к пригодности к разработке, где коллекции можно применять для выбора в отношении любого антигена, применяя, например, фаговый дисплей.

Изобретение относится к биотехнологии и иммунологии. Изобретение относится к генетически модифицированным мышам, которые экспрессируют λ-вариабельные последовательности человека (hVλ), в том числе к мышам, которые экспрессируют последовательности hVλ из эндогенного локуса λ-легкой цепи мыши, мышам, которые экспрессируют последовательности hVλ из эндогенного локуса κ-легкой цепи мыши, и мышам, которые экспрессируют последовательности hVλ из трансгена или эписомы, при этом последовательность hVλ соединена с константной последовательностью мыши.

Изобретение относится к биохимии. Предоставлена композиция для осуществления реакции замещения цепей нуклеиновых кислот, содержащая первый и второй комплексы нуклеиновых кислот, каждый из которых содержит первую, вторую, третью и четвертую цепи нуклеиновых кислот, где каждая из цепей содержит последовательно первый, второй и третий фрагменты.

Изобретение относится к области биотехнологии и может быть использовано для рекомбинантного получения мутантов фототоксического флуоресцентного белка. Рекомбинантным путем получают мутанты фототоксического флуоресцентного белка KillerRed.

Изобретение относится к области биохимии. Предложен антисмысловой олигонуклеотид, содержащий по меньшей мере одну модифицированную межнуклеотидную связь, который гибридизуется с природным антисмысловым полинуклеотидом аполипопротеина A1 (ApoA1) и повышает экспрессию молекул ApoA1 по сравнению с нормальным контролем.

Изобретение относится к области биотехнологии и может быть использовано для получения вариантов плазминогена и плазмина. Получают вариант плазминогена, содержащий в своем каталитическом домене замену глутаминовой кислоты на глутамин в положении 138 каталитического домена плазмина человека или в положении, соответствующем таковому в каталитическом домене плазмина, отличного от плазмина человека, где указанный каталитический домен плазмина человека начинается с аминокислоты валин в положении 1, которая является такой же аминокислотой валин, что встречается в положении 562 Glu-плазминогена человека с SEQ ID NO: 1. При этом указанный вариант плазминогена может также содержать замену лизина на глутаминовую кислоту или гистидин в положении 147 иили замену аргинина на гистидин в положении 158 каталитического домена плазмина человека. Изобретение позволяет получить аутопротеолитически стабильный вариант плазмина. 12 н. и 11 з.п. ф-лы, 14 ил., 2 табл., 2 пр.

Наверх