Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами

Авторы патента:


Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами
Способ получения агента, связывающегося с препро-вазопрессином или с его фрагментами

 


Владельцы патента RU 2607588:

Б.Р.А.Х.М.С. ГМБХ (DE)

Группа изобретений относится к медицине и касается способа получения связывающего агента или смеси связывающих агентов, способных связываться с эпитопом, содержащимся в аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина, состоящей из аминокислот 146-163, но не содержащей аминокислоту 164, где указанный способ включает стадии получения связывающего агента с использованием формирующего агента; определения способности связывающего агента связываться с аминокислотной последовательностью длиной по меньшей мере 12 аминокислот, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина; отбора связывающего агента из множества связывающих агентов. Группа изобретений также касается формирующего агента для получения связывающего агента или смеси связывающих агентов; применения связывающего агента для качественного или количественного детектирования препро-вазопрессина или его фрагментов в биологическом образце. Группа изобретений обеспечивает качественное или количественное детектирование препро-вазопрессина или его фрагментов в биологическом образце. 6 н. и 14 з.п. ф-лы, 1 пр., 5 ил., 2 табл.

 

Настоящее изобретение относится к способу получения и/или подтверждения получения агента, связывающегося с препро-вазопрессином или с его фрагментами, включая копептин; к связывающему агенту и к набору, содержащему указанный связывающий агент и используемому для качественного или количественного детектирования препро-вазопрессина или его фрагментов, включая копептин, присутствующих в биологическом образце, и к пептиду, используемому для получения агента, связывающегося с препро-вазопрессином или его фрагментами, включая копептин.

Предшествующий уровень техники

Препро-вазопрессин может быть процессирован в про-вазопрессин посредством отщепления сигнального пептида, а про-вазопрессин может быть затем процессирован в вазопрессин, нейрофизин-2 и копептин, где указанный копептин представляет собой С-концевую часть пептида-предшественника. Вазопрессин, также известный как антидиуретический гормон (ADH), представляет собой ключевой регулятор водно-солевого баланса. Определение уровня вазопрессина в биологических образцах с применением стандартных клинических методов почти невозможно из-за серьезных технических проблем, связанных с быстрым клиренсом вазопрессина из кровотока, его взаимодействием с тромбоцитами в сыворотке и небольшим размером, см. раздел «Библиография» [0039], [1-3]. Большой удачей оказалось установление того факта, что копептин, стехиометрически образующийся вместе с вазопрессином, может служить в качестве суррогатного маркера для вазопрессина. Главной причиной такого успеха можно считать очень высокую ex vivo стабильность копептина, позволяющую использовать его в стандартных методах [4-6].

Клинические исследования выявили множество показаний, при которых измерение уровня копептина позволяет получить очень ценную диагностическую информацию, включая сердечно-сосудистые заболевания, болезни легких, инфекционные заболевания, болезни почек, патологические нарушения водно-солевого баланса и другие [5]. Известными методами детектирования копептина являются иммуноанализы [4, 6].

Препро-вазопрессин и его фрагменты могут быть также экспрессированы эктопически при раковых заболеваниях некоторых типов, и антитела против копептина могут быть использованы для детектирования его экспрессии в образцах ткани (EP 1539818 A2).

Хотя в литературе были описаны иммуногены для получения антител против копептина, однако, очень мало известно, если вообще известно, о фактических эпитопах этих антител. Описанные антитела против человеческого копептина представлены в таблице 1. Ранее, никогда не возникал вопрос, существуют ли эпитоп-специфические антитела против копептина, и если эти антитела существуют, то как, при их использовании в методах детектирования, эти антитела будут влиять на точность и надежность детектирования препро-вазопрессина или его фрагментов, включая копептин, в биологических образцах. Было высказано предположение, что копептин является в высокой степени стабильным per se. Антитело, используемое для детектирования зрелого копептина, эпитоп которого, скорее всего, является неспецифическим и был определен как эпитоп, картированный «поблизости от С-конца копептина», поставляется фирмой Santa Cruz Biotechnology, Inc., Heidelberg, Germany, и это антитело было рекомендовано для использования в ELISA и в других целях.

Таблица 1
Антитело Источ-ник Иммуноген Эпитоп Ссылка
Анти-PATV17 антитело Овца CATQLDGPAGALLLRLV,
представляющий положения 132-147 препро-вазопрессина + N-концевой цистеиновый остаток
Не описан [6]
Анти-PLAY17 антитело Овца CLACAPEPFEPAQPDAY,
представляющий положения 149-164 препро-вазопрессина + N-концевой цистеиновый остаток
Не описан [6]
294/1A7 Мышь ATQLDGPAGALLLRLVQLAGA-PEPFEPAQPDAY, представляющий положения 132-164 препро-вазопрессина + N-концевой цистеиновый остаток GPAGAL, представляющий положения 137-144 препро-вазопрессина WO 2010049179 A1
H-065-32 Кролик ASDRSNATQLDCPAGALLLRL-VQLAGAPEPFEPAQPDAY, представляющий положения 126-164 препро-вазопрессина Не описан Phoenix Pharma-ceuticals, Burlingame, USA
MAB6077 (клон 579021) Мышь ASDRSNATQLDGPAG, представляющий положения 126-140 препро-вазопрессина Не описан R+D Systems, Minneapolis, USA
MAC-1 Мышь QLAGAPEPFEPAQPDAY, представляющий положения 148-164 препро-вазопрессина Не описан EP 1539818 A2
sc-7811 Обо-лочка Не описан «картирование эпитопа возле С-конца человеческого копептина» Santa Cruz Bio-techno-logy, Inc., Heidelberg, Germany

Описание изобретения

Настоящее изобретение относится к способу по п.1 формулы изобретения; к пептиду по п.10 формулы изобретения и к его применению по п.11 формулы изобретения; к связывающему агенту по п.12 формулы изобретения; к применению указанного связывающего агента по п.14 формулы изобретения; и к набору по п. 18 формулы изобретения. Предпочтительные варианты изобретения описаны в соответствующих зависимых пунктах формулы изобретения.

Более конкретно, в первом своем аспекте, настоящее изобретение относится к способу получения и/или подтверждения получения агента, связывающегося с препро-вазопрессином (SEQ ID NO. 1) или с его фрагментами, длиной по меньшей мере 6 аминокислот, включая копептин (SEQ ID NO. 2), где указанный способ включает по меньшей мере одну из нижеследующих стадий:

a) получения связывающего агента с использованием формирующего агента, содержащего аминокислотную последовательность длиной по меньшей мере в 6 аминокислот, содержащуюся в аминокислотной последовательности, соответствующей C-концевой части, но не содержащего аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1);

b) определения способности связывающего агента связываться с аминокислотной последовательностью длиной по меньшей мере в 4 аминокислоты, содержащейся в аминокислотной последовательности, соответствующей C-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1);

c) отбора и, необязательно, выделения связывающего агента из множества связывающих агентов, способных связываться с аминокислотной последовательностью, содержащейся в аминокислотной последовательности, соответствующей C-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1);

d) осуществления анализов на связывание со связывающим агентом в целях определения ex vivo стабильности препро-вазопрессина или его фрагментов длиной по меньшей мере в 6 аминокислот, включая копептин, в биологическом образце;

e) осуществления анализов на связывание со связывающим агентом и с другим связывающим агентом в целях сравнения для определения концентрации препро-вазопрессина или его фрагментов длиной по меньшей мере в 6 аминокислот, включая копептин, в биологическом образце;

где C-концевая часть состоит из аминокислот 138-164 препро-вазопрессина (SEQ ID NO. 1),

с получением связывающего агента или смеси связывающих агентов, способных связываться с эпитопом, содержащимся в аминокислотной последовательности, соответствующей аминокислотам 138-163, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1).

В основу главного аспекта настоящего изобретения был положен тот неожиданно обнаруженный факт, что фрагменты препро-вазопрессина, а особенно копептина, в биологических образцах не обладают такой уж высокой стабильностью per se, как это предполагалось ранее, и что стабильность аналита и точность и надежность детектирования непосредственно зависят от эпитопа, против которого направлены антитела, используемые в анализе по детектированию фрагментов, таких как копептин. В частности, было обнаружено, что исключение аминокислоты в положении 164 в С-концевой части препро-вазопрессина, как части эпитопа для агента, связывающегося с препро-вазопрессином или с его фрагментами, такими как копептин, играет очень важную роль с точки зрения точности детектирования и стабильности аналита. В соответствии с этим, указанный способ включает стадии подтверждения присутствия тех связывающих агентов, которые не требуют присутствия аминокислоты 164 в эпитопе аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина (SEQ ID NO. 1), то есть, аминокислотной последовательности, начинающейся с аминокислоты в положении 138 и далее. Как было обнаружено и подтверждено авторами настоящего изобретения, связывающие агенты, не требующие присутствия аминокислоты 164 в эпитопе для связывания, позволяют получить более точные и надежные результаты анализа, а поэтому они являются более подходящими для использования в анализах по детектированию препро-вазопрессина или его фрагментов, чем связывающие агенты, которым для связывания требуется присутствие указанной аминокислоты 164.

Было также показано, что в С-концевой части препро-вазопрессина, как части эпитопа для агента, связывающегося с препро-вазопрессином или с его фрагментами, может отсутствовать не только аминокислота 164, и что улучшенные результаты могут быть также получены даже, если отсутствует более, чем одна аминокислота. Более конкретно, в аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина (SEQ ID NO. 1), могут отсутствовать аминокислоты 163 и 164, предпочтительно, 162-164, а наиболее предпочтительно, аминокислоты 161-164. То есть, связывающий агент, который может быть получен способом согласно изобретению, не требует присутствия этих аминокислот в эпитопе для связывания с препро-вазопрессином или его фрагментами, включая копептин (SEQ ID NO. 2).

Используемые здесь термины «препро-вазопрессин» и «копептин» включают также аминокислотные последовательности, которые только на 75%, предпочтительно, по меньшей мере на 80%, а более предпочтительно, по меньшей мере на 90% гомологичны препро-вазопрессину и копептину соответственно. То же самое относится не только к копептину, но и к другим фрагментам препро-вазопрессина. Термин «фрагменты» препро-вазопрессина означает фрагменты длиной по меньшей мере в 6 аминокислот, предпочтительно, по меньшей мере в 8 аминокислот, более предпочтительно, по меньшей мере в 10 аминокислот, а наиболее предпочтительно, по меньшей мере в 12 аминокислот.

Способ согласно изобретению включает несколько путей получения и/или подтверждения получения подходящих связывающих агентов, которым для связывания не требуется присутствия аминокислоты 164, как описано выше, и которые могут быть использованы отдельно или в комбинации друг с другом. Первый возможный путь описан в стадии (a) и относится к целевому и селективному продуцированию связывающего агента с использованием подходящего формирующего агента, селективно образующего нужный связывающий агент. Более конкретно, формирующий агент включает аминокислотную последовательность, содержащуюся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1). То есть, указанный формирующий агент содержит аминокислотную последовательность длиной по меньшей мере в 6 аминокислот, которая соответствует по меньшей мере части аминокислотной последовательности, простирающейся от аминокислоты 138 до аминокислоты 164 препро-вазопрессина, но не имеющей аминокислоты 164. С использованием формирующего агента, где отсутствует аминокислота 164, можно получить связывающий агент или смесь связывающих агентов, для связывания с которыми не требуется присутствия указанной аминокислоты 164. (Используемый ниже термин «связывающий агент», если это не оговорено особо, означает связывающий агент одного типа или смесь связывающих агентов различных типов). В принципе, стадия (a) позволяет осуществлять селективное и непосредственное продуцирование нужного связывающего агента и не требует проведения дополнительных стадий для удаления связывающих агентов, которым для связывания требуется присутствие указанной аминокислоты 164. Однако это не исключает возможности проведения после стадии (a) дополнительных стадий, таких как характеристика, очистка, отбор и выделение.

В контексте настоящего изобретения, аминокислотная последовательность, содержащаяся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1), и используемая для получения связывающего агента, в принципе, может быть получена путем синтеза, либо она может происходить от природной аминокислотной последовательности. Такая последовательность может быть линейной или иметь складчатую структуру. Указанная аминокислотная последовательность, в принципе, может иметь любую длину, а именно, в 6 или более аминокислот, подходящую для получения нужного связывающего агента или для достижения эффективного связывания с указанным связывающим агентом. В принципе, она может соответствовать любой аминокислотной последовательности в пределах от аминокислоты 138 до аминокислоты 163 препро-вазопрессина. Предпочтительно, аминокислотная последовательность содержится в последовательности из аминокислот 140-163, более предпочтительно, 142-163, еще более предпочтительно, 144-163, а наиболее предпочтительно, 146-163 препро-вазопрессина (SEQ ID NO. 1). Подходящая аминокислотная последовательность имеет по меньшей мере 8 аминокислот, предпочтительно, по меньшей мере 10 аминокислот, а наиболее предпочтительно, по меньшей мере 12 аминокислот. В частности, указанная аминокислотная последовательность содержит по меньшей мере 6, предпочтительно, по меньшей мере 8, более предпочтительно, по меньшей мере 10, а наиболее предпочтительно, по меньшей мере 12 непрерывно следующих друг за другом аминокислот, содержащихся в аминокислотной последовательности, соответствующей аминокислотам 146-163 препро-вазопрессина (SEQ ID NO. 1).

Используемый здесь термин «связывающий агент» означает любое вещество, способное связываться с эпитопом, содержащимся в аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина (SEQ ID NO. 1). Этот связывающий агент обычно имеет адекватную форму, а также соответствующие пространственные и поверхностные свойства, такие как поверхностный заряд, гидрофобность, гидрофильность, присутствие или отсутствие доноров и/или акцепторов Льюиса, подходящие для специфического связывания с молекулами-мишенями или с представляющими интерес молекулами, то есть, с препро-вазопрессином или с его фрагментами, включая копептин. Таким образом, связывание может, например, опосредоваться ионными взаимодействиями, ван-дер-ваальсовыми взаимодействиями, пи-пи-взаимодействиями, сигма-пи-взаимодействиями, гидрофобными взаимодействиями или взаимодействиями посредством водородных связей, или комбинациями двух или более из вышеупомянутых взаимодействий между связывающим агентом и молекулами-мишенями или представляющими интерес молекулами. Такие связывающие агенты могут быть выбраны из группы, состоящей из антител и аптамеров, но не ограничивающейся ими.

Предпочтительно, указанным связывающим агентом является антитело, а более предпочтительно, моноклональное антитело, поликлональная антисыворотка, обогащенное или очищенное поликлональное антитело, рекомбинантное антитело или их функциональные производные. Используемый здесь термин «антитело», если это не оговорено особо, употребляется в своем широком смысле и означает молекулы антитела и ряд молекул, происходящих от антитела. Такие молекулы, происходящие от антитела, содержат по меньшей мере одну вариабельную область (вариабельную область тяжелой цепи или легкой цепи), а также отдельные легкие цепи антител, отдельные тяжелые цепи антител, химерные гибриды между цепями антител и других молекул и т.п. Функциональными иммуноглобулиновыми фрагментами согласно изобретению могут быть Fv; scFv; Fv, связанный дисульфидным мостиком; Fab и F(ab’)2. Термин «антитело» также включает поликлональные антитела, моноклональные антитела, а предпочтительно, антитела IgG1, химерные моноклональные антитела, гуманизованные антитела, генетически сконструированные моноклональные антитела. Функциональные производные представляют собой химически и/или биологически модифицированные варианты антител/антисыворотки, имеющие аналогичные функциональные свойства/связывающую способность. Аналогичным образом, формирующий агент может представлять собой любое вещество, подходящее для получения связывающего агента согласно изобретению. Предпочтительным формирующим агентом является иммуноген, а наиболее предпочтительно, природный или синтетический пептид, включающий аминокислотную последовательность длиной по меньшей мере в 6 аминокислот, содержащуюся в аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина (SEQ ID NO. 1).

Используемый здесь термин «формирующий агент» означает вещество, родственное сайту связывания и используемое для получения связывающего агента, например, аминокислотной последовательности. Формирующий агент может состоять из аминокислотной последовательности, описанной выше, либо он может содержать аминокислотную последовательность как функциональную часть соединения. Так, например, формирующий агент может также содержать связывающую часть, такую как другая аминокислотная последовательность. Предпочтительно, формирующий агент выбран из группы, включающий пептиды, состоящие из аминокислот 146-163 (SEQ ID NO. 7), 146-162 (SEQ ID NO. 8), 146-161 (SEQ ID NO. 9), 146-160 (SEQ ID NO. 10), 146-159 (SEQ ID NO. 11), 146-158 (SEQ ID NO. 12) и 146-157 (SEQ ID NO. 13) препро-вазопрессина (SEQ ID NO. 1). Эти пептиды и их применение в способе согласно изобретению также являются частью настоящего изобретения. Способы получения связывающих агентов, а в частности, антител с использованием пептидов, по существу, известны специалистам, а поэтому нет необходимости описывать их в настоящей заявке.

В стадии (b) согласно изобретению определяют способность связывающего агента связываться с аминокислотной последовательностью, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1). В этом случае, а также в стадии (c), аминокислотные последовательности и С-концевая часть определены как это указано выше в стадии (a), за исключением того, что длина аминокислотной последовательности по меньшей мере в 4 аминокислоты рассматривается как достаточная для определения связывания. Предпочтительно, указанная аминокислотная последовательность содержит по меньшей мере 6, предпочтительно, по меньшей мере 8, более предпочтительно, по меньшей мере 10, а наиболее предпочтительно, по меньшей мере 12 непрерывно следующих друг за другом аминокислот, содержащихся в аминокислотной последовательности, соответствующей аминокислотам 146-163 препро-вазопрессина (SEQ ID NO. 1), а предпочтительно, она представляет собой аминокислотную последовательность, выбранную из группы, состоящей из аминокислот 146-163 (SEQ ID NO. 7), 146-162 (SEQ ID NO. 8), 146-161 (SEQ ID NO. 9), 146-160 (SEQ ID NO. 10), 146-159 (SEQ ID NO. 11), 146-158 (SEQ ID NO. 12) и 146-157 (SEQ ID NO. 13) препро-вазопрессина (SEQ ID NO. 1).

Стадия (b) может быть проведена, например, как дополнение к стадии (a) в целях подтверждения пригодности данного связывающего агента, полученного в стадии продуцирования. Однако, более предпочтительно, стадия (b) может быть проведена для того, чтобы определить, является ли связывающий агент, если он не был получен с использованием селективного формирующего агента, как описано в стадии (a), и, если не ясно, необходима ли аминокислота 164, присутствующая в эпитопе, для связывания, фактически способным связываться с аминокислотной последовательностью длиной по меньшей мере в 4 аминокислоты, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1). Это также относится к смесям связывающих агентов, где может оказаться необходимым определить, содержат ли эти смеси связывающие агенты, которым, для их эффективного связывания, требуется присутствие аминокислоты 164 в эпитопе. Если это подтвердится, то такие нежелательные связывающие агенты могут быть, затем удалены в последующей стадии.

Стадия (b) может быть проведена с применением любого подходящего метода определения, известного специалисту. Предпочтительным способом определения способности связывающего агента связываться с аминокислотной последовательностью длиной по меньшей мере в 4 аминокислоты, соответствующей аминокислотной последовательности С-концевой части препро-вазопрессина, является картирование эпитопов. Способ картирования эпитопов известен специалистам. Картирование эпитопов представляет собой способ идентификации сайтов связывания или «эпитопов» связывающих агентов на их антигенах-мишенях. Существует два типа общих структур, которые используются связывающими агентами для связывания с антигенами, а именно, линейная и конформационная структура. Линейные эпитопы образованы непрерывной последовательностью аминокислот белка, а конформационные эпитопы состоят из аминокислот, которые имеют дискретную последовательность белка, но все вместе они образуют трехмерную укладку белка. Существует несколько методов картирования эпитопов для связывания на антигенах-мишенях. Метод, называемый «золотым стандартом», представляет собой комбинированный метод рентгеновской кристаллографии, который позволяет непосредственно визуализировать взаимодействие между антигеном и связывающим агентом. Однако, осуществление этого способа связано с определенными техническими трудностями, поскольку он требует больших количеств очищенного белка и больших затрат времени и средств. Альтернативой способу картирования эпитопов является пептидное сканирование. Этот метод заключается в использовании библиотеки коротких пептидных последовательностей, происходящих от перекрывающихся сегментов белка-мишени, и в проведении тестов на их способность связываться с представляющим интерес антителом. Этот метод является более быстрым и относительно не дорогостоящим, однако, он применяется, главным образом, для картирования линейных, а не конформационных эпитопов. Для того чтобы определить, может ли связывающий агент связываться с соответствующей аминокислотной последовательностью, указанная аминокислотная последовательность может быть прямо или опосредованно присоединена к твердой фазе. Аминокислотная последовательность для непрямого связывания может содержать эту аминокислотную последовательность как функциональную часть соединения. Так, например, указанная аминокислотная последовательность может дополнительно содержать связывающую часть, такую как биотин. Биотинилированные аминокислотные последовательности могут быть иммобилизованы посредством стрептавидина, авидина, нейтравидина или каптавидина, которые непосредственно связаны с твердой фазой. Поскольку биотин связывается со стрептавидином, авидином, нейтравидином или каптавидином с очень высокой аффинностью и специфичностью, то впоследствии, аминокислотную последовательность, тестируемую на связывание с соответствующим связывающим агентом, опосредованно присоединяют к твердой фазе с использованием комплекса «биотин/стрептавидин». Другим методом картирования эпитопов является сайт-направленный мутагенез. При применении такого метода, системные мутации аминокислот вводят в последовательность белка, а затем определяют уровень специфического связывания связывающего агента в целях идентификации аминокислот, составляющих эпитоп. Этот способ целесообразно использовать для картирования линейных и конформационных эпитопов, однако, он является довольно трудоемким и требует много времени, а поэтому, анализ обычно ограничивается только небольшим числом аминокислотных остатков. Все эти методы могут быть применены в стадии (b) согласно изобретению. Однако в этом способе предпочтительно оценивать уровень связывания связывающего агента с вариантами связывающей области. Такие варианты могут быть усеченными, мутированными, удлиненными или как-либо иначе модифицированными вариантами связывающей области, которые обычно получают методами химического синтеза или методами молекулярной биологии в виде рекомбинантных пептидов/белков. Следует отметить, что на интерпретацию экспериментальных данных картирования эпитопов могут существенно влиять условия проведения эксперимента, такие как, например, количество мишеней для связывания, концентрации используемого связывающего агента, применяемый метод детектирования, созданные условия инкубирования и т.п. Тем не менее, этот метод известен специалистам, а поэтому он также может быть принят во внимание.

Если, например, окажется, что в описанной выше стадии определения (b) была получена смесь связывающих агентов или если указанный способ приводит к получению смеси связывающих агентов, а указанная смесь содержит нежелательные связывающие агенты, которым, для их эффективного связывания требуется аминокислота 164, присутствующая в эпитопе, то такие нежелательные связывающие агенты либо должны быть удалены, либо по меньшей мере должно быть уменьшено их количество. Для этих целей, в этот способ согласно изобретению была включена стадия (c), где нужный связывающий агент, которому не требуется для связывания аминокислоты 164, присутствующей в эпитопе препро-вазопрессина, и который дает улучшенные результаты анализа, был выбран так, чтобы он мог быть отделен от нежелательного связывающего агента. Такая стадия отбора может быть осуществлена любым способом, подходящим для селективного отбора нужного связывающего агента в целях увеличения его количества по сравнению с количеством нежелательного связывающего агента. Предпочтительным способом достижения этой цели является аффинное разделение. В этом способе используются различные связывающие свойства разделенных молекул. Наиболее распространенным способом является аффинная хроматография, в которой лиганд, специфичный к сайту связывания молекулы-мишени, присоединяют к инертной хроматографической матрице. При этих условиях связывания, такой специфический лиганд, присутствующий на хроматографической матрице, будет связываться с молекулами только специфически. Все другие компоненты образца будут проходить через хроматографическую среду в несвязанном виде. После стадии промывки, связанные молекулы могут быть затем подвернуты высвобождению и элюированию путем изменения условий в сторону диссоциации или путем добавления избытка вещества, которое будет вытеснять молекулу-мишень из аффинного лиганда (конкурентное элюирование). Таким образом, связывающий агент может присутствовать в выделенной или очищенной форме. Однако настоящее изобретение не ограничивается вышеуказанными стадиями отбора, очистки и выделения, и это означает, что могут быть применены и любые другие подходящие методы.

Для того, чтобы определить, требует ли связывающий агент присутствия аминокислоты 164 препро-вазопрессина в эпитопе для связывания, могут быть также проведены анализы на связывание в соответствии со стадиями (d) и (e) согласно изобретению. Обе эти стадии позволяют проводить опосредованную характеризацию специфичности связывающего агента к эпитопу и таким образом, подтвердить пригодность данного связывающего агента.

Используемый здесь термин «анализ» может означать анализ любого типа, применяемый в области диагностики. Такой анализ может быть проведен на основе связывания детектируемого аналита с одним или более зондами для захвата с определенной аффинностью. Что касается взаимодействия между молекулами для захвата и молекулами-мишенями или представляющими интерес молекулами, то их константа аффинности, предпочтительно, превышает 108 M-1. «Молекулами для захвата» являются молекулы, которые могут быть использованы для связывания с молекулами-мишенями или с представляющими интерес молекулами. Таким образом, молекулы для захвата должны иметь адекватную форму с точки зрения пространственных и поверхностных свойств, таких как поверхностный заряд, гидрофобность, гидрофильность, присутствие или отсутствие доноров и/или акцепторов Льюиса, подходящих для специфического связывания с молекулами-мишенями или с представляющими интерес молекулами. Как упоминалось выше, такое связывание может быть опосредовано, например, ионными взаимодействиями, ван-дер-ваальсовыми взаимодействиями, пи-пи-взаимодействиями, сигма-пи-взаимодействиями, гидрофобными взаимодействиями или взаимодействиями посредством водородных связей, или комбинациями двух или более из вышеупомянутых взаимодействий между молекулами для захвата и молекулами-мишенями или представляющими интерес молекулами.

Указанные анализы могут быть осуществлены в различных форматах, таких как, например, радиоиммуноанализ (РИА), хемилюминесцентные и флуоресцентные иммуноанализы, твердофазные иммуноферментные анализы (ELISA), анализы с использованием массивов сфер на основе Luminex, анализы с использованием микромассивов белков и анализы в формате экспресс-тестов, такие как, например, иммунохроматографические тест-полоски.

Такие анализы могут быть гомогенными или гетерогенными, конкурентными и неконкурентными. В особенно предпочтительном варианте изобретения, указанный анализ проводят в форме «сэндвич-анализа», представляющего собой неконкурентный иммуноанализ, в котором детектируемую и/или количественно оцениваемую молекулу присоединяют к первому антителу и ко второму антителу. Первое антитело может быть связано с твердой фазой, например, со сферой, с поверхностью лунки или другого контейнера, а также с чипом или с полоской, а вторым антителом является антитело, которое было помечено, например, красителем, радиоизотопом или реакционноспособной или каталитически активной молекулой. Затем, количество меченого антитела, связанного с аналитом, определяют с применением соответствующего метода. Общая схема и процедуры «сэндвич-анализов» подробно описаны в литературе и известны специалистам (см. руководство The Immunoassay Handbook, Ed. David Wild, Elsevier LTD, Oxford; 3rd ed. (May 2005), ISBN-T3: 978-0080445267; Hultschig C et al., Curr Opin Chem Biol. 2006 Feb; 10(1):4-10. PMID: 16376134, которое вводится в настоящее описание посредством ссылки).

В особенно предпочтительном варианте изобретения, в указанном анализе используют две молекулы для захвата, предпочтительно, антитела, которые присутствуют в виде дисперсий в жидкой реакционной смеси, где первый компонент для мечения присоединен к первой молекуле для захвата и является частью системы мечения, проводимого на основе гашения флуоресценции или хемилюминесценции или амплификации, а второй компонент для мечения, входящий в указанную систему мечения, присоединен ко второй молекуле для захвата, так, чтобы после связывания обеих молекул для захвата с аналитом генерировался измеримый сигнал, позволяющий детектировать образовавшиеся ««сэндвич»-комплексы в растворе, содержащем указанный образец.

Еще более предпочтительно, чтобы указанная система мечения содержала редкоземельные криптаты или редкоземельные хелаты в комбинации с флуоресцентным красителем или с хемилюминесцентным красителем, а в частности, с красителем цианинового типа.

В стадии (d), анализ на связывание осуществляют с использованием связывающего агента для определения ex vivo стабильности препро-вазопрессина или его фрагментов, включая копептин, в биологическом образце. Как было показано в настоящем изобретении, стабильность аналита была выше в том случае, когда использовался связывающий агент, которому для связывания не требуется присутствия аминокислоты 164 препро-вазопрессина или его фрагмента, по сравнению со связывающим агентом, для связывания которого требовалось присутствие указанной аминокислоты 164. Следовательно, по стабильности аналита можно сделать выводы относительно типа связывающего агента. Такими аналитами, имеющими наивысшую стабильность, являются аналиты, для связывания которых не требуется присутствия аминокислоты 164, а поэтому, такие связывающие агенты являются предпочтительными с точки зрения настоящего изобретения. Связывающие агенты, для связывания которых, как уже известно, не требуется присутствия аминокислоты 164, могут быть использованы в целях сравнения, то есть, стабильность аналита, связанного с этими сравниваемыми связывающими агентами, может быть использована в качестве стандарта, с которым можно сравнивать стабильность аналита, оцениваемую для новых связывающих агентов.

В стадии (e), которая может быть проведена в качестве альтернативы стадии (d) или дополнения к стадии (d), также используется другой связывающий агент для сравнения, а анализы на связывание осуществляют с использованием этого связывающего агента для сравнения и нового связывающего агента для определения концентрации препро-вазопрессина или его фрагментов, включая копептин, в биологическом образце. Связывающим агентом, подходящим для сравнения, является связывающий агент, которому, как уже известно, для связывания с указанным эпитопом не требуется присутствия указанной аминокислоты 164 препро-вазопрессина. Как и ожидалось, новый связывающий агент, которому для связывания с указанным эпитопом также не требовалось присутствия указанной аминокислоты 164 препро-вазопрессина, давал в результате аналогичные или более высокие концентрации препро-вазопрессина или его фрагментов, включая копептин, в биологическом образце, при сравнении со связывающим агентом, используемым для сравнения, тогда как связывающие агенты, требующие присутствия указанной аминокислоты 164, как и ожидалось, давали более низкие концентрации.

Как уже упоминалось выше, способ согласно изобретению может включать только одну из стадий (a)-(e). Так например, он может состоять только из стадии (a), стадии (b), стадии (c), стадии (d) или стадии (e). Однако, такой способ также включает комбинации из двух или более стадий (a)-(e), которые могут быть проведены в любом подходящем порядке. Так, например, после стадии получения, которая, предположительно, может давать смесь, содержащую желательные и нежелательные связывающие агенты, может быть проведена стадия анализа, такая как стадия (b), (d) или (e), а после нее может быть проведена, но необязательно, стадия отбора нужных связывающих агентов, которая может быть осуществлена в соответствии со стадией (с), а затем, если это необходимо, может быть проведена стадия выделения, с получением большого количества нужного связывающего агента (который, как упоминалось выше, может представлять собой смесь нужных связывающих агентов).

С применением способа согласно изобретению, включающего по меньшей мере одну из стадий (a)-(e), можно получить такие связывающие агенты, которые будут эффективно связываться с эпитопом, содержащимся в аминокислотной последовательности, соответствующей аминокислотам 138-163, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1), где указанными связывающими агентами, как было неожиданно обнаружено авторами изобретения, являются связывающие агенты, которым, для их эффективного связывания, не требуется присутствия аминокислоты 164 в эпитопе аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина. Таким образом, более точные результаты анализа могут быть получены с помощью связывающего агента, продуцированного способом согласно изобретению, или набора, содержащего указанный связывающий агент, и использованы для качественного или количественного детектирования препро-вазопрессина или его фрагментов, включая копептин, в биологическом образце.

Биологический образец, может представлять собой физиологическую жидкость любого типа, предпочтительно, выбранную из группы, включающей кровь, сыворотку, плазму, мочу, цереброспинальную жидкость и слюну. Предпочтительным образцом является проба крови, а наиболее предпочтительно, проба сыворотки или проба плазмы. Если это необходимо, то образец, перед его применением в соответствии с настоящим изобретением, может быть подвергнут гомогенизации или экстракции растворителем с получением жидкого образца. Таким образом, жидким образцом может быть раствор или суспензия. Жидкие образцы, перед их применением в соответствии с настоящим изобретением, могут быть подвергнуты одной или более стадиям предварительной обработки. Такой предварительной обработкой являются, но не ограничиваются ими, разведение, фильтрация, центрифугирование, концентрирование, седиментация, осаждение и диализ. Предварительная обработка может также включать добавление к раствору химических или биохимических веществ, таких как кислоты, основания, буферы, соли, растворители, реакционноспособные красители, детергенты, эмульгаторы, хелатообразующие агенты.

В контексте настоящего описания, «плазма» представляет собой фактически бесклеточный супернатант крови, содержащий антикоагулянт, полученный после центрифугирования. Репрезентативными антикоагулянтами являются соединения, связывающиеся с ионами кальция, такие как EDTA или цитрат, и ингибиторы тромбина, такие как гепаринаты или гирудин. Бесклеточная плазма может быть получена путем центрифугирования крови, обработанной антикоагулянтами (например, крови, обработанной цитратом, EDTA или гепарином), в течение по меньшей мере 15 минут при 2000-3000×g. Поэтому, предпочтительно, чтобы пробы плазмы согласно изобретению были подвергнуты центрифугированию при более, чем 1500×g в течение 30 минут, предпочтительно, по меньшей мере при 2000×g в течение по меньшей мере 30 минут, более предпочтительно, по меньшей мере при 3000×g в течение по меньшей мере 20 минут, а наиболее предпочтительно, по меньшей мере при 3000×g в течение по меньшей мере 30 минут.

В контексте настоящего описания, «сыворотка» представляет собой неразведенную внеклеточную часть крови после ее адекватного свертывания. Свертывание крови обычно происходит за 30 минут. Сыворотка может быть получена путем центрифугирования пробы свернутой крови в течение по меньшей мере 10 минут при скорости минимум 1500×g. Поэтому, предпочтительно, чтобы проба сыворотки согласно изобретению была подвергнута центрифугированию при скорости по меньшей мере 1500×g в течение по меньшей мере 10 минут, предпочтительно, по меньшей мере в течение 15 минут, а более предпочтительно, по меньшей мере в течение 20 минут. Наиболее предпочтительно, чтобы проба сыворотки была подвергнута центрифугированию при скорости по меньшей мере 3000×g в течение по меньшей мере 20 минут.

Надежность результатов при определении препро-вазопрессина или его фрагментов может быть даже увеличена с использованием, помимо связывающего агента согласно изобретению, по меньшей мере одного другого связывающего агента. Такой другой связывающий агент, в отличие от связывающего агента согласно изобретению, соответственно связывается с другим эпитопом препро-вазопрессина или его фрагментов. Предпочтительным эпитопом, используемым другим связывающим агентом для связывания, предпочтительно, является эпитоп, который полностью или частично содержится в аминокислотной последовательности, соответствующей аминокислотам 126-164 препро-вазопрессина (SEQ. ID NO. 1). Особенно предпочтительно, чтобы такой эпитоп полностью или частично содержался в аминокислотной последовательности, соответствующей аминокислотам 126-146 препро-вазопрессина, а наиболее предпочтительно, аминокислотам 126-137 препро-вазопрессина. В этом контексте описания, термин «частично содержится» означает, что только часть эпитопа находится в аминокислотной последовательности, соответствующей аминокислотам 126-164 препро-вазопрессина, а другая часть расположена выше по направлению к N-концу аминокислотной последовательности. То есть, часть этого эпитопа перекрывается с указанной аминокислотной последовательностью препро-вазопрессина, а остальная часть эпитопа находится выше. Такое перекрывание, предпочтительно, составляет по меньшей мере 6 аминокислот. Термин «дополнительный связывающий агент» означает любое вещество, способное связываться с эпитопом, полностью или частично содержащимся в аминокислотной последовательности, соответствующей аминокислотам 126-164 препро-вазопрессина (SEQ ID NO. 1). Предпочтительным дополнительным связывающим агентом является антитело, а более предпочтительно, моноклональное антитело, поликлональная антисыворотка, обогащенное или очищенное поликлональное антитело, рекомбинантное антитело или их функциональные производные.

Ниже представлено более подробное описание настоящего изобретения со ссылками на прилагаемый графический материал и примеры. Графический материал и примеры относятся к предпочтительным вариантам изобретения, которое не ограничивается этими вариантами и включает все другие варианты его осуществления, входящие в объем формулы изобретения.

Описание графического материала

Фиг. 1. Картирование эпитопа для овечьей анти-PLAY17 антисыворотки (фиг. 1 (A)), аффинно очищенного овечьего поликлонального анти-PLAY17 антитела (фиг. 1 (B)), mAb 429/F4 (фиг. 1 (С) и mAb 423/F10 (фиг. 1 (D)). Результаты представлены как данные по связыванию с соответствующим указанным пептидом минус неспецифическое связывание (то есть, связывание, достигаемое в отсутствии тестируемого антитела), по отношению к связыванию с пептидом P146-164 минус неспецифическое связывание. Результаты даны для различных разведений/количеств тестируемых антисывороток/антител.

Фиг. 2 Кривые «доза-ответ» для анализов с использованием поликлональных (pc) анти-PLAY17 антител/моноклональных (mc) анти-PATV17 антител (фиг. 2 (A)), mAb 429/F4/mc анти-PATV17 антител (Фиг. 2 (B)), mAb 423/F10/mc анти-PATV17 антител (фиг. 2 (С).

Фиг. 3. Корреляция проб сыворотки, проанализированных с использованием pc анти-PLAY17 антител/mc анти-PATV17 антител и mAb 429/F4/mc анти-PATV17 антител (фиг. 3 (A)), pc анти-PLAY17 антител/mc анти-PATV17 антител и mAb 423/F10/mc анти-PATV17 антител (фиг. 3 (B)), mAb 423/F10/mc анти-PATV17 антител и mAb 429/F4/mc анти-PATV17 антител (Fig. 3 (С)).

Фиг. 4. Корреляция проб EDTA-плазмы, оцененных с использованием pc анти-PLAY17 антител/mc анти-PATV17 антител и mAb 429/F4/mc анти-PATV17 антител (фиг. 4 (A)), pc анти-PLAY17 антитело/mc анти-PATV17 антител и mAb 423/F10/mc анти-PATV17 антител (фиг. 4 (B)), mAb 423/F10/mc анти-PATV17 антител и mAb 429/F4/mc анти-PATV17 антител (Fig. 4 (С).

Фиг. 5. Стабильность аналита. Указаны средние величины (ср.кв.откл.) для пяти проб сыворотки после их хранения при 22°C в течение определенных периодов времени по отношению к величинам, полученным для проб, не находившихся на хранении (t=0), где указанные пробы были оценены с помощью описанных здесь анализов.

Примеры

Пептиды

Нижеследующие пептиды, родственные копептину, химически синтезировали, очищали и контроль их качества осуществляли в соответствии со стандартными процедурами:

Пептид Последовательность SEQ ID NO: Положение аминокислот препро-вазопрессина
PAY16 CAGAPEPFEPAQPDAY 4 150-164(+N-концевой цистеин)
PAY14 CAPEPFEPAQPDAY 3 152-164(+N-концевой цистеин)
Р146-164 LVQLAGAPEPFEPAQPDAY 6 146-164
Р146-163 LVQLAGAPEPFEPAQPDA 7 146-163
Р146-162 LVQLAGAPEPFEPAQPD 8 146-162
Р146-161 LVQLAGAPEPFEPAQP 9 146-161

Р146-159 LVQLAGAPEPFEPA 11 146-159
Р146-158 LVQLAGAPEPFEP 12 146-158
Р146-157 LVQLAGAPEPFE 13 146-157

Антитела

Моноклональные антитела против пептидов PAY16 и PAY14 получали стандартными методами (Harlow E, Lane D. Antibodies - A Laboratory Manual. Cold Spring Harbor: Cold Spring Harbor Laboratory, 1988; Lane RD. A short-duration polyethylene glycol fusion technique for increasing production of monoclonal antibody-secreting hybridomas. J. Immunol Methods 1985; 81: 223-8).

Вкратце, пептиды конъюгировали с BSA с использованием сульфо-MBS (сложного эфира м-малеимидобензоил-N-гидроксисукцинимида). Мышей Balb/c иммунизировали этими конъюгатами, а затем подвергали бустер-иммунизации, и клетки селезенки подвергали слиянию с миеломными клетками SP2/0 с получением гибридомных клеточных линий. Клеточные линии скринировали на их способность секретировать антитела, связывающиеся с иммуногенными пептидами, которые были нанесены на твердую полистироловую фазу.

С применением такого метода получали клеточные линии, секретирующие моноклональные антитела 429/F4 (против PAY16) и 423/F10 (против PAY14). В последующих экспериментах, моноклональные антитела выделяли из супернатанта культуры с помощью аффинной хроматографии на G-белке.

Овечью антисыворотку и соответствующие аффинно очищенные поликлональные овечьи антитела против пептида PLAY17 («pc анти-PLAY антитела»), используемые в анализах, проводимых в хемилюминесцентной/сенсибилизированной пробирке для детектирования копептина (CT-proAVP) как описано в [4, 7], закупали у BRAHMS GmbH, Hennigsdorf, Germany.

Картирование эпитопов

Эпитопы для антител картировали следующим образом:

a) Нанесение пептидов

Нанесение пептидов осуществляли в соответствии со стандартными процедурами (EP 1488209 A1, EP 1738178 A1): Полистироловые пробирки Startubes (Greiner) покрывали пептидами P146-164, P146-163, P146-162, P146-161, P146-159, P146-158 и Ρ146-157 (на пробирку, 1,5 мкг пептида в 300 мкл PBS, pH 7,8) в течение ночи при 22°C. Затем пробирки блокировали 10 ммоль/л Na-фосфата (pH 6,5), содержащего 3% Karion FP (Merck), 0,5% BSA без протеазы (Sigma), и лиофилизовали.

b) Мечение ослиными антителами против овечьих IgG и козьими антителами против мышиных IgG

Мечение проводили в соответствии со стандартными процедурами (EP 1488209 A1, EP 1738178 A1). Концентрацию ослиных антител против антител овцы (Scantibodies Laboratory Inc., USA) и козьих антител против антител мыши (BiosPacific, USA) доводили до 1 г/л, и антитела метили путем инкубирования с хемилюминесцентной меткой «MACN-акридиний-NHS-эфир» (1 г/л; InVent GmbH, Hennigsdorf, Germany) в молярном отношении 1:4 в течение 20 минут при комнатной температуре. Реакции прекращали путем добавления 1/10 объема 1 ммоль/л Триса в течение 10 минут при комнатной температуре. Меченые антитела отделяли от свободной метки с помощью эксклюзионной хроматографии на колонке NAP-5 (GE Healthcare, Freiburg, Germany) и на 5 мкм ВЭЖХ-колонке Thermo BioBasic 300 (Thermo Scientific).

c) Поликлональная (pc) анти-PLAY17 антисыворотка/аффинно очищенное антитело

Метку получали путем разведения меченного ослиного антитела против овечьих IgG в аналитическом буфере PBS с 0,5% альбумином бычьей сыворотки без протеазы (Sigma), содержащем 106 относительных световых единиц (RLU) MACN-меченного антитела на 200 мкл. Поликлональную (Pc) овечью анти-PLAY17 антисыворотку (B.R.A.H.M.S GmbH, Hennigsdorf, Germany) разводили PBS с 0,5% альбумином бычьей сыворотки (без протеазы) в отношениях 1:1000, 1:3000, 1:9000, 1:27000 и 1:81000. Аффинно очищенные поликлональные овечьи анти-PLAY17 антитела разводили PBS с 0,5% альбумином бычьей сыворотки без протеазы, до следующих концентраций: 972, 324, 108, 36 и 12 нг/200 мкл. В первой стадии инкубирования, 50 мкл разведений поликлональной овечьей анти-PLAY17 антисыворотки/очищенных антител и 200 мкл PBS с 0,5% альбумином бычьей сыворотки (без протеазы) пипетировали в пробирки, покрытые пептидами P146-164, P146-163, P146-162, P146-161, P146-159, P146-158 и P146-157. Для определения уровня неспецифического связывания (NSB), в пробирки, покрытые пептидами P146-164, P146-163, P146-162, P146-161, P146-159, P146-158 и P146-157, пипетировали только 250 мкл PBS с 0,5% альбумином бычьей сыворотки (без протеазы). Эти пробирки инкубировали в течение ночи при 22°C с перемешиванием. Затем пробирки 5 раз промывали 1 мл промывочного раствора B.R.A.H.M.S (B.R.A.H.M.S GmbH). Во второй стадии инкубирования добавляли 200 мкл меченного ослиного антитела против овечьих IgG, и пробирки инкубировали в течение 2 часов при 22°C с перемешиванием. Затем пробирки 5 раз промывали 1 мл промывочного раствора B.R.A.H.M.S, и связанную хемилюминесценцию измеряли в течение 1 секунды на пробирку с помощью люминометра LB 952T (Berthold).

d) mAb 429/F4 и mAb 423/F10

Метку получали путем разведения меченного козьего антитела против мышиных IgG в аналитическом буфере (PBS, 0,5% с альбумином бычьей сыворотки без протеазы), содержащем 106 относительных световых единиц (RLU) MACN-меченного антитела на 200 мкл. Моноклональные антитела 429/F4 и 423/F10 разводили PBS с 0,5% альбумином бычьей сыворотки (без протеазы) до следующих концентраций: 972, 324, 108, 36 и 12 нг/200 мкл.

В первой стадии инкубирования, 50 мкл разведений mAb 429/F4/mAb 423/F10 и 200 мкл PBS с 0,5% альбумином бычьей сыворотки (без протеазы) пипетировали в пробирки, покрытые пептидами P146-164, P146-163, P146-162, P146-161, P146-159, P146-158 и P146-157. Для определения NSB, в пробирки, покрытые пептидами P146-164, P146-163, P146-162, P146-161, P146-159, P146-158 и P146-157, пипетировали только 250 мкл PBS с 0,5% альбумином бычьей сыворотки (без протеазы). Эти пробирки инкубировали в течение ночи при 22°C с перемешиванием. Затем пробирки 5 раз промывали 1 мл промывочного раствора B.R.A.H.M.S (B.R.A.H.M.S GmbH, Henninsdorf, Germany). Во второй стадии инкубирования добавляли 200 мкл меченного козьего антитела против антитела мыши, и пробирки инкубировали в течение 2 часов при 22°C с перемешиванием. Затем пробирки 5 раз промывали 1 мл промывочного раствора B.R.A.H.M.S, и связанную хемилюминесценцию измеряли в течение 1 секунды на пробирку с помощью люминометра LB 952T (Berthold).

На фиг. 1(A)-1(D) проиллюстрировано наблюдаемое связывание антисыворотки и антител с пептидами, представляющими собой С-концевую полноразмерную часть и усеченные варианты С-концевой части копептина. Овечья анти-PLAY17 антисыворотка, аффинно очищенное овечье поликлональное анти-PLAY17 антитело и mAb 429/F4 обнаруживали почти аналогичное связывание с пептидными последовательностями, соответствующими положениям аминокислот 146-164, 146-163, 146-162, 146-161 препро-вазопрессина. Что касается пептидных вариантов, то варианты с большим усечением по С-концу обнаруживали меньший уровень связывания. Снижение уровня связывания зависело от концентрации используемых антител. Что касается тестируемых антисывороток/антител, то можно сделать вывод, что эпитопы для этих антисывороток/антител не содержат аминокислоты в положениях 161-164 препро-вазопрессина. В отличие от этого, связывание mAb 423/F10 было эффективным лишь по отношению к пептиду, соответствующему положениям аминокислот 146-164 препро-вазопрессина, и существенно снижалось в случае связывания с пептидными вариантами, усеченным по С-концу. Следовательно, в эпитопе для mAb 423/F10 присутствовала аминокислота в положении 164 препро-вазопрессина.

Иммуноанализы

Мечение моноклональных антител

Мечение проводили в соответствии со стандартными процедурами (EP 1488209 A1, EP 1738178 A1). Концентрацию очищенных антител 429/F4 и 423/F10 доводили до 1 г/л, и антитела метили путем инкубирования с хемилюминесцентной меткой «MACN-акридиний-NHS-эфир» (1 г/л; InVent GmbH, Hennigsdorf, Germany) в молярном отношении 1:5 в течение 20 минут при комнатной температуре. Реакции прекращали путем добавления 1/10 объема 1 ммоль/л Триса в течение 10 минут при комнатной температуре. Меченые антитела отделяли от свободной метки с помощью эксклюзионной хроматографии на колонке NAP-5 (GE Healthcare, Freiburg, Germany) и на 5 мкм ВЭЖХ-колонке Thermo BioBasic 300 (Thermo Scientific).

Три ««сэндвич»-иммуноанализа были проведены или разработаны следующим образом:

A. Pc анти-PLAY17/mc анти-PATV17 антитела

Стандарт CT-proAVP LIA (B.R.A.H.M.S GmbH, Hennigsdorf, Germany), описанный в [7].

B. mAb 429/F4/mc анти-PATV17 антитела

Метку получали путем разведения меченого антитела 429/F4 в аналитическом буфере (300 ммоль/л фосфата калия, 100 ммоль/л NaCl, 10 ммоль/л натрий-EDTA, 5 г/л альбумина бычьей сыворотки без протеазы, 1 г/л неспецифических овечьих IgG, 1 г/л неспецифических бычьих IgG, 1 г/л неспецифических мышиных IgG, 0,9 г/л азида натрия, pH 7,0), содержащем 106 относительных световых единиц (RLU) MACN-меченного антитела на 200 мкл. 50 мкл стандартов CT pro-AVP (B.R.A.H.M.S GmbH), Hennigsdorf, Germany)/образцов и 200 мкл метки пипетировали в пробирки, покрытые CT pro-AVP (B.R.A.H.M.S GmbH). Пробирки инкубировали в течение 2 часов при 22°C с перемешиванием. Затем пробирки 5 раз промывали 1 мл промывочного раствора (B.R.A.H.M.S, GmbH), и связанную хемилюминесценцию измеряли в течение 1 секунды на пробирку с помощью люминометра LB 952T (Berthold).

С. mAb 423/F10/mc анти-PATV17 антитело

Метку получали путем разведения меченых антител 423/F10 в аналитическом буфере (300 ммоль/л фосфата калия, 100 ммоль/л NaCl, 10 ммоль/л натрий-EDTA, 5 г/л альбумина бычьей сыворотки без протеазы, 1 г/л неспецифических овечьих IgG, 1 г/л неспецифических бычьих IgG, 1 г/л неспецифических мышиных IgG, 0,9 г/л азида натрия, pH 7,0), содержащем 106 относительных световых единиц (RLU) MACN-меченного антитела на 200 мкл. 50 мкл стандартов CT pro-AVP (B.R.A.H.M.S GmbH, Hennigsdorf, Germany)/образцов и 200 мкл метки пипетировали в пробирки, покрытые CT pro-AVP (B.R.A.H.M.S GmbH). Пробирки инкубировали в течение 2 часов при 22°C с перемешиванием. Затем пробирки 5 раз промывали 1 мл промывочного раствора (B.R.A.H.M.S, GmbH), и связанную хемилюминесценцию измеряли в течение 1 секунды на пробирку с помощью люминометра LB 952T (Berthold).

Типичные кривые «доза-ответ» для этих трех анализов представлены на фиг. 2.

Сравнение методов

С помощью вышеописанных трех анализов были оценены различные клинические образцы, включая пробы, взятые у здоровых индивидуумов, у пациентов с болезнями сердца и у пациентов с ICU. Графические сравнения методов анализа представлены на фиг. 3 (для сыворотки) и фиг. 4 (для пробы EDTA-плазмы). Идеальные коэффициенты корреляции Спирмана были получены при сравнении анализа, проводимого с использованием pc анти-PLAY17/mc анти-PATV17 антител, с анализом, проводимым с использованием mAb 429/F4/mAb PATV17, тогда как явные различия наблюдались при сравнении анализа, проводимого с использованием mAb 423/F10/mc анти-PATV17 антител, с анализом, проводимым с использованием pc анти-PLAY17 антител/mc анти-PATV17 антител или с анализом, проводимым с использованием mAb 429/F4/mc анти-PATV17 антител. Различия были более явно выражены при использовании сыворотки, а не проб EDTA-плазмы. Наблюдаемые различия явно ассоциировались с эпитопами для антител. Эпитоп для mAb 423/F10 содержит аминокислоту в положении 164 препро-вазопрессина, а эпитопы поликлональных анти-PLAY17 антител и mAb 429/F4 не содержат аминокислоты в положениях 161-164 препро-вазопрессина. Очевидно, что в сыворотке и в плазме, помимо полноразмерного копептина, присутствуют также варианты, усеченные по С-концу. Поскольку пробы, используемые в сравнении методов, были подвергнуты замораживанию сразу после сбора и оттаиванию непосредственно перед их оценкой, то частичное усечение по С-концу, очевидно, не является последствием хранения этих проб ex vivo, а уже происходило in vivo.

Стабильность аналита

Субсерию проб сыворотки, используемых в сравнениях методов анализа, хранили в течение различных периодов времени при 22°C, а затем оценивали путем проведения трех анализов. При проведении анализа с использованием mAb 423/F10/mc анти-PATV17 антител, выход резко снижался уже после 1-го дня хранения при 22°C. Эпитоп для mAb 423/F10 содержал аминокислоту в положении 164 препро-вазопрессина. В отличие от этого, аналит был гораздо более стабильным при проведении анализа с использованием pc анти-PLAY17 антител/mc анти-PATV17 антител или mAb 429/F4/mc анти-PATV17 антител. Эпитопы для pc анти-PLAY17 антител и mAb 429/F4 не содержали аминокислоты в положениях 161-164 препро-вазопрессина.

Последовательности

SEQ ID NO. 2 (Копептин)

ASDRSNATQLDGPACALLLRLVQLAGAPEPFEPAQPDAY

(представляющая собой последовательность с аминокислотами в положениях 126-164 препро-вазопрессина)

SEQ ID NO. 3 (Пептид PAY14)

CAPEPFEPAQPDAY

(представляющая собой последовательность с аминокислотами в положениях 152-164 препро-вазопрессина + N-концевой цистеин)

SEQ ID NO. 4 (Пептид PAY16)

CAGAPEPFEPAQPDAY

(представляющая собой последовательность с аминокислотами в положениях 150-164 препро-вазопрессина + N-концевой цистеин)

SEQ ID NO. 5 (Пептид PAY33)

ATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY

(представляющая собой последовательность с аминокислотами в положениях 132-164 препро-вазопрессина)

SEQ ID NO. 6 (Пептид P146-164)

LVQLAGAPEPFEPAQPDAY

(представляющая собой последовательность с аминокислотами в положениях 146-164 препро-вазопрессина)

SEQ ID NO. 7 (Пептид P146-163)

LVQLACAPEPFEPAQPDA

(представляющая собой последовательность с аминокислотами в положениях 146-163 препро-вазопрессина)

SEQ ID NO. 8 (Пептид P146-162)

LVQLACAPEPFEPAQPD

(представляющая собой последовательность с аминокислотами в положениях 146-162 препро-вазопрессина)

SEQ ID NO. 9 (Пептид P146-161)

LVQLAGAPEPFEPAQP

(представляющая собой последовательность с аминокислотами в положениях 146-161 препро-вазопрессина)

SEQ ID NO. 10 (Пептид P146-160)

LVQLACAPEPFEPAQ

(представляющая собой последовательность с аминокислотами в положениях 146-160 препро-вазопрессина)

SEQ ID NO. 11 (Пептид P146-159)

LVQLAGAPEPFEPA

(представляющая собой последовательность с аминокислотами в положениях 146-159 препро-вазопрессина)

SEQ ID NO. 12 (Пептид P146-158)

LVQLACAPEPFEP

(представляющая собой последовательность с аминокислотами в положениях 146-158 препро-вазопрессина)

SEQ ID NO. 13 (Пептид P146-157)

LVQLACAPEPFE

(представляющая собой последовательность с аминокислотами в положениях 146-157 препро-вазопрессина)

Библиография

1. Kluge M, Riedl S, Erhart-Hofmann B, Hartmann J., Waldhauser F. Improved extraction procedure and RIA for determination of arginine-8-vasopressin in plasma: role of premeas-urement sample treatment and reference values in children. Clin Chem 1999;45:98-103.

2. Preibisz JJ, Sealey JE, Laragh JH, Cody RJ, Weksler BB. Plasma and platelet vasopressin in essential hypertension and congestive heart failure. Hypertension 1983;5:11 29-38.

3. Robertson CL, Mahr EA, Athar S, Sinha T. Development and clinical application of a new method for the radioimmunoassay of arginine vasopressin in human plasma. J. Clin Invest 1973;52:2340-52.

4. Morgenthaler NC, Struck J., Alonso C, Bergmann A. Assay for the measurement of co-peptin, a stable peptide derived from the precursor of vasopressin. Clin Chem 2006;52:112-9.

5. Morgenthaler NC, Struck J., Jochberger S, Dunser MW. Copeptin: clinical use of a new bio-marker. Trends Endocrinol Metab 2008;19:43-9.

6. Struck J., Morgenthaler NG, Bergmann A. Copeptin, a stable peptide derived from the vasopressin precursor, is elevated in serum of sepsis patients. Peptides 2005;26:2500-4.

7. Fenske W, Stork S, Blechschmidt A, Maier SG, Morgenthaler NG, Allolio B. Copeptin in the differential diagnosis of hyponatremia. J. Clin Endocrinol Metab 2009;94: 123-9.

1. Способ получения связывающего агента или смеси связывающих агентов, способных связываться с эпитопом, содержащимся в аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина (SEQ ID NO. 1), состоящей из аминокислот 146-163, но не содержащей аминокислоту 164, где указанный способ включает следующие стадии:

a) получение связывающего агента с использованием формирующего агента, содержащего аминокислотную последовательность длиной по меньшей мере 12 аминокислот, содержащуюся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1);

b) определение способности связывающего агента связываться с аминокислотной последовательностью длиной по меньшей мере 12 аминокислот, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1);

c) отбор связывающего агента, способного связываться с аминокислотной последовательностью из по меньшей мере 12 аминокислот в длину, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1), из множества связывающих агентов, способных связываться с аминокислотной последовательностью, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1).

2. Способ по п. 1, дополнительно содержащий выделение связывающего агента, способного связываться с аминокислотной последовательностью из по меньшей мере 12 аминокислот в длину, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1), из множества связывающих агентов, способных связываться с аминокислотной последовательностью, содержащейся в аминокислотной последовательности, соответствующей С-концевой части, но не содержащей аминокислоту 164 препро-вазопрессина (SEQ ID NO. 1).

3. Способ по п. 1 или 2, где аминокислоты 163-164, предпочтительно аминокислоты 162-164, а наиболее предпочтительно аминокислоты 161-164 отсутствуют в аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина (SEQ ID NO. 1).

4. Способ по п. 1 или 2, где аминокислотная последовательность, содержащаяся в формирующем агенте, и/или аминокислотная последовательность, содержащаяся в аминокислотной последовательности, соответствующей С-концевой части препро-вазопрессина (SEQ ID NO. 1), выбирается из группы, включающей пептиды, состоящие из аминокислот 146-163 (SEQ ID NO. 7), 146-162 (SEQ ID NO. 8), 146-161 (SEQ ID NO. 9), 146-160 (SEQ ID NO. 10), 146-159 (SEQ ID NO. 11), 146-158 (SEQ ID NO. 12) и 146-157 (SEQ ID NO. 13) препро-вазопрессина (SEQ ID NO. 1).

5. Способ по п. 1 или 2, где указанный связывающий агент обладает способностью связываться с аминокислотной последовательностью, выбранной из группы, состоящей из аминокислот 146-162 (SEQ ID NO. 8), 146-161 (SEQ ID NO. 9), 146-160 (SEQ ID NO. 10), 146-159 (SEQ ID NO. 11), 146-158 (SEQ ID NO. 12) и 146-157 (SEQ ID NO. 13) препро-вазопрессина (SEQ ID NO. 1).

6. Способ по п. 1 или 2, где стадия определения (b) включает картирование эпитопов.

7. Способ по п. 1 или 2, где определяют специфичность связывания связывающего агента с указанным эпитопом.

8. Способ по п. 1 или 2, где стадия отбора включает аффинное разделение.

9. Формирующий агент для получения связывающего агента или смеси связывающих агентов, способных связываться с эпитопом, содержащимся в аминокислотной последовательности, соответствующей С-концевой части препровазопрессина (SEQ ID NO. 1), состоящей из аминокислот 146-163, но не содержащей аминокислоту 164, выбранный из группы, включающей пептиды, состоящие из аминокислот 146-163 (SEQ ID NO. 7), 146-162 (SEQ ID NO. 8), 146-161 (SEQ ID NO. 9), 146-160 (SEQ ID NO. 10), 146-159 (SEQ ID NO. 11), 146-158 (SEQ ID NO. 12) и 146-157 (SEQ ID NO. 13) препро-вазопрессина (SEQ ID NO. 1).

10. Формирующий агент по п. 9, содержащий биотин в качестве связывающей части.

11. Применение формирующего агента по п. 10 в качестве формирующего агента в способе по любому из пп. 1-8.

12. Связывающий агент, полученный способом по любому из пп. 1-8.

13. Связывающий агент по п. 12, а именно антитело, предпочтительно моноклональное антитело, поликлональная антисыворотка, обогащенное или очищенное поликлональное антитело, рекомбинантное антитело или их функциональные производные.

14. Применение связывающего агента по пп. 12 или 13 для качественного или количественного детектирования препро-вазопрессина или его фрагментов в биологическом образце.

15. Применение по п. 14, где фрагмент препро-вазопрессина представляет собой копептин.

16. Применение по п. 14, где указанный биологический образец представляет собой физиологическую жидкость, выбранную из группы, включающей кровь, сыворотку, плазму, мочу, цереброспинальную жидкость и слюну.

17. Применение по пп. 14 или 15, где используется по меньшей мере один дополнительный связывающий агент, способный связываться с эпитопом, который полностью или частично содержится в аминокислотной последовательности, соответствующей аминокислотам 126-164 препро-вазопрессина (SEQ ID NO. 1).

18. Применение по п. 17, где указанный по меньшей мере один дополнительный связывающий агент представляет собой антитело, предпочтительно моноклональное антитело, поликлональную антисыворотку, обогащенное или очищенное поликлональное антитело, рекомбинантное антитело или их функциональные производные.

19. Набор для качественного или количественного детектирования препро-вазопрессина или его фрагментов в биологическом образце, где указанный набор содержит связывающий агент по п. 12 или 13.

20. Набор по п. 19, где фрагмент препро-вазопрессина представляет собой копептин.



 

Похожие патенты:

Изобретение относится к области медицины, а именно к способу диагностики водянки оболочек яичек. Сущность способа состоит в том, что производят забор образца водяночной жидкости из собственной влагалищной оболочки яичка, аспирируют водяночную жидкость и направляют ее на исследование половых гормонов: общего тестостерона и эстрадиола, при этом одновременно производят забор образца сыворотки крови путем проведения пункции периферической вены локтевого сгиба того же пациента, в образцах сыворотки крови определяют уровень половых гормонов, а именно общего тестостерона крови (Tsкр), а также эстрадиола крови (Екр).

Изобретение относится к области медицины, а именно к эндокринологии репродукции, и может быть использовано для оценки активности ароматазы овариальных фолликулов.

Группа изобретений относится к области медицины и биохимии и касается способа диагностирования бактериальной инфекции у пациента с неспецифическими жалобами, включающего следующие этапы: (i) обеспечение образца из организма пациента, поступившего с неспецифическими жалобами; (ii) определение уровня прокальцитонина (PCT) или его фрагмента длиной как минимум 12 аминокислот в вышеупомянутом образце и (iii) определение у вышеупомянутого пациента наличия или отсутствия бактериальной инфекции путем сравнения вышеупомянутого определенного уровня PCT с заданным пороговым уровнем.

Изобретение относится к медицине, а именно к оториноларингологии, и может быть использовано для оценки безопасности применения системных кортикостероидов. Способ включает определение концентрации кортизола в крови и слюне до и после лечения, оценку проводят с учетом физиологического пика секреции кортизола корой надпочечников.
Изобретение касается способа выявления пациента с риском развития расстройства щитовидной железы в результате лечения в режиме, который истощает лимфоциты. Способ включает определение до лечения наличия антител, направленных против пероксидазы щитовидной железы или микросом щитовидной железы, у пациента.
Изобретение относится к медицине, в частности к гинекологии и репродуктологии, и описывает способ отбора пациенток с синдромом слабого ответа яичников, нуждающихся в переводе на программу лечения с использованием донорских ооцитов.
Изобретение относится к медицине, а именно к педиатрии, и может быть использовано для прогнозирования риска развития рахита у доношенных детей первых месяцев жизни с функциональной недостаточностью щитовидной железы.
Изобретение относится к медицине, а именно к гинекологии, и может быть использовано для прогнозирования овуляторных менструальных циклов у женщин с первичной олигоменореей в анамнезе.
Изобретение относится к медицине, а именно к способу оценки овариальной ароматазной активности. Сущность способа состоит в том, что проводят гормональное исследование сыворотки крови на второй день менструального цикла до перорального приема 10 мг ингибитора ароматазы летрозола и через 48 часов после; до приема летрозола определяют уровень эстрадиола и уровень антимюллерова гормона, после приема летрозола - уровень эстрадиола.

Изобретение относится к области медицины, а именно к терапии и профессиональной патологии, и может быть использовано для диагностики начальных проявлений нарушения здоровья у стажированных рабочих, контактирующих с комплексом неблагоприятных факторов: низкая положительная температура воздуха, высокая относительная влажность, тяжелый труд и напряженный трудовой процесс, высокие уровни шума, гипогеомагнитное поле, высокие значения объемных активностей радона в зоне дыхания рабочих, обслуживающих железнодорожный тоннель.

Настоящее изобретение относится к области микробиологии и касается способа определения таких характеристик, как типирование, потенциальная устойчивость по меньшей мере к одному антимикробному средству и фактора вирулентности, по меньшей мере, одного микроорганизма из образца.

Изобретение относится к области медицины, а именно к гинекологии и гемостазиологии, и может быть использовано для оценки степени тяжести воспалительных заболеваний органов малого таза.

Изобретение относится к области медицины, и касается способа прогнозирования эффективности монотерапии пероральным сахароснижающим препаратом метформином у больных сахарным диабетом 2 типа.

Изобретение относится к области медицины и касается способа диагностики генетической предрасположенности к риску развития ишемического инсульта у больных с фибрилляцией предсердий (ФП).
Изобретение относится к области медицины, в частности трансфузиологии, и результаты его будут востребованы в практической медицине. Способ касается отбора доноров для получения плазмы крови с целью лечения пациентов с инфекционными заболеваниями и осложнениями после оперативных вмешательств, травм и ожогов, путем исследования иммунологических показателей крови.

Изобретение относится к области биотехнологии, конкретно к применению пептида, состоящего из по меньшей мере 8 последовательных аминокислотных остатков последовательности, представленной в SEQ ID NO:3, для диагностики рассеянного склероза, что может быть использовано в медицине.

Изобретение относится к медицине, а именно к лабораторной диагностике, и может быть использовано для оценки угрозы нарушения энергетического обмена в фетоплацентарном барьере ворсинок плаценты.

Изобретение относится к области медицины и касается способа, тест-системы диагностики диабетической нефропатии. Сущность способа заключается в том, что в образце от субъекта определяют биомаркер, который представляет собой подобный антигену CD5.

Изобретение относится к области медицины, к клинико-биохимической лабораторной диагностике, а именно к методам определения модифицированных белков и предназначается для селективного количественного определения степени окисления фибриногена в клинических образцах плазмы крови по содержанию карбонильных групп в фибриновом сгустке.

Настоящее изобретение относится к биохимии, в частности к лигандам для аффинной хроматографии на основе различных доменов белка A (SpA) Staphylococcus. Лиганд содержит либо несколько доменов C, либо несколько доменов B, либо несколько доменов Z белка SpA.

Изобретение относится к области биотехнологии, конкретно к новым аллергенам лошади, и может быть использовано в медицине для профилактического или терапевтического лечения или диагностики аллергии типа I на лошадей. Получают лошадиный аллерген, который представляет собой секретоглобин, имеющий молекулярную массу 15 кДа в невосстанавливающих условиях и содержащий первую пептидную цепь с молекулярной массой примерно 5 кДа и вторую пептидную цепь с молекулярной массой примерно 10 кДа, связанные друг с другом. Также получают рекомбинантную форму указанного аллергена. Изобретение позволяет получить рекомбинантным путем аллерген лошади с полностью установленной аминокислотной последовательностью. 12 н. и 1 з.п. ф-лы, 10 ил., 3 табл., 8 пр.
Наверх