Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения



Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения
Новые производные оксинтомодулина и содержащая их фармацевтическая композиция для лечения ожирения

 


Владельцы патента RU 2612906:

ХАНМИ САЙЕНС КО., ЛТД. (KR)

Изобретение относится к области биотехнологии, конкретно к получению аналогов оксинтомодулина, и может быть использовано в медицине для предупреждения или лечения ожирения. Получают модифицированный пептид, способный к активации рецептора глюкагонподобного пептида-1 (GLP-1) и рецептора глюкагона, содержащий аминокислотную последовательность SEQ ID NO: 24, 25, 26 или 28. Изобретение позволяет повысить активностью аналога в отношении рецептора глюкагонподобного пептида-1 и рецептора глюкагона по сравнению с нативным оксинтомодулином. 6 н. и 6 з.п. ф-лы, 1 ил., 2 табл., 3 пр.

 

Область техники

Настоящее изобретение относится к новому пептиду, обладающему улучшенной активностью в отношении рецептора глюкагонподобного пептида-1 и рецептора глюкагона, более высокой по сравнению с нативным оксинтомодулином, а также к композиции для предупреждения или лечения ожирения, содержащей такой пептид в качестве активного ингредиента.

Предшествующий уровень техники

В настоящее время экономический рост и изменения в образе жизни приводят к изменениям в привычках питания. Главные причины набора избыточного веса и степени ожирения у современных людей заключаются в потреблении высококалорийной пищи, такой как фастфуд, и в отсутствии физической нагрузки. По оценкам Всемирной Организации Здравоохранения (ВОЗ) более 1 миллиарда людей имеют избыточный вес, и по меньшей мере 300 миллионов из них имеют клинически установленный диагноз ожирение. В частности, 250000 людей в год умирают в Европе, и более 2,5 миллионов людей в год во всем мире умирают по причине избыточного веса (World Health Organization, Global Strategy on Diet, Physical Activity and Health, 2004).

Избыточный вес и ожирение повышают кровяное давление и уровни холестерина, вызывая или осложняя различные заболевания, такие как сердечно-сосудистое заболевание, диабет и артрит, и, кроме того, являются основной причиной увеличения частоты возникновения атеросклероза, гипертензии, гиперлипидемии или сердечно-сосудистого заболевания у детей или подростков, а также у взрослых.

Ожирение представляет собой тяжелое состояние, которое повсеместно вызывает различные заболевания. Предполагается, что его следует преодолевать индивидуальными усилиями, и также полагают, что у пациентов с ожирением отсутствует самоконтроль. Однако, ожирение трудно поддается лечению, так как ожирение представляет собой сложное расстройство, затрагивающее регуляцию аппетита и энергетический обмен. Что касается лечения ожирения, наряду с усилиями самих пациентов с ожирением, лечение следует направлять на аномальные эффекты, ассоциированные с регуляцией аппетита и энергетическим метаболизмом. Много попыток было предпринято для разработки лекарственных средств, способных лечить эти аномальные эффекты. В результате этих попыток были разработаны такие лекарственные средства, как римонабант (Sanofi-Aventis), сибутрамин (Abbott), контрав (Takeda) и орлистат (Roche), однако они имеют недостатки в виде серьезных побочных эффектов или очень слабых эффектов против ожирения. Например, сообщалось, что римонабант (Sanofi-Aventis) проявляет побочный эффект в виде расстройства центральной нервной системы, сибутрамин (Abbott) и контрав (Takeda) проявляют сердечно-сосудистые побочные эффекты, а орлистат (Roche) дает только 4 кг потери веса при приеме в течение 1 года. К сожалению, нет терапевтических агентов для лечения ожирения, которые могут быть безопасно предписаны пациентам с ожирением.

Много исследований было проведено для разработки терапевтических агентов для лечения ожирения, которые не имеют проблем традиционных лекарственных средств против ожирения. В настоящее время много внимания привлечено к производным глюкагона. Глюкагон продуцируется поджелудочной железой, когда уровень глюкозы в крови падает в результате действия других лекарств или заболеваний, гормональных или ферментативных недостаточностей. Глюкагон стимулирует распад гликогена в печени и способствует высвобождению глюкозы для повышения уровней глюкозы в крови до нормального диапазона. В дополнение к эффекту повышения уровня глюкозы в крови глюкагон подавляет аппетит и активирует гормон-чувствительную липазу (HSL) адипоцитов для облегчения липолиза, тем самым проявляя эффекты против ожирения. Одно из производных глюкагона, глюкагонподобный пептид-1 (GLP-1), находится в разработке в качестве терапевтического агента для лечения гипергликемии у пациентов с диабетом, и его функция заключается в стимуляции синтеза и секреции инсулина, в ингибировании секреции глюкагона, в замедлении опорожнения желудка, в усилении утилизации глюкозы и в ингибировании приема пищи. Эксендин-4 выделен из яда ящерицы, который имеет приблизительно 50% аминокислотной гомологии с GLP-1, и также сообщалось, что он активирует рецептор GLP-1, тем самым ослабляя гипергликемию у пациентов с диабетом. Однако, лекарственные средства против ожирения, включающие GLP-1, как сообщалось, имеют побочные эффекты, такие как рвота и тошнота.

В качестве альтернативы GLP-1, таким образом, много внимания было сконцентрировано на оксинтомодулине, пептиде, имеющем происхождение от предшественника глюкагона, преглюкагона, который связывается с рецепторами двух пептидов: GLP-1 и глюкагона. Оксинтомодулин представляет собой сильнодействующее средство для лечения ожирения, так как он подавляет потребление пищи подобно GLP-1, способствует насыщению и обладает липолитической активностью подобно глюкагону.

Основываясь на двойной функции пептида оксинтомодулина, его активно изучали в качестве лекарственного средства для лечения ожирения. Например, в патенте Кореи No. 925017 раскрыта фармацевтическая композиция, включающая оксинтомодулин в качестве активного ингредиента для лечения избыточного веса у человека, которую вводят пероральным, парентеральным, мукозальным, ректальным, подкожным или трансдермальным путем. Однако, сообщалось, что это лекарственное средство против ожирения, включающее оксинтомодулин, обладает коротким периодом полувыведения in vivo и слабой терапевтической эффективностью, даже несмотря на введение в высокой дозе три раза в сутки. Так, много попыток было предпринято для увеличения периода полувыведения in vivo или улучшения терапевтического эффекта оксинтомодулина в отношении ожирения путем его модификации.

Например, двойной агонист оксинтомодулин (Merck) получен путем замены L-серина на D-серин по положению 2 оксинтомодулина для повышения устойчивости к дипептидилпептидазе-IV (DPP-IV) и путем присоединения холестериновой группировки по С-концу для увеличения в то же время периода полувыведения из крови. ZP2929 (Zealand) получен путем замены L-серина на D-серин по положению 2 для повышения устойчивости к DPP-IV, замены аргинина на аланин по положению 17 для повышения устойчивости к протеазе, замены метионина на лизин по положению 27 для усиления оксидативной стабильности и замены глутамина на аспарагиновую кислоту и аланин по положениям 20 и 24 и аспарагина на серин по положению 28 для усиления стабильности к дезамидированию. Однако, даже несмотря на то что период полувыведения этого двойного агониста оксинтомодулина (Merck) был увеличен, проявляя период полувыведения примерно на 8-12 минут дольше по сравнению с нативным оксинтомодулином, он все еще имеет очень короткий период полувыведения in vivo, составляющий 1,7 часа, и его доза введения также является настолько высокой как несколько мг/кг. К сожалению, оксинтомодулин и его производные имеют недостатки ежедневного введения в высокой дозе из-за короткого периода полувыведения и низкой эффективности.

Описание

Техническая задача

Соответственно, авторы настоящего изобретения разработали производное оксинтомодулина, получаемое путем модификации аминокислотной последовательности нативного оксинтомодулина с целью усиления его терапевтических эффектов в отношении ожирения и снижения дозы его введения. В результате они обнаружили, что производное оксинтомодулина проявляет улучшенные активности в отношении рецептора глюкагона и рецептора GLP-1 по сравнению с нативным оксинтомодулином, тем самым осуществляя настоящее изобретение.

Техническое решение

Задача настоящего изобретения состоит в том, чтобы предложить новый пептид, проявляющий улучшенные терапевтические эффекты в отношении ожирения.

Задача настоящего изобретения также состоит в том, чтобы предложить композицию для предупреждения или лечения ожирения, содержащую такой пептид.

Задача настоящего изобретения также состоит в том, чтобы предложить способ предупреждения или лечения ожирения путем введения субъекту данного пептида или данной композиции.

Задача настоящего изобретения также состоит в том, чтобы предложить применение пептида в изготовлении лекарственных средств для предупреждения или лечения ожирения.

Благоприятные эффекты

В противоположность нативному оксинтомодулину, новый пептид по настоящему изобретению сокращает потребление пищи, подавляет опорожнение желудка и способствует липолизу без проявления побочных эффектов, а также демонстрирует улучшенные рецептор-активирующие эффекты. Поэтому он может быть широко использован в безопасном и эффективном лечении ожирения.

Краткое описание графических материалов

На Фиг. 1 представлен график, показывающий изменения в потреблении пищи в зависимости от дозы введения оксинтомодулина или производного оксинтомодулина.

Наилучший путь осуществления изобретения

В одном аспекте для достижения указанных выше задач в настоящем изобретении предложен новый пептид, включающий аминокислотную последовательность следующей формулы 1:

R1-Х1-X2-GTFTSD-X3-X4-X5-X6-X7-X8-X9-X10-Х11-Х12-Х13-Х14-Х15-Х16-X17-X18-X19-X20-X21-X22-X23-X24-R2 (SEQ ID NO: 51) (формула 1),

где R1 представляет собой гистидин, дезамино-гистидил, диметил-гистидил (N-диметил-гистидил), бета-гидроксиимидазопропионил, 4-имидазоацетил, бета-карбоксиимидазопропионил или тирозин;

X1 представляет собой Aib(аминоизомасляную кислоту), d-аланин, глицин, Sar(N-метилглицин), серии или d-серин;

Х2 представляет собой глутаминовую кислоту или глутамин;

Х3 представляет собой лейцин или тирозин;

Х4 представляет собой серии или аланин;

Х5 представляет собой лизин или аргинин;

Х6 представляет собой глутамин или тирозин;

Х7 представляет собой лейцин или метионин;

Х8 представляет собой аспарагиновую кислоту или глутаминовую кислоту;

Х9 представляет собой глутаминовую кислоту, серии, альфа-метил-глутаминовую кислоту или делетирован;

Х10 представляет собой глутамин, глутаминовую кислоту, лизин, аргинин, серии или делетирован;

X11 представляет собой аланин, аргинин, валин или делетирован;

Х12 представляет собой аланин, аргинин, серии, валин или делетирован;

Х13 представляет собой лизин, глутамин, аргинин, альфа-метил-глутаминовую кислоту или делетирован;

Х14 представляет собой аспарагиновую кислоту, глутаминовую кислоту, лейцин или делетирован;

Х15 представляет собой фенилаланин или делетирован;

Х16 представляет собой изолейцин, валин или делетирован;

Х17 представляет собой аланин, цистеин, глутаминовую кислоту, лизин, глутамин, альфа-метил-глутаминовую кислоту или делетирован;

Х18 представляет собой триптофан или делетирован;

Х19 представляет собой аланин, изолейцин, лейцин, серин, валин или делетирован;

Х20 представляет собой аланин, лизин, метионин, глутамин, аргинин или делетирован;

Х21 представляет собой аспарагин или делетирован;

Х22 представляет собой аланин, глицин, треонин или делетирован;

Х23 представляет собой цистеин, лизин или делетирован;

Х24 представляет собой пептид, имеющий от 2 до 10 аминокислот, состоящих из комбинаций аланина, глицина и серина, или делетирован; и

R2 представляет собой KRNRNNIA (SEQ ID NO:32), GPSSGAPPPS (SEQ ID NO:33), GPSSGAPPPSK (SEQ ID NO:34), HSQGTFTSDYSKYLD (SEQ ID NO:35), HSQGTFTSDYSRYLDK (SEQ ID NO:36), HGEGTFTSDLSKQMEEEAVK (SEQ ID NO:37) или делетирован (за исключением случая, когда аминокислотная последовательность формулы 1 идентична SEQ ID NO:1).

Термин «пептид», как он использован здесь, означает соединение из двух или более α-аминокислот, связанных пептидной связью. В отношении объектов по настоящему изобретению, этот термин означает пептид, который активирует как рецептор GLP-1, так и рецептор глюкагона для проявления эффектов против ожирения. Пептид по настоящему изобретению включает пептиды, производные пептидов или миметики пептидов, которые получают путем добавления, делеции или замены аминокислот оксинтомодулина таким образом, чтобы активировать оба рецептора GLP-1 и глюкагона на высоком уровне по сравнению с нативным оксинтомодулином.

Аминокислоты, упомянутые здесь, имеют следующие сокращения согласно правилам номенклатуры IUPAC-IUB:

Аланин А Аргинин R
Аспарагин N Аспарагиновая кислота D
Цистеин С Глутаминовая кислота Е
Глутамин Q Глицин G
Гистидин Н Изолейцин I
Лейцин L Лизин K
Метионин М Фенилаланин F
Proline Р Серин S
Треонин Т Триптофан W
Тирозин Y Валин V

В настоящем изобретении пептид охватывает любой пептид, который получают путем замен, вставок, делеций или посттрансляционных модификаций (например метилирования, ацилирования, убиквитинилирования, внутримолекулярного ковалентного связывания) в аминокислотной последовательности оксинтомодулина (HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA, SEQ ID NO:1), так чтобы одновременно активировать рецепторы глюкагона и GLP-1. Что касается замены или добавления аминокислот, могут быть использованы любые из 20 аминокислот, обычно обнаруживаемых в человеческих белках, а также атипичные или неприродные аминокислоты. Коммерческие источники атипичных аминокислот включают Sigma-Aldrich, ChemPep Inc. и Genzyme Pharmaceuticals. Пептиды, включающие эти аминокислоты и атипичные пептидные последовательности, могут быть синтезированы и приобретены у коммерческих поставщиков, например American Peptide Company или Bachem (USA) или Anygen (Korea).

С целью усиления активности оксинтомодулина дикого типа в отношении рецептора глюкагона и рецептора GLP-1, пептид по настоящему изобретению может быть замещен 4-имидазоацетилом, где альфа-углерод гистидина по положению 1 аминокислотной последовательности, представленной в SEQ ID NO:1, делетирован, дезамино-гистидилом, где N-концевая аминогруппа делетирована, диметил-гистидилом (N-диметил-гистидилом), где N-концевая аминогруппа модифицирована с помощью двух метильных групп, бета-гидрокси-имидазопропионилом, где N-концевая аминогруппа замещена гидроксильной группой, или бета-карбоксиимидазопропионилом, где N-концевая аминогруппа замещена карбоксильной группой. В дополнение, область, связывающая рецептор GLP-1, может быть заменена на аминокислоты, которые усиливают гидрофобные и ионные связи или их комбинации. Часть последовательности оксинтомодулина может быть заменена на аминокислотную последовательность GLP-1 или эксендина-4 для усиления активности в отношении рецептора GLP-1.

Кроме того, часть последовательности оксинтомодулина может быть заменена на последовательность, стабилизирующую альфа-спираль. Предпочтительно, аминокислоты по положениям 10, 14, 16, 20, 24 и 28 аминокислотной последовательности формулы 1 могут быть заменены на аминокислоты или производные аминокислот, состоящие из Tyr(4-Me), Phe, Phe(4-Me), Phe(4-Cl), Phe(4-CN), Phe(4-NO2), Phe(4-NH2), Phg, Pal, Nal, Ala(2-тиенил) и Ala(бензотиенил), которые, как известно, стабилизируют альфа-спираль, и не имеется ограничений в отношении типа и количества подлежащих вставке аминокислот или производных аминокислот, стабилизирующих альфа-спираль. Предпочтительно, аминокислоты по положениям 10 и 14, 12 и 16, 16 и 20, 20 и 24, и 24 и 28 могут быть также заменены на глутаминовую кислоту или лизин, соответственно таким образом чтобы образовать кольца, и не имеется ограничения в отношении количества колец, подлежащих вставке. Наиболее предпочтительно, пептид может представлять собой пептид, имеющий аминокислотную последовательность, выбранную из нижеследующих формул со 2 по 6.

В одном конкретном воплощении пептид по настоящему изобретению представляет собой производное оксинтомодулина, включающее аминокислотную последовательность следующей формулы 2, где аминокислотная последовательность оксинтомодулина заменена на аминокислотную последовательность эксендина или GLP-1:

R1-A-R3 (SEQ ID NO: 52) (формула 2)

В другом конкретном воплощении пептид по настоящему изобретению представляет собой производное оксинтомодулина, включающее аминокислотную последовательность следующей формулы 3, которую получают путем связывания части аминокислотной последовательности оксинтомодулина и части аминокислотной последовательности эксендина или GLP-1 через подходящий аминокислотный линкер:

R1-B-C-R4 (SEQ ID NO: 53) (формула 3)

В еще одном конкретном воплощении пептид по настоящему изобретению представляет собой производное оксинтомодулина, включающее аминокислотную последовательность следующей формулы 4, где часть аминокислотной последовательности оксинтомодулина заменена на аминокислоту, способную усиливать аффинность связывания с рецептором GLP-1, например, Leu в положении 26, который связывается с рецептором GLP-1 путем гидрофобного взаимодействия, замещен гидрофобным остатком, Не или Val: (формула 4)

R1-SQGTFTSDYSKYLD-D1-D2-D3-D4-D5-LFVQW-D6-D7-N-D8-R3 (SEQ ID NO: 54)

В еще одном конкретном воплощении пептид по настоящему изобретению представляет собой производное оксинтомодулина, включающее следующую формулу 5, где часть аминокислотной последовательности делетирована, добавлена или заменена на другую аминокислоту с целью усиления активностей нативного оксинтомодулина в отношении рецептора GLP-1 и рецептора глюкагона: (формула 5)

R1-Е1-QGTFTSDYSKYLD-E2-E3-RA-E4-E5-FV-E6-WLMNT-E7-R5 (SEQ ID NO: 55)

В формулах со 2 по 5, R1 является таким же, как в описании формулы 1;

А выбран из группы, состоящей из SQGTFTSDYSKYLDSRRAQDFVQWLMNT (SEQ ID NO: 38), SQGTFTSDYSKYLDEEAVRLFIEWLMNT (SEQ ID NO: 39), SQGTFTSDYSKYLDERRAQDFVAWLKNT (SEQ ID NO: 40), GQGTFTSDYSRYLEEEAVRLFIEWLKNG (SEQ ID NO: 41), GQGTFTSDYSRQMEEEAVRLFIEWLKNG (SEQ ID NO: 42), GEGTFTSDLSRQMEEEAVRLFIEWAA (SEQ ID NO: 43) и SQGTFTSDYSRQMEEEAVRLFIEWLMNG (SEQ ID NO: 44);

В выбран из группы, состоящей из SQGTFTSDYSKYLDSRRAQDFVQWLMNT (SEQ ID NO: 38), SQGTFTSDYSKYLDEEAVRLFIEWLMNT (SEQ ID NO: 39), SQGTFTSDYSKYLDERRAQDFVAWLKNT (SEQ ID NO:40), GQGTFTSDYSRYLEEEAVRLFIEWLKNG (SEQ ID NO:41), GQGTFTSDYSRQMEEEAVRLFIEWLKNG (SEQ ID NO:42), GEGTFTSDLSRQMEEEAVRLFIEWAA (SEQ ID NO:43), SQGTFTSDYSRQMEEEAVRLFIEWLMNG (SEQ ID NO:44), GEGTFTSDLSRQMEEEAVRLFIEW (SEQ ID NO:45) и SQGTFTSDYSRYLD (SEQ ID NO:46);

С представляет собой пептид, имеющий 2-10 аминокислот, состоящих из комбинаций аланина, глицина и серина;

D1 представляет собой серин, глутаминовую кислоту или аргинин;

D2 представляет собой аргинин, глутаминовую кислоту или серин;

D3 представляет собой аргинин, аланин или валин;

D4 представляет собой аргинин, валин или серин;

D5 представляет собой глутамин, аргинин или лизин;

D6 представляет собой изолейцин, валин или серин;

D7 представляет собой метионин, аргинин или глутамин;

D8 представляет собой треонин, глицин или аланин;

Е1 представляет собой серин, Aib, Sar, d-аланин или d-серин;

Е2 представляет собой серин или глутаминовую кислоту;

Е3 представляет собой аргинин или лизин;

Е4 представляет собой глутамин или лизин;

Е5 представляет собой аспарагиновую кислоту или глутаминовую кислоту;

Е6 представляет собой глутамин, цистеин или лизин;

Е7 представляет собой цистеин, лизин или делетирован;

R3 представляет собой KRNRNNIA (SEQ ID NO:32), GPSSGAPPPS (SEQ ID NO:33) или GPSSGAPPPSK (SEQ ID NO:34);

R4 представляет собой HSQGTFTSDYSKYLD (SEQ ID NO:35), HSQGTFTSDYSRYLDK (SEQ ID NO:36) или HGEGTFTSDLSKQMEEEAVK (SEQ ID NO:37); и

R5 представляет собой KRNRNNIA (SEQ ID NO:32), GPSSGAPPPS (SEQ ID NO:33), GPSSGAPPPSK (SEQ ID NO:34) или делетирован (за исключением случая, когда аминокислотные последовательности формул 2-5 идентичны SEQ ID NO: 1).

Предпочтительно новый пептид по настоящему изобретению может представлять собой пептид следующей формулы 6:

R1-Х1-X2-GTFTSD-X3-X4-X5-X6-X7-X8-X9-X10-Х11-Х12-Х13-Х14-Х15-Х16-X17-X18-X19-X20-X21-X22-X23-X24-R2 (SEQ ID NO: 56) (формула 6),

где R1 представляет собой гистидин, дезамино-гистидил, 4-имидазоацетил или тирозин;

X1 представляет собой Aib(аминоизомасляную кислоту), глицин или серии;

Х2 представляет собой глутаминовую кислоту или глутамин;

Х3 представляет собой лейцин или тирозин;

Х4 представляет собой серии или аланин;

Х5 представляет собой лизин или аргинин;

Х6 представляет собой глутамин или тирозин;

Х7 представляет собой лейцин или метионин;

Х8 представляет собой аспарагиновую кислоту или глутаминовую кислоту;

Х9 представляет собой глутаминовую кислоту, альфа-метил-глутаминовую кислоту или делетирован;

Х10 представляет собой глутамин, глутаминовую кислоту, лизин, аргинин или делетирован;

X11 представляет собой аланин, аргинин или делетирован;

Х12 представляет собой аланин, валин или делетирован;

Х13 представляет собой лизин, глутамин, аргинин, альфа-метил-глутаминовую кислоту или делетирован;

Х14 представляет собой аспарагиновую кислоту, глутаминовую кислоту, лейцин или делетирован;

Х15 представляет собой фенилаланин или делетирован;

Х16 представляет собой изолейцин, валин или делетирован;

Х17 представляет собой аланин, цистеин, глутаминовую кислоту, глутамин, альфа-метил-глутаминовую кислоту или делетирован;

Х18 представляет собой триптофан или делетирован;

Х19 представляет собой аланин, изолейцин, лейцин, валин или делетирован;

Х20 представляет собой аланин, лизин, метионин, аргинин или делетирован;

Х21 представляет собой аспарагин или делетирован;

Х22 представляет собой треонин или делетирован;

Х23 представляет собой цистеин, лизин или делетирован;

Х24 представляет собой пептид, имеющий 2-10 аминокислот, состоящих из глицина, или делетирован; и

R2 представляет собой KRNRNNIA (SEQ ID NO:32), GPSSGAPPPS (SEQ ID NO:33), GPSSGAPPPSK (SEQ ID NO:34), HSQGTFTSDYSKYLD (SEQ ID NO:35), HSQGTFTSDYSRYLDK (SEQ ID NO:36), HGEGTFTSDLSKQMEEEAVK (SEQ ID NO:37) или делетирован (за исключением случая, когда аминокислотная последовательность формулы 6 идентична SEQ ID NO:1).

Более предпочтительно пептид по настоящему изобретению может быть выбран из группы, состоящей из пептидов SEQ ID NO: с 1 по 31. Еще более предпочтительно пептид по настоящему изобретению может представлять собой производное оксинтомодулина, описанное в Таблице 1 Примера 2-1.

Оксинтомодулин обладает активностями двух пептидов, GLP-1 и глюкагона. GLP-1 снижает уровень глюкозы в крови, снижает потребление пищи и подавляет опорожнение желудка, а глюкагон повышает уровень глюкозы в крови, способствует липолизу и снижает массу тела посредством увеличения энергетического метаболизма. Разные биологические эффекты двух пептидов могут вызывать нежелательные эффекты типа повышения уровня глюкозы в крови, если глюкагон проявляет более доминирующий эффект по сравнению с GLP-1, или вызывая тошноту и рвоту, если GLP-1 проявляет более доминирующий эффект по сравнению с глюкагоном. Таким образом, производные оксинтомодулина по настоящему изобретению не только предназначены для повышения этих активностей, например, аминокислоты по положению 1 и 11 оксинтомодулина, которые подавляют активность глюкагона, могут быть модифицированы, для того чтобы сбалансировать соотношения активностей глюкагона и GLP-1.

Авторы настоящего изобретения осуществили in vitro эксперименты для того, чтобы продемонстрировать, что пептид по настоящему изобретению проявляет улучшенные активности в отношении рецептора GLP-1 и рецептора глюкагона по сравнению с оксинтомодулином. Так, подтверждено, что пептид по настоящему изобретению активирует рецептор GLP-1 и рецептор глюкагона с проявлением улучшенных терапевтических эффектов в отношении ожирения по сравнению с традиционным оксинтомодулином. Кроме того, были исследованы его ингибирующие эффекты в отношении потребления пищи in vivo, и он показывает улучшенные ингибирующие эффекты в отношении приема пищи по сравнению с традиционным оксинтомодулином (Фиг. 1).

Специалистам в данной области техники понятно, что когда производные оксинтомодулина по настоящему изобретению модифицированы с использованием типичных методик, включая модификацию полимерами, такими как полиэтиленгликолевые (ПЭГ) и сахарные цепи, или слиянием с альбумином, трансферрином, жирной кислотой и иммуноглобулином, с целью улучшения терапевтических эффектов производных оксинтомодулина, они будут проявлять превосходные терапевтические эффекты по сравнению с нативным оксинтомодулином. Таким образом, модифицированные производные оксинтомодулина также включены в объем настоящего изобретения.

В другом аспекте настоящего изобретения предложен полинуклеотид, кодирующий данный пептид.

Термин "гомология", как он использован здесь в отношении полинуклеотида, указывает на сходство последовательностей между аминокислотными последовательностями дикого типа или нуклеотидными последовательностями дикого типа и включает последовательность гена, которая на 75% или выше, предпочтительно на 85% или выше, более предпочтительно на 90% или выше и даже еще более предпочтительно на 95% или выше идентична полинуклеотидной последовательности, кодирующей данный пептид. Оценка гомологии может быть осуществлена невооруженным глазом или с использованием коммерчески доступных программ. Используя коммерчески доступную компьютерную программу, гомология между двумя или более последовательностями может быть выражена в виде процента (%), и может быть оценена гомология (%) между соседними последовательностями. Полинуклеотид, кодирующий пептид, встраивают в вектор и экспрессируют таким образом, чтобы получить большое количество пептида.

В еще одном аспекте настоящего изобретения предложена фармацевтическая композиция для предупреждения или лечения ожирения, содержащая данный пептид.

Термин "предупреждение", как он использован здесь, означает все действия, путем осуществления которых ожирение сдерживается или замедляется при введении пептида или композиции, и термин "лечение" означает все действия, путем осуществления которых симптомы ожирения направляются в сторону улучшения состояния или модифицируются при введении пептида или композиции.

Термин "введение", как он использован здесь, означает введение количества заранее определенного вещества пациенту определенным подходящим методом. Композиция по настоящему изобретению может быть введена посредством любого общепринятого пути, пока она способна достичь желаемой ткани, например, без ограничения, внутрибрюшинным, внутривенным, внутримышечным, подкожным, внутридермальным, пероральным, местным, интраназальным, внутрилегочным или внутриректальным введением. Однако, поскольку пептиды перевариваются при пероральном введении, активные ингредиенты композиции для перорального введения должны быть покрыты или изготовлены в виде препарата для защиты против разложения в желудке.

Термин "ожирение", как он использован здесь, подразумевает накопление избыточного количества жировой ткани в организме, и индекс массы тела (масса тела (кг), разделенная на рост (м) в квадрате) выше 25 считается ожирением. Ожирение обычно вызывается нарушением энергетического баланса, когда количество принимаемой пищи превышает количество энергии, расходуемое в течение длительного периода времени. Ожирение представляет собой метаболическое расстройство, которое влияет на весь организм и повышает риск диабета, гиперлипидемии, сексуальной дисфункции, артрита и сердечно-сосудистых заболеваний, и в некоторых случаях ассоциировано с возникновением рака.

Фармацевтическая композиция по настоящему изобретению может дополнительно включать фармацевтически приемлемый носитель, эксципиент или разбавитель. Термин "фармацевтически приемлемый", как он использован здесь, означает, что композиция достаточна для достижения терапевтических эффектов без неблагоприятных побочных эффектов и может быть легко определена в зависимости от типа заболеваний, возраста пациента, массы тела, состояния здоровья, пола и лекарственной чувствительности, пути введения, способа введения, частоты введения, продолжительности лечения, лекарственных средств, используемых в комбинации или сочетании с композицией по данному изобретению, и других факторов, известных в медицине.

Фармацевтическая композиция, включающая производное по настоящему изобретению, может дополнительно включать фармацевтически приемлемый носитель. Для перорального введения носитель может включать, без ограничения, связывающий агент, смазывающий агент, разрыхлитель, эксципиент, солюбилизатор, диспергирующий агент, стабилизатор, суспендирующий агент, краситель и корригент. Для инъекционных препаратов носитель может включать буферный агент, консервант, анальгетик, солюбилизатор, изотонический агент и стабилизатор. Для препаратов для местного введения носитель может включать основу, эксципиент, смазывающий агент и консервант.

Композиция по настоящему изобретению может быть изготовлена в большом разнообразии лекарственных форм в комбинации с вышеупомянутыми фармацевтически приемлемыми носителями. Например, для перорального введения фармацевтическая композиция может быть изготовлена в виде таблеток, троше, капсул, эликсиров, суспензий, сиропов или или облаток. Для инъецируемых препаратов фармацевтическая композиция может быть изготовлена в виде ампулы в индивидуальной лекарственной форме или многодозовом контейнере. Фармацевтическая композиция также может быть изготовлена в виде растворов, суспензий, таблеток, пилюлей, капсул и препаратов длительного действия.

С другой стороны, примеры носителя, эксципиента и разбавителя, подходящего для фармацевтических композиций, включают лактозу, декстрозу, сахарозу, сорбит, маннит, ксилит, эритрит, мальтит, крахмал, аравийскую камедь, альгинат, желатин, фосфат кальция, силикат кальция, целлюлозу, метилцеллюлозу, микрокристаллическую целлюлозу, поливинилпирролидон, воду, метилгидроксибензоат, пропилгидроксибензоат, тальк, стеарат магния и минеральные масла. В дополнение, фармацевтические композиции могут дополнительно включать наполнители, агенты против коагуляции, смазывающие агенты, увлажнители, корригенты и антисептики.

Кроме того, фармацевтическая композиция по настоящему изобретению может иметь любую форму, выбранную из группы, состоящей из таблеток, пилюль, порошков, гранул, капсул, суспензий, жидкостей для приема внутрь, эмульсий, сиропов, стерильных водных растворов, неводных растворителей, лиофилизированных препаратов и суппозиториев.

Кроме того, композиция может быть изготовлена в виде индивидуальной лекарственной формы, подходящей для организма пациента, и предпочтительно изготовлена в виде препарата, полезного для пептидных лекарственных средств, в соответствии с типичным способом в фармацевтической области, так чтобы вводить пероральным или парентеральным путем, таким как через кожу, внутривенным, внутримышечным, внутриартериальным путем, интрамедуллярно, интравентрикулярно, легочным, трансдермальным, подкожным, внутрибрюшинным, интраназальным, внутрикишечным, местным, сублингвальным, вагинальным или ректальным введением, но не ограничиваясь ими.

Пептид может быть использован путем смешивания с рядом фармацевтически приемлемых носителей, таких как физиологический раствор или органические растворители. С целью повышения стабильности или всасываемости могут быть использованы углеводы, такие как глюкоза, сахароза или декстраны, антиоксиданты, такие как аскорбиновая кислота или глутатион, хелатирующие агенты, низкомолекулярные белки или другие стабилизаторы.

Дозу и частоту введения фармацевтической композиции по настоящему изобретению определяют по типу активного ингредиента, вместе с разными факторами, такими как заболевание, подлежащее лечению, пути введения, возраст, пол и масса тела пациента, а также тяжесть заболевания.

Суммарная эффективная доза композиции по настоящему изобретению может быть введена пациенту в однократной дозе или может быть введена в течение длительного периода времени в нескольких дозах в соответствии с протоколом многократного введения. В фармацевтической композиции по настоящему изобретению содержание активного ингредиента может варьировать в зависимости от тяжести заболевания. Предпочтительно суммарная суточная доза пептида по настоящему изобретению может составлять приблизительно от 0,0001 мкг до 500 мг на 1 кг массы тела пациента. Однако, эффективная доза пептида определяется различными факторами, включая возраст пациента, массу тела, состояние здоровья, пол, тяжесть заболевания, тип питания и скорость выведения, в дополнение к пути и частоте введения фармацевтической композиции. В свете этого, специалисты в данной области техники могут легко определить эффективную дозу, подходящую для конкретного использования фармацевтической композиции по настоящему изобретению. Фармацевтическая композиция по настоящему изобретению конкретно не ограничена препаратом, а также путем и способом введения, пока она проявляет эффекты настоящего изобретения.

Фармацевтическая композиция по настоящему изобретению проявляет улучшенные in vivo продолжительность эффекта и титр, тем самым значительно снижая количество и частоту ее введения.

Кроме того, фармацевтическая композиция может быть введена отдельно или в комбинации либо сочетании с другими фармацевтическими препаратами, проявляющими профилактические или терапевтические эффекты в отношении ожирения. Фармацевтические препараты, проявляющие профилактические или терапевтические эффекты в отношении ожирения, конкретно не ограничены и могут включать агонист рецептора GLP-1, агонист рецептора лептина, ингибитор DPP-IV, антагонист рецептора Y5, антагонист рецептора меланин-концентрирующего гормона (МСН), агонист рецептора Y2/3, агонист меланокортиновых рецепторов 3/4 (МС3/4), ингибитор желудочной/панкреатической липазы, агонист серотониновых рецепторов 2c типа (5HT2c), агонист рецептора β3A, агонист рецептора амилина, антагонист грелина и/или антагонист рецептора грелина.

В еще одном аспекте настоящего изобретения предложен способ предупреждения или лечения ожирения, включающий стадию введения субъекту пептида или фармацевтической композиции, включающей его.

В настоящем изобретении термин "субъект" относится к тем, кто подозревается в наличии ожирения, что означает млекопитающих, включая человека, мышь и сельскохозяйственных животных, имеющих ожирение или имеющих возможность развития ожирения. Однако, без ограничения включен любой субъект, предназначенный для лечения пептидом или фармацевтической композицией по настоящему изобретению. Фармацевтическую композицию, включающую пептид по настоящему изобретению, вводят субъекту, подверженному ожирению, тем самым эффективно излечивая данного субъекта. Ожирение является таким, как описано выше.

Терапевтический способ по настоящему изобретению может включать стадию введения композиции, включающей пептид в фармацевтически эффективном количестве. Суммарная суточная доза должна определяться через подходящее медицинское руководство лечащим врачом, и ее вводят один или несколько раз. В отношении задач настоящего изобретения, уровень конкретной терапевтически эффективной дозы для любого конкретного пациента может варьировать в зависимости от различных факторов, хорошо известных в медицинской области, включая вид и степень ответа, которые следует достигнуть, конкретных композиций в зависимости от того используют ли с ними или нет другие агенты, возраст пациента, масса тела, состояние здоровья, пол и тип питания, и путь введения, скорость выведения композиции, период времени терапии, другие лекарственные средства, используемые в комбинации или сочетании с композицией по данному изобретению, и подобные факторы, хорошо известные в медицинской области.

В еще одном аспекте настоящего изобретения предложено применение пептида или фармацевтической композиции, включающей его, в изготовлении лекарственных средств для предупреждения или лечения ожирения.

Способ осуществления

Далее настоящее изобретение будет описано более подробно со ссылкой на следующие Примеры. Однако, эти Примеры приведены только с иллюстративной целью, и изобретение не предназначено быть ограниченным этими Примерами.

Пример 1. Получение in vitro активированной клеточной линии

Пример 1-1: Получение клеточной линии, демонстрирующей цАМФ-ответ на GLP-1

Полимеразную цепную реакцию (PCR) осуществляли с использованием области, соответствующей открытой рамке считывания (ORF) в кДНК (OriGene Technologies, Inc. USA) гена человеческого рецептора GLP-1 в качестве матрицы и следующих прямого и обратного праймера, каждый из которых включает сайты рестрикции HindIII и EcoRI с получением PCR-продукта.

Прямой праймер: 5'-CCCGGCCCCCGCGGCCGCTATTCGAAATAC-3' (SEQ ID NO:47)

Обратный праймер: 5'-GAACGGTCCGGAGGACGTCGACTCTTAAGATAG-3' (SEQ ID NO:48)

Этот PCR-продукт клонировали в известный вектор экспрессии в животной клетке x0GC/dhfr (дигидрофолатредуктаза) с получением рекомбинантного вектора x0GC/GLP1R.

СНО DG44 клеточную линию, культивированную в среде DMEM/F12 (модифицированная Дульбекко среда Игла с питательной смесью Хэма F12) (10% FBS (фетальная телячья сыворотка)), трансфицировали рекомбинантным вектором x0GC/GLP1R с использованием липофектамина (Invitrogen, USA) и культивировали в селекционной среде, содержащей 1 мг/мл G418 и 10 нм метотрексат. Из нее отбирали клеточные линии, происходящие из единичных клонов, используя метод предельных разведении, и из них окончательно отбирали клеточную линию, демонстрирующую лучший цАМФ-ответ на GLP-1 зависимым от концентрации образом.

Пример 1-2: Получение клеточной линии, демонстрирующей цАМФ-ответ на глюкагон

PCR осуществляли с использованием области, соответствующей ORF в кДНК (OriGene Technologies, Inc. USA) гена человеческого рецептора глюкагона в качестве матрицы и следующих прямого и обратного праймеров, каждый из которых включает сайты рестрикции EcoRI and XhoI с получением PCR-продукта.

Прямой праймер: 5'-CAGCGACACCGACCGTCCCCCCGTACTTAAGGCC-3' (SEQ ID NO:49)

Обратный праймер: 5'-CTAACCGACTCTCGGGGAAGACTGAGCTCGCC-3' (SEQ ID NO:50)

Этот PCR-продукт клонировали в известный вектор экспрессии в животной клетке x0GC/dhfr с получением рекомбинантного вектора x0GC/GCGR.

СНО DG44 клеточную линию, культивированную в среде DMEM/F12 (10% FBS), трансфицировали рекомбинантным вектором x0GC/GCGR с использованием липофектамина и культивировали в селекционной среде, содержащей 1 мг/мл G418 и 10 нм метотрексат. Из нее отбирали клеточные линии, происходящие из единичных клонов, используя метод предельных разведении, и из них окончательно отбирали клеточную линию, демонстрирующую лучший цАМФ-ответ на глюкагон зависимым от концентрации образом.

Пример 2. Тест на in vitro активность производных оксинтомодулина

Пример 2-1: Синтез производных оксинтомодулина

Для измерения in vitro активностей производных оксинтомодулина синтезировали производные оксинтомодулина со следующими аминокислотными последовательностями (Таблица 1).

В Таблице 1 аминокислоты, выделенные жирным шрифтом и подчеркиванием, представляют собой аминокислоты, образующие кольца, и аминокислоты, обозначенные X, означают неприродную аминокислоту, альфа-метил-глутаминовую кислоту. Кроме того, СА представляет собой 4-имидазоацетил, и DA представляет собой дезамино-гистидил.

Пример 2-2: Тест на in vitro активность производных оксинтомодулина

Для измерения эффективности производных оксинтомодулина против ожирения, синтезированных в Примере 2-1, измеряли клеточную активность in vitro с использованием клеточных линий, полученных в Примерах 1-1 и 1-2.

Использовали клеточные линии, которые были получены путем трансфицирования СНО (яичники китайского хомячка) для экспрессии гена человеческого рецептора GLP-1 и гена рецептора глюкагона, соответственно. Таким образом, они подходят для измерения активностей GLP-1 и глюкагона. Таким образом, активность каждого производного оксинтомодулина измеряли с использованием каждой трансформированной клеточной линии.

Конкретно, каждую клеточную линию субкультивировали дважды или трижды в неделю и распределяли аликвотами в каждую лунку 96-луночного планшета с плотностью 1×105, а затем культивировали в течение 24 часов.

Культивированные клетки промывали буфером KRB (бикарбонатный буфер Кребса-Рингера) и суспендировали в 40 мл буфера KRB, содержащего 1 мМ IBMX (изобутилметилксантин), и оставляли при комнатной температуре в течение 5 минут. Оксинтомодулин (SEQ ID NO:1) и производные оксинтомодулина (представленные последовательностями SEQ ID NO:2-6, 8, 10-13, 17, 18, 23-25, 27-30 и 31) разбавляли от 1000 нМ до 0,02 нМ 5-кратным серийным разведением и каждые их 40 мл добавляли к клеткам и культивировали при 37°С в течение 1 часа в CO2 инкубаторе. Затем 20 мл буфера для клеточного лизиса добавляли для лизиса клеток, и в клеточных лизатах измеряли концентрации цАМФ с использованием набора для анализа цАМФ (Molecular Device, USA). На их основе рассчитывали значения ЕС50 и сравнивали друг с другом. Значения EC50 показаны в следующей Таблице 2.

Как показано в Таблице 2, выявлены производные оксинтомодулина, проявляющие превосходные in vitro активности и отличные соотношения активностей в отношении рецептора GLP-1 и рецептора глюкагона по сравнению с нативным оксинтомодулином SEQ ID NO:1.

Известно, что оксинтомодулин активирует как рецептор GLP-1, так и рецептор глюкагона с подавлением аппетита, облегчением липолиза и стимулированием насыщения, тем самым проявляя эффекты против ожирения. Производные оксинтомодулина по настоящему изобретению показывают более высокие активности in vitro в отношении как рецептора GLP-1, так и рецептора глюкагона по сравнению с оксинтомодулином дикого типа, и поэтому могут быть использованы в качестве терапевтического агента для лечения ожирения с более высокой эффективностью по сравнению с известным оксинтомодулином.

Пример 3. Тест на in vivo активность производных оксинтомодулина

С целью измерения in vivo терапевтической активности производных оксинтомодулина изучали изменения в потреблении пищи при введении производных оксинтомодулина у мышей линии ob/ob с использованием нативного оксинтомодулина в качестве контроля.

Конкретно, диабетические мыши с ожирением ob/ob, обычно используемые для тестирования эффективности терапевтических агентов против ожирения и диабета, голодали в течение 16 часов, затем им вводили 1 или 10 мг/кг оксинтомодулина либо 0,02, 0,1, 1 или 10 мг/кг производного оксинтомодулина с SEQ ID NO:2. Затем, в течение 2 часов проверяли потребление пищи (Фиг. 1). На Фиг. 1 представлен график, показывающий изменения в потреблении пищи в зависимости от дозы введения оксинтомодулина или производного оксинтомодулина. Как показано на Фиг. 1, введение 1 мг/кг производного оксинтомодулина проявляло намного более сильное подавляющее действие в отношении потребления пищи, чем введение 10 мг/кг оксинтомодулина.

Взятые в целом производные оксинтомодулина по настоящему изобретению проявляют намного более сильные эффекты против ожирения, чем оксинтомодулин дикого типа, несмотря на то что вводится в более низкой дозе, указывая на улучшение проблем, связанных с оксинтомодулином дикого типа, который показывает более слабые эффекты против ожирения и должен быть введен в более высокой дозе три раза в сутки.

1. Пептид, способный к активации рецептора глюкагонподобного пептида-1 (GLP-1) и рецептора глюкагона, содержащий аминокислотную последовательность SEQ ID NO: 24, 25, 26 или 28.

2. Пептид по п. 1, содержащий аминокислотную последовательность SEQ ID NO: 24.

3. Пептид по п. 1, содержащий аминокислотную последовательность SEQ ID NO: 25.

4. Пептид по п. 1, содержащий аминокислотную последовательность SEQ ID NO: 26.

5. Пептид по п. 1, содержащий аминокислотную последовательность SEQ ID NO: 28.

6. Пептид по п. 1, где пара аминокислот по положениям 16 и 20 аминокислотной последовательности формулы 1 образует кольцо.

7. Фармацевтическая композиция для предупреждения или лечения ожирения, содержащая фармацевтически эффективное количество пептида по любому из пп. 1-6 в качестве активного ингредиента и фармацевтически приемлемый носитель.

8. Способ предупреждения или лечения ожирения, включающий введение субъекту композиции по п. 7 в комбинации либо в сочетании с другими фармацевтическими препаратами, проявляющими профилактические или терапевтические эффекты в отношении ожирения.

9. Способ по п. 8, где фармацевтический препарат, проявляющий профилактические или терапевтические эффекты в отношении ожирения, выбран из группы, состоящей из агониста рецептора GLP-1, агониста рецептора лептина, ингибитора дипептидилпептидазы-IV (DPP-IV), антагониста рецептора Y5, антагониста рецептора меланин-концентрирующего гормона (МСН), агониста рецептора Y2/3, агониста меланокортиновых рецепторов 3/4 (МС3/4), ингибитора желудочной/панкреатической липазы, агониста серотонинового рецептора 2с типа (5НТ2с), агониста рецептора β3А, агониста рецептора амилина, антагониста грелина и антагониста рецептора грелина.

10. Способ предупреждения или лечения ожирения, включающий стадию введения субъекту пептида по любому из пп. 1-6 или композиции по п. 7.

11. Применение пептида по любому из пп. 1-6 или композиции по п. 7 в изготовлении лекарственных средств для предупреждения или лечения ожирения.

12. Применение пептида по любому из пп. 1-6 или композиции по п. 7 для предупреждения или лечения ожирения.



 

Похожие патенты:

Изобретение относится к области биохимии. Описана группа изобретений, включающая пептид глюкагона, фармацевтическую композицию, содержащую вышеуказанный пептид глюкагона в терапевтически эффективном количестве, и способ применения вышеуказанного пептида глюкагона для получения лекарственного средства для лечения или предотвращения диабета, ожирения и связанных заболеваний и состояний.

Изобретение относится к области биотехнологии, конкретно к конъюгатам оксинтомодулина с Fc-областью иммуноглобулина, и может быть использовано в медицине для лечения ожирения.

Изобретение относится к новым конъюгатам пептидов глюкагонового суперсемейства, которые конъюгированы со стероидом, активирующим ядерный гормональный рецептор типа I.

Изобретение относится к пептидам (глюкагону и/или GLP-1 и их аналогам), ковалентно связанным с поверхностно-активными гликозидами, предназначенным для лечения или предупреждения нарушений, связанных с инсулинорезистентностью.

Изобретение относится к производному аналога GLP-1, где аналог содержит первый остаток К в позиции, соответствующей позиции 27 в GLP-1 (7-37) (SEQ ID №1); второй остаток К в позиции, соответствующей позиции 36 в GLP-1 (7-37), и максимум десять аминокислотных замен по сравнению с GLP-1 (7-37); где первый остаток К обозначается как К27, а второй остаток К обозначается как K36; где производное содержит две альбуминсвязывающие группировки, прикрепленные к К27 и K36, соответственно, через линкер, и альбуминсвязывающая группировка содержит пролонгирующую группировку, выбранную среди НООС-(СН2)x-СО- и НООС-С6Н4-O-(СН2)y-СО-; где x представляет собой целое число в диапазоне 6-16, а y представляет собой целое число в диапазоне 3-17; где линкер содержит элемент формулы -NH-(CH2)2-(O-(CH2)2)k-O-(CH2)n-CO-, где k представляет собой целое число в диапазоне 1-5 и n представляет собой целое число в диапазоне 1-5; или к его фармацевтически приемлемой соли, амиду или сложному эфиру.

Изобретение относится к пролекарственным препаратам, состоящим из пептидов, принадлежащих к суперсемейству глюкагонов, где указанный пептид, принадлежащий к суперсемейству глюкагонов, был модифицирован путем присоединения дипептида к пептиду, принадлежащему к суперсемейству глюкагонов, посредством амидной связи.

Изобретение относится к области биотехнологии, конкретно к получению производных аналогов GLP-1, и может быть использовано в медицине для лечения инсулиннезависимого сахарного диабета, инсулинозависимого сахарного диабета или ожирения.

Изобретение относится к области биотехнологии, конкретно к получению модифицированных пептидов глюкагона, и может быть использовано в медицине. Получают пептид глюкагона с активностью агониста глюкагона, характеризующийся аминокислотной последовательностью SEQ ID NO: 1, содержащей вплоть до 7 аминокислотных замещений по отношению к SEQ ID NO: 1, где одно из замещений аминокислот представляет собой замещение глютамина в положении 3 последовательности SEQ ID NO: 1 на аминокислоту, содержащую боковую цепь структуры I, и где аминокислота в положении 16 пептида глюкагона представляет собой аминоизомасляную кислоту (AIB).

Изобретение относится к области биотехнологии, конкретно к производным аналога GLP-1, и может быть использовано в медицине. Синтезируют соединение, обладающее активностью GLP-1 и являющееся производным аналога GLP-1, где аналог имеет первый остаток K37 в позиции, соответствующей позиции 37 GLP-1 (7-37) (SEQ ID №1), второй остаток K26 в позиции, соответствующей позиции 26 GLP-1 (7-37), а также не более четырех аминокислотных модификаций по сравнению с GLP-1 (7-37), включая K37 и Q или R в позиции, соответствующей позиции 34 в GLP-1 (7-37).

Настоящее изобретение относится к новым соединениям глюкагона, содержащим три или более отрицательно заряженных фрагмента, где один из указанных отрицательно заряженных фрагментов расположен дистально от липофильного фрагмента.

Изобретение относится к кристаллической форме натриевой соли (4-{4-[5-(6-трифторметил-пиридин-3-иламино)пиридин-2-ил]фенил}циклогексил)уксусной кислоты формулы (II) в форме Модификации С, где данная Модификация С характеризуется рентгеновской порошковой дифрактограммой, включающей два, четыре или более 2θ значений (±0,1 градус) (CuKα λ=1,5418 ), выбранных из группы, включающей значения 5,9, 17,0, 19,6, 22,5, 23,6, 26,4, 26,8, 28,4 и 30,0, при температуре около 22°C, которая может найти применения в лечении или профилактике состояния или расстройства, связанного с активностью DGAT1.

Настоящее изобретение относится к области фармацевтики, в частности к комбинации и композиции для лечения ожирения, избыточной массы тела и связанных с ним проблем со здоровьем.

Изобретение относится к области биотехнологии, конкретно к конъюгатам оксинтомодулина с Fc-областью иммуноглобулина, и может быть использовано в медицине для лечения ожирения.

Изобретение относится к области органической химии, а именно к новым производным 2,8-диазаспиро[4.5]декан-1-она или к их фармацевтически приемлемым солям, где R1 выбран из фенила, который замещен одним заместителем, выбранным из галогено-С1-4-алкокси; R2 выбран из фенила, пиридинила и 2-оксо-1,2-дигидро-пиридинила, которые замещены одним-двумя заместителями, независимо выбранными из C1-4-алкила, галогена, галогено-С1-4-алкила, гидрокси, С1-4-алкокси, галогено-С1-4-алкокси и бензилокси; n равно нулю.

Настоящее изобретение относится к соединениям формулы (I), их фармацевтически приемлемым солям или стереоизомерам, способу их получения и применению в медицине: где А представляет собой фенил, , или тиенил, где фенил замещен 1-5 атомами галогена и -OR7; R7 представляет собой C1-6 алкил, где C1-6 алкил возможно замещен одной или более группами, выбранными из дейтерия, галогена, C1-6 алкокси и C1-6 циклоалкокси; или указанный фенил замещен только -OR7, где R7 представляет собой C1-6 алкил, и указанный C1-6 алкил дополнительно замещен 1-3 группами, выбранными из галогена и С3-10 циклоалкокси; или, если А представляет собой или тиенил, тиенил возможно замещен одной или более группами, выбранными из галогена, C1-6 алкила и фенила, необязательно замещенного дейтерием или галогеном; R1, R2, R3 или R4 выбраны из водорода, C1-6 алкила или галогена; R5 и R6 выбраны из водорода и дейтерия.

Группа изобретений относится к гликемическому контролю пациентов с диабетом 2 типа с уровнем глюкозы через 2 часа после приёма пищи по меньшей мере 14 ммоль/л, у которых гликемия не контролируется должным образом только базальным инсулином.
Изобретение относится к медицине, в частности к эндокринологии и рефлексотерапии, и может быть использовано для коррекции избыточной массы тела при лечении ожирения.

Группа изобретений относится к медицине, а именно к гастро- и эндокринологии, и может быть использована для предотвращения, лечения, отсрочки возникновения, снижения заболеваемости или снижения тяжести состояния, связанного с употреблением пищи с высоким содержанием жира, жировой инфильтрации печени, постменопаузным ожирением, для повышения расхода энергии у пациента, увеличения тощей массы тела.

Изобретение относится к новым конъюгатам пептидов глюкагонового суперсемейства, которые конъюгированы со стероидом, активирующим ядерный гормональный рецептор типа I.

Настоящее изобретение относится к соединению и его фармацевтически или косметически приемлемым солям, применимым в качестве ингибитора натрий-зависимого котранспортера глюкозы, антиоксиданта и для депигментации кожи в медицине и косметологии, следующей формулы (I): а также к способам его получения и композициям на его основе, где n, m и р представляют собой независимо друг от друга 0 или 1, R представляет собой СН2ОН или CH2OR11, R1 и R2 представляют собой ОН или OR15, R3 представляет собой ОН или OR18, R4 представляет собой атом водорода, когда n=1, или атом водорода, атом галогена или группу ОН, когда n=0; X1 представляет собой атом водорода, атом галогена, группу ОН, (С1-С6)-алкил или OR24; U, V и W представляют собой фенил, пиразолил, N-(С1-С6)алкил-пиразолил или тиенил, необязательно замещенные одним или более заместителями, выбранными из атома галогена, ОН, (С1-С6)-алкила и OR24; R11, R15 и R18 представляют собой арил-(С1-С6)-алкил и R24 представляет собой (С1-С6)-алкил или арил-(С1-С6)-алкил.

Изобретение относится к области биотехнологии, конкретно к конъюгатам оксинтомодулина с Fc-областью иммуноглобулина, и может быть использовано в медицине для лечения ожирения.
Наверх