Стабильное при хранении жидкое моющее или чистящее средство, содержащее протеазу и целлюлазу

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении целлюлазы в жидком моющем или чистящем средстве, включающем целлюлазу и протеазу. Изобретение обеспечивает пониженную дезактивацию целлюлазы посредством вышеуказанной протеазы, тем самым позволяя сохранить высокую целлюлолитическую остаточную активность в указанном моющем или чистящем средстве даже после 8 недель хранения. 7 з.п. ф-лы, 2 табл., 1 пр.


Изобретение относится к области жидких моющих или чистящих средств. В частности, изобретение относится к содержащим ферменты жидким моющим и чистящим средствам, которые содержат определенные протеазы в комбинации с целлюлазой, а также к способу применения подобных средств. Кроме того, изобретение относится к применению определенных протеаз в жидких моющих или чистящих средствах, которые содержат целлюлазу.

В моющих и чистящих средствах предпочтительно используют протеазы типа субтилизина. Используемые в известных из уровня техники моющих или чистящих средствах протеазы своим первоначальным происхождением обязаны микроорганизмам, например, родов Bacillus, Streptomyces, Humicola или Pseudomonas, и/или их производят известными методами биотехнологии с помощью соответствующих микроорганизмов, например трансгенных хозяев для экспрессии родов Bacillus или элементарных нитевидных грибов.

В частности, современные жидкие моющие средства в растущих количествах содержат другие ферменты, в особенности целлюлазы (эндоглюканазы). Целлюлаза является ферментом, катализирующим гидролиз 1,4-β-D-глюкозидных связей целлюлозы (целлобиозы), лихенина и/или β-D-глюкананов. Целлюлазы нередко способны гидролизовать также 1,4-связи β-D-глюканов, которые помимо 1,4-связей содержат также 1,3-связи. Согласно принятой Комиссией по ферментам (ЕС) цифровой системе классификации ферментов целлюлазам соответствует ЕС-номер, и в соответствии с этим они относятся к третьему из шести основных классов ферментов, то есть к гидролазам Е.С.3.-.-.-, а именно к гликозилазам (Е.С.3.2.-.-) и, на более низком уровне, к гликозидазам (Е.С.3.2.1.-), то есть к ферментам, которые гидролизуют О- и/или S-гликозильные соединения. Целлюлазы способны расщеплять целлюлозу до β-глюкозы. Следовательно, целлюлазы при стирке прежде всего оказывают воздействие на содержащие целлюлозу или ее производные остатки и катализируют их гидролиз.

В международной заявке WO 95/23221 описаны протеазы, соответственно варианты протеазы типа субтилизина из Bacillus lentus DSM 5483, пригодные для использования в моющих или чистящих средствах. В одной из указанных протеаз может быть заменена также аминокислота R99E, A, S или G. Кроме того, моющие средства согласно цитируемой заявке могут содержать другие ферменты, к которым относится также целлюлаза. Моющие средства могут быть твердыми или жидкими. Однако в цитируемой публикации отсутствует непосредственная и однозначная информация о жидком моющем средстве, содержащем целлюлазу в комбинации с протеазой, которая в положении 99 в качестве аминокислоты содержит глутаминовую кислоту (Е) или аспарагиновую кислоту (D), аспарагин (N) или глутамин (Q), или аланин (А), глицин (G) или серин (S). То же относится и к европейскому патенту ЕР 1921147.

Недостаток содержащих протеазу и целлюлазу жидких моющих и чистящих средств уровня техники состоит в том, что они обладают недостаточной стабильностью при хранении, а следовательно, уже спустя короткое время в значительной мере утрачивают целлюлолитическую и/или протеолитическую, прежде всего целлюлолитическую активность. Присутствие протеазы часто приводит к потере целлюлолитической активности, поскольку протеаза дезактивирует целлюлазу. При этом моющее или чистящее средство утрачивает оптимальную эффективность очистки.

В основу настоящего изобретения была положена задача устранить указанный выше недостаток и предложить содержащие протеазу и целлюлазу жидкие моющие или чистящие средства, которые обладают достаточной, соответственно повышенной стабильностью при хранении, что прежде всего относится к их целлюлолитической активности.

В соответствии с этим объектом настоящего изобретения является жидкое моющее или чистящее средство, включающее:

(а1) протеазу, которая содержит аминокислотную последовательность, по меньшей мере на 80% идентичную указанной в SEQ ID NO. 1 аминокислотной последовательности, и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты глутаминовую кислоту (Е) или аспарагиновую кислоту (D),

(а2) протеазу, которая содержит аминокислотную последовательность, по меньшей мере на 80% идентичную указанной в SEQ ID NO. 1 аминокислотной последовательности, и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты аспарагин (N) или глутамин (Q), или

(a3) протеазу, которая содержит аминокислотную последовательность, по меньшей мере на 80% идентичную указанной в SEQ ID NO. 1 аминокислотной последовательности, и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты аланин (а), глицин (G) или серин (S), и

(b) целлюлазу.

Неожиданно было обнаружено, что жидкое моющее или чистящее средство, которое содержит комбинацию указанной выше протеазы с целлюлазой, предпочтительно обладает стабильностью при хранении. В частности, оно обладает более высокой целлюлолитической активностью после хранения по сравнению с моющим или чистящим средством, которое отличается от предлагаемого в изобретении средства лишь присутствующей в соответствующем средстве протеазой, причем в подлежащих сравнению средствах протеаза в начале хранения присутствует в такой же концентрации (в пересчете на активный фермент). Таким образом, предусматриваемая в настоящем изобретении протеаза обеспечивает пониженную дезактивацию целлюлазы. Однако пониженная дезактивация целлюлазы посредством используемой в соответствии с настоящим изобретением протеазы не обусловлена недостаточной активностью последней.

Кроме того, предлагаемое в изобретении средство отличается соответствующей, преимущественно высокой, в частности, предпочтительной эффективностью удаления чувствительных к протеазе загрязнений. Подобная эффективность очистки по отношению по меньшей мере к одному чувствительному к протеазе загрязнению проявляется также, в частности, при низких температурах, например, в температурном интервале от 10 до 50°С, предпочтительно от 10 до 40°С или от 20 до 40°С. Таким образом, предлагаемое в изобретении средство обеспечивает удовлетворительное или более эффективное удаление по меньшей мере одного загрязнения, предпочтительно нескольких чувствительных к протеазе загрязнений текстильных изделий и/или твердых поверхностей, например поверхностей посуды.

Таким образом, в отличие от цитированной в начале описания международной заявки WO 95/23221 в настоящем изобретении речь идет об особенно предпочтительном выборе, приводящем к получению эффективного и стабильного при хранении жидкого моющего средства, что прежде всего относится к его протеолитической и/или целлюлолитической активности, соответственно остаточной активности после хранения.

Согласно изобретению под эффективностью очистки подразумевают способность отбеливать одно или несколько загрязнений, прежде всего загрязнений белья. Примерами подобных загрязнений являются пятна крови-молока/туши на хлопке, цельного яйца/пигмента на хлопке, шоколада-молока/туши на хлопке, арахисового масла-пигмента/туши на сложном полиэфире/хлопке, травы на хлопке или какао на хлопке, в частности такие, как указано ниже. В соответствии с изобретением соответствующей эффективностью очистки обладает как моющее или чистящее средство, которое содержит протеазу и целлюлазу, соответственно образуемый этим средством моющий, соответственно чистящий раствор, так и сама протеаза, соответственно целлюлаза. Таким образом, присущая ферментам эффективность очистки способствует эффективности очистки средством, соответственно образуемым средством моющим, соответственно чистящим раствором. Эффективность очистки предпочтительно определяют, как указано ниже.

Под моющим, соответственно чистящим раствором подразумевают содержащий моющее или чистящее средство рабочий раствор, который воздействует на текстильные изделия или ткань (моющий раствор), соответственно на твердые поверхности (чистящий раствор), а, следовательно, вступает в контакт с загрязнениями, находящимися на текстильные изделиях, соответственно тканях, или на твердых поверхностях. Моющий, соответственно чистящий раствор обычно образуется на начальной стадии процесса стирки или чистки, например, в результате разбавления моющего или чистящего средства водой в стиральной машине или другой пригодной емкости.

В соответствии с настоящим изобретением предлагаемое в изобретении моющее или чистящее средство обладает стабильностью при хранении, если после хранения оно характеризуется более высокой активностью целлюлазы по сравнению с контрольной композицией, которая отличается от предлагаемого в изобретении моющего или чистящего средства лишь содержащейся в ней протеазой. Таким образом, предлагаемое в изобретении моющее или чистящее средство после хранения характеризуется более высокой активностью целлюлазы по сравнению с контрольной композицией. Оба подлежащих сравнению средства в начале хранения содержат одинаковое количество целлюлазы, соответственно обладают одинаковой концентрацией целлюлазы и/или одинаковой целлюлолитической исходной активностью. Кроме того, в начале хранения протеаза присутствует в обоих средствах в одинаковой концентрации в пересчете на активный фермент, и оба средства обрабатывают одинаковым образом, что прежде всего относится к условиям их хранения и определению ферментативной активности. Хранение средств предпочтительно осуществляют (в порядке возрастания) в течение по меньшей мере 24 часов, 48 часов, 72 часов, пяти дней, одной недели, двух недель, трех недель, четырех недели или восьми недель. Хранение предпочтительно осуществляют при температуре 20°С, 25°С или 30°С, особенно предпочтительно при 30°С.

Ферментативную активность можно определять обычно используемыми для этого методами, которые реализуют в соответствие с типом соответствующего фермента. Методы определения активности известны специалистам в области технологии ферментов, и их используют в установленном порядке. Методы определения активности протеазы опубликованы, например, в Tenside, том 7 (1970), c.125-132. Кроме того, протеолитическую активность можно определять путем высвобождения хромофорного пара-нитроанилина (pNA) из субстрата suc-L-Ala-L-Ala-L-Pro-L-Phe-п-нитроанилид (suc-AAPF-pNA). Протеаза расщепляет субстрат и высвобождает пара-нитроанилин. Высвобождение pNA обусловливает усиление поглощения при 410 нм, зависимость которого от времени является мерой ферментативной активности (смотри Del Mar и другие, 1979). Измерения осуществляют при температуре 25°С, показателе рН 8,6 и длине волны 410 нм. Время измерения составляет 5 минут при интервале измерений от 20 до 60 секунд. Активность протеазы предпочтительно указывают в РЕ (единицах протеазы).

Активность целлюлазы определяют обычно используемыми для этого методами. Активность целлюлазы предпочтительно определяют, как указано ниже. Целлюлазы высвобождают из карбоксиметилцеллюлозы (КМЦ) глюкозу. Подлежащие исследованию образцы инкубируют в определенных условиях реакции (100 ммолей натрийфосфатного буфера, рН 7,5, 40°С, 15 минут) совместно с субстратом (1,25% КМЦ). Образцы реагируют с гидразидом п-гидроксибензойной кислоты в присутствии висмута с образованием желтого окрашивающего вещества, которое может быть определено фотометрически при 410 нм. Необходимым условием является щелочной показатель рН во время реакции окрашивания. При этом мерой ферментативной активности является окрашивание соответствующего количества высвобождаемого сахара (смотри Lever, Anal. Biochem., 1972, 47 & 1977, 81).

Стабилизацию ферментов в соответствии с настоящим изобретением особенно предпочтительно определяют, как указано выше, с использованием содержащего протеазу и целлюлазу жидкого моющего или чистящего средства, которое хранят в течение по меньшей мере четырех, но не более восьми недель при температуре 30°С, причем протеолитическую активность определяют путем высвобождения хромофорного пара-нитроанилина из субстрата suc-AAPF-pNA, в то время как целлюлолитическую активность определяют, как указано выше.

Протеаза, присутствующая в предлагаемом в изобретении моющем или чистящем средстве, содержит аминокислотную последовательность, которая по меньшей мере на 80% идентична указанной в SEQ ID NO. 1 аминокислотной последовательности и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты глутаминовую кислоту (Е) или аспарагиновую кислоту (D), аспарагин (N) или глутамин (Q), или аланин (А), глицин (G) или серин (S). Аминокислотная последовательность предпочтительно идентична указанной в SEQ ID NO. 1 аминокислотной последовательности в порядке возрастания по меньшей мере на 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% и еще более предпочтительно на 99%. SEQ ID NO. 1 является последовательностью зрелой щелочной протеазы из Bacillus lentus DSM 5483, опубликованной в международной заявке WO 92/21760, которую следует считать соответствующей ссылкой.

Согласно изобретению обнаружено, что благодаря добавлению подобной протеазы к жидкому моющему или чистящему средству, которое содержит целлюлазу, получают особенно стабильное при хранении жидкое моющее средство, что прежде всего относится к остающейся после хранения целлюлолитической активности, в частности, после хранения, длительность которого в порядке возрастания предпочтительно составляет 24 часа, 48 часов, 72 часов, пять дней, одну неделю, две недели, три недели, четыре недели или восемь недель.

Протеаза, содержащаяся в предлагаемом в изобретении моющем или чистящем средстве, обладает протеолитической активностью, то есть способностью гидролизовать пептидные связи полипептида, соответственно белка. Таким образом, она является ферментом, катализирующим гидролиз пептидных связей, а следовательно, способным расщеплять пептиды или белки. Протеазой прежде всего является субтилаза, особенно предпочтительно субтилизин.

Целлюлаза является ферментом указанного в начале описания типа. Для обозначения целлюлазы можно использовать термины-синонимы, в частности эндоглюканаза, эндо-1,4-бета-глюканаза, карбоксиметилцеллюлаза, эндо-1,4-бета-D-глюканаза, бета-1,4-глюканаза, бета-1,4-эндоглюкангидро-лаза, целлудекстриназа или авицелаза. Решающее значение для определения, является тот или иной фермент соответствующей настоящему изобретению целлюлазой, имеет способность этого фермента гидролизовать 1,4-β-D-глюкозидные связи целлюлозы.

К поставляемым на рынок сбыта целлюлазам (эндоглюканазам) согласно изобретению относится, например, обогащенный эндоглюканазой грибовидный препарат целлюлазы, соответственно его усовершенствованные варианты, поставляемые фирмой Novozymes под торговым названием Celluzyme®. Выпускаемые этой фирмой продукты Endolase® и Carezyme® основаны на 50 kD-EG, соответственно 43 kD-EG из Humicola Insolens DSM 1800. Другими используемыми товарными продуктами указанной фирмы являются, Cellusoft®, Renozyme® и Celluclean®. Кроме того, можно использовать, например, целлюлазы, поставляемые фирмой АВ Enzymes (Финляндия) под торговыми названиями Ecostone® и Biotouch®, которые по меньшей мере частично основаны на 20 kD-EG из черноплодки. Другими поставляемыми фирмой АВ Enzymes целлюлазами являются Econase® и Ecopulp®. К другим пригодным целлюлазам относятся целлюлазы из Bacillus sp. CBS 670.93 и CBS 669.93, причем целлюлазы из Bacillus sp. CBS 670.93 под торговым названием Puradax® поставляет фирма Danisco/Genencor. Другими используемыми товарными продуктами фирмы Danisco/Genencor являются ʺGenencor detergent cellulase Lʺ и IndiAge®Neutra.

Согласно изобретению можно использовать также варианты указанных выше ферментов, которые могут быть получены посредством точечных мутаций. Особенно предпочтительными целлюлазами являются варианты целлюлазы из Thielavia terrestris, описанные в международной заявке WO 98/12307, целлюлазы из Melanocarpus, в частности из Melanocarpus albomyces, описанные в международной заявке WO 97/14804, целлюлазы типа EGIII из Trichoderma reesei, описанные в европейском патенте ЕР 1305432, соответственно варианты, которые могут быть получены из указанных целлюлаз, в частности, описанные в европейских патентах ЕР 1240525 и ЕР 1305432, а также целлюлазы, описанные в международных заявках WO 1992006165, WO 96/29397 и WO 02/099091. Соответствующие публикации и относящийся к ним объем раскрытия следует считать относящимися к настоящей заявке ссылками.

Согласно другому варианту осуществления изобретения моющее или чистящее средство отличается тем, что протеаза содержит также по меньшей мере одну из следующих аминокислот (при отсчете положений согласно SEQ ID NO. 1):

(a) треонин в положении 3 (3Т),

(b) изолейцин в положении 4 (4I),

(c) аланин, треонин или аргинин в положении 61 (61А, 61Т или 61R),

(d) аспарагиновую или глутаминовую кислоту в положении 154 (154D или 154Е),

(e) пролин в положении 188 (188Р),

(f) метионин в положении 193 (193М),

(g) изолейцин в положении 199 (199I),

(h) аспарагиновую кислоту, глутаминовую кислоту или глицин в положении 211 (211D, 211Е или 211G),

(i) комбинации аминокислот от (а) до (h).

Таким образом, протеаза помимо одной из указанных аминокислот, находящейся в положении 99, содержит в соответствующих положениях одну или несколько аминокислот из приведенного выше перечня. Аминокислоты из этого перечня могут придавать протеазам другие предпочтительные свойства и/или дополнительно усиливать те свойства, которыми они уже обладают. Указанные выше аминокислоты способствуют, в частности, повышению протеолитической активности и/или стабильности протеаз в жидком моющем или чистящем средстве, соответственно в образуемом этим моющим или чистящим средством моющем растворе. Таким образом, благодаря добавлению подобной протеазы к жидкому моющему или чистящему средству, которое содержит целлюлазу, получают также особенно стабильное при хранении жидкое моющее средство, что прежде всего относится не только к остающейся после хранения целлюлолитической активности, но и предпочтительно также к остающейся после хранения протеолитической активности, в частности, после хранения, длительность которого предпочтительно составляет в порядке возрастания 24 часа, 48 часов, 72 часов, пять дней, одну неделю, две недели, три недели, четыре недели или восемь недель. Кроме того, подобное средство обладает повышенной эффективностью очистки чувствительных к протеазе и/или целлюлазе загрязнений.

При этом положения аминокислот задают путем выравнивания аминокислотной последовательности подлежащей использованию протеазы из Bacillus lentus в соответствии с аминокислотной последовательностью, указанной в SEQ ID NO. 1. Поскольку протеаза из Bacillus lentus в уровне техники представляет собой важный молекулярный эталон для описания протеазы и изменений аминокислот, при упорядочении положений аминокислот предпочтительно следует ссылаться на их отсчет в протеазе из Bacillus lentus (SEQ ID NO. 1). Кроме того, при отсчете положений аминокислот руководствуются их положением в зрелом белке. Подобное упорядочение прежде всего необходимо соблюдать также в том случае, если аминокислотная последовательность подлежащей использованию протеазы содержит большее число аминокислотных остатков, чем протеаза из Bacillus lentus согласно SEQ ID NO. 1. Исходя из указанных положений в аминокислотной последовательности протеазы из Bacillus lentus, положения аминокислот в подлежащей использованию согласно изобретению протеазе аналогичны именно тем, которые приписаны им при выравнивании.

Таким образом, при выравнивании в соответствии с SEQ ID NO. 1, а следовательно, при отсчете согласно SEQ ID NO. 1 помимо положения 99 особенно предпочтительными должны являться положения 3, 4, 61, 154, 188, 193, 199 и 211. В указанных положениях в молекуле протеазы из Bacillus lentus природного типа находятся аминокислотные остатки S3, V4, G61, S154, А188, V193, V199 и L211. Особенно предпочтительными являются аминокислоты 3Т, 4I, 61А, 154D, 154Е, 211D, 211G и 211Е, если соответствующие положения в подлежащей использованию согласно изобретению протеазе уже не заняты одной из этих предпочтительных аминокислот. Замены 3Т и 4I, например, благодаря стабилизирующему воздействию на молекулу приводят к повышению стабильности при хранении и чистящей эффективности протеазы, а следовательно, к повышению эффективности очистки предлагаемым в изобретении жидким моющим или чистящим средством, которое содержит протеазу.

При реализации соответствующего положения одной или нескольких указанных выше аминокислот помимо положения 99 имеют место другие отклонения от последовательности SEQ ID NO. 1, поскольку эта последовательность содержит в соответствующем положении другую аминокислоту. Следовательно, в зависимости от числа имеющихся отклонений от последовательности SEQ ID NO. 1 получают разные максимальные значения идентичности, которыми может обладать подлежащая использованию согласно изобретению протеаза, даже если во всех прочих аминокислотах они должны совпадать с SEQ ID NO. 1. Данное обстоятельство в конкретном случае следует учитывать для каждой возможной комбинации предлагаемых аминокислот, а также в зависимости от длины аминокислотной последовательности протеазы. Так, например, максимальная идентичность при одном, двух, три, четырех, пяти, шести, семи, восьми или девяти изменениях аминокислотной последовательности составляет 99,63%, 99,26%, 98,88%, 98,51%, 98,14%, 97,77%, 97,40%, 97,03%, соответственно 96,65% в случае последовательности, состоящей из 269 аминокислот, соответственно 99,64%, 99,27%, 98,91%, 98,55%, 98,18%, 97,82%, 97,45%, 97,09%, соответственно 96,73% в случае последовательности, состоящей из 275 аминокислот.

Идентичность последовательностей нуклеиновых или аминокислот определяют путем сравнения этих последовательностей. Сравнение осуществляют, сопоставляя друг с другом аналогичные чередования в последовательностях нуклеотидов или последовательностях аминокислот. Подобное сравнение, предпочтительно выполняемое на основе широко известного и обычно используемого в уровне техники алгоритма BLAST (смотри, например, Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J. (1990) ʺBasic local alignment search tool.ʺ J. Mol. Biol. 215:403-410, а также Altschul, Stephan F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Hheng Zhang, Webb Miller and David J. Lipman (1997): ʺGapped BLAST and PSI-BLAST: a new generation of protein database search programsʺ; Nucleic Acids Res., 25, c.3389-3402), в принципе состоит в сопоставлении друг с другом аналогичных чередований нуклеотидов или аминокислот в последовательностях нуклеиновых кислот, соответственно аминокислот. Представленное в табличной форме упорядочение соответствующих положений называют выравниванием. Другим доступным из уровня техники алгоритмом является алгоритм FASTA. Сравнение последовательностей (выравнивание), в особенности сравнение сложных последовательностей обычно выполняют с помощью компьютерных программ. Так, например, часто используют серию программ Clustal (смотри, например, Chenna и другие (2003): Multiple sequence alignment with the Clustal series of programs. Nucleic Acid Research. 31, 3497-3500), T-Coffee (смотри, например, Notredame и другие (2000): T-Coffee: A novel method for multiple sequence alignments. J. Mol. Biol. 302, 205-217) или программы, основанные на указанных выше программах, соответственно алгоритмах. Согласно настоящему изобретению сравнения последовательностей и выравнивания предпочтительно осуществляют, используя компьютерную программу Vector NTI® Suite 10.3 (Invitrogen Corporation, 1600 Faraday Avenue, Карлсбад, Калифорния, США) с заданными (по умолчанию) стандартными параметрами.

Указанное сравнение позволяет судить о подобии сравниваемых последовательностей. Подобие обычно указывают в процентах идентичности, что соответствует доле идентичных нуклеотидов или аминокислотных остатков в одинаковых или соответствующих друг другу положениях при выравнивании. Другой относящийся к гомологии термин используют в случае консервативных замен аминокислот в последовательностях аминокислот, то есть аминокислот с подобными свойствами, поскольку последние в составе белка чаще всего обладают аналогичными активностями, соответственно функциями. Таким образом, подобие сравниваемых последовательностей может быть указано также в процентах гомологии или в процентах подобия. Касающиеся идентичности и/или гомологии данные могут относиться к целым полипептидам или генам или лишь к отдельным участкам последовательностей. Следовательно, гомологи, соответственно идентичные участки разных последовательностей нуклеиновых кислот или аминокислот определяются совпадениями в последовательностях. Подобные участки часто обладают одинаковыми или подобными функциями. Они могут быть короткими участками, состоящими лишь из небольшого числа нуклеотидов, соответственно аминокислот. Подобные короткие участки часто выполняют весьма важные для общей активности белка функции. В связи с этим целесообразным может быть отнесение соответствий последовательностей лишь к отдельным, при необходимости коротким участкам. Однако в соответствии с настоящим изобретением в отсутствие особых указаний данные, касающиеся идентичности, соответственно гомологии, относятся ко всей длине соответствующей указанной последовательности нуклеиновых кислот или аминокислот.

В другом варианте данного объекта изобретения моющее или чистящее средство отличается тем, что протеаза содержит аминокислотную последовательность, которая, как указано выше, идентична указанной в SEQ ID NO. 1 аминокислотной последовательности и которую получают (соответственно которая может быть получена) из протеазы согласно SEQ ID NO. 1 путем однократного или многократного консервативного замещения аминокислот, причем, как указано выше, в протеазе в положении 99 по-прежнему присутствует одна из предусматриваемых для указанного положения аминокислот. Термин «консервативное замещение аминокислот» означает замену (замещение) аминокислотного остатка другим аминокислотным остатком, причем подобная замена не приводит к изменению полярности или заряда замененной в указанном положении аминокислоты: так, например, речь идет о замене неполярного аминокислотного остатка другим неполярным аминокислотным остатком. В соответствии с изобретением консервативными замещениями аминокислот являются, например, G=A=S, I=V=L=M, D=E, N=Q, K=R, Y=F, S=T, G=A=I=V=L=M=Y=F=W=P=S=T.

В другом варианте осуществления изобретения предлагаемое в изобретении моющее или чистящее средство отличается также тем, что эффективность выполняемой им очистки по меньшей мере соответствует эффективности очистки моющим или чистящим средством, содержащим протеазу, которая включает аминокислотную последовательность, соответствующую аминокислотной последовательности SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8, особенно предпочтительно аминокислотной последовательности SEQ ID NO. 2. Эффективность очистки определяют в системе стирки, которая содержит включающее целлюлазу моющее средство в дозировке от 2,0 до 9,0 граммов на литр моющего раствора, а также протеазу, причем подлежащие сравнению протеазы используют в одинаковой концентрации (в пересчете на активный белок) и причем определяют эффективность удаления одного или нескольких загрязнений кровь-молоко/тушь на хлопке, цельное яйцо/пигмент (яичный меланж/сажа) на хлопке, арахисовое масло-пигмент/тушь на сложном полиэфире/хлопке и трава на хлопке, в частности, одного или нескольких следующих загрязнений:

- кровь-молоко/тушь на хлопке: продукт Nr. C-05, который может быть поставлен CFT (Центром по испытанию материалов, B.V. Влаардинген, Нидерланды),

- цельное яйцо/пигмент (яичный меланж/сажа) на хлопке: продукт Nr. 10N, который может быть поставлен фирмой wfk Testgewebe GmbH (Брюгген-Брахт, Германия), или продукт C-S-37, который может быть предоставлен CFT (Центром по испытанию материалов, B.V. Влаардинген, Нидерланды),

- арахисовое масло-пигмент/тушь на сложном полиэфире/хлопке: продукт Nr. PC-10, который может быть поставлен CFT (Центром по испытанию материалов, B.V. Влаардинген, Нидерланды),

- трава на хлопке: продукт Nr. 164, который может быть поставлен фирмой Eidgenossische Material- und Prufanstalt (EMPA) Testmaterialien AG (St. Gallen, Швейцария),

путем измерения степени белизны подвергнутых стирке текстильных изделий, процесс стирки которых реализуют в течение по меньшей мере 30 минут, при необходимости в течение 60 минут, при температуре 20°С и жесткости воды от 15,5 до 16,5° (немецкая жесткость).

Моющее средство для системы стирки является жидким моющим средством, которое обладает следующим составом (все данные указаны в массовых процентах): от 0,3 до 0,5% ксантана, от 0,2 до 0,4% антивспенивающего средства, от 6 до 7% глицерина, от 0,3 до 0,5% этанола, от 4 до 7% сульфоэфира жирного спирта, от 24 до 28% неионных поверхностно-активных веществ, 1% борной кислоты, от 1 до 2% цитрата натрия (дигидрата), от 2 до 4% соды, от 14 до 16% жирных кислот кокосовых орехов, 0,5% 1-гидроксиэтан-(1,1-дифосфоновой кислоты), от 0 до 0,4% поливинилпирролидона, от 0 до 0,05% оптических отбеливателей, от 0 до 0,001% красителя, от 0,0002 до 0,06% целлюлазы (активного белка), в качестве которой предпочтительно используют препарат целлюлазы Ecostone N400® фирмы АВ Enzymes, остальное деминерализованная вода. Протеазу в моющем средстве используют в концентрации от 0,001 до 0,1%, предпочтительно от 0,01 до 0,06% (в пересчете на активный белок). Дозировка жидкого моющего средства составляет от 2,0 до 9,0, предпочтительно от 3,0 до 8,2 и от 4,0 до 7,5 граммов на литр моющего раствора, особенно предпочтительно 4,7 граммов на литр моющего раствора. Стирку осуществляют при показателе рН в диапазоне от 8 до 10,5, предпочтительно от 8 до 9. Значения активности в моющем растворе как протеазы, так и целлюлазы в начале стирки отличаются от ноля.

Степень белизны, то есть отбеливания загрязнений, в качестве меры эффективности очистки определяют оптическими методами измерения, предпочтительно фотометрически. Пригодным для этой цели прибором является, например, спектрометр Minolta CM508d. Используемые для измерения приборы обычно подвергают предварительной калибровке с белым стандартом, который предпочтительно поставляют вместе с прибором.

В другом варианте осуществления изобретения моющее или чистящее средство отличается также тем, что его стабильность при хранении по меньшей мере соответствует стабильности при хранении моющего или чистящего средства, которое содержит протеазу, включающую аминокислотную последовательность, соответствующую аминокислотной последовательности в SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8, особенно предпочтительно в SEQ ID NO. 2. Предлагаемое в изобретении моющее или чистящее средство обладает подобной стабильностью при хранении в том случае, если после хранения в течение восьми недель при 30°С активность содержащейся в нем целлюлазы соответствует активности целлюлазы, содержащейся в используемом для сравнения моющем или чистящем средстве, или превышает ее, причем предлагаемое в изобретении средство отличается от используемого для сравнения моющего или чистящего средства лишь содержащейся в нем протеазой.

Под используемым для сравнения средством особенно предпочтительно подразумевают жидкое моющее средство, которое обладает следующим составом (все данные указаны в массовых процентах): от 0,3 до 0,5% ксантана, от 0,2 до 0,4% антивспенивающего средства, от 6 до 7% глицерина, от 0,3 до 0,5% этанола, от 4 до 7% сульфоэфира жирного спирта, от 24 до 28% неионных поверхностно-активных веществ, 1% борной кислоты, от 1 до 2% цитрата натрия (дигидрата), от 2 до 4% соды, от 14 до 16% жирных кислот кокосовых орехов, 0,5% 1-гидроксиэтан-(1,1-дифосфоновой кислоты), от 0 до 0,4% поливинилпирролидона, от 0 до 0,05% оптических отбеливателей, от 0 до 0,001% красителя, от 0,0002 до 0,06% целлюлазы (активного белка), в качестве которой предпочтительно используют препарат целлюлазы Ecostone N400® фирмы АВ Enzymes, остальное деминерализованная вода. Протеазу используют в моющем средстве в концентрации от 0,001 до 0,1%, предпочтительно от 0,01 до 0,06% (в пересчете на активный белок).

В начале хранения оба подлежащих сравнению средства обладают одинаковой исходной целлюлолитической активностью, содержат протеазу в одинаковой концентрации (в пересчете на активный фермент) и оба средства подвергают обработке одинаковым методом. Протеолитическую активность в соответствующих средствах определяют посредством высвобождения хромофора (пара-нитроанилина, pNA) из субстрата suc-AAPF-pNA, в то время как соответствующую целлюлолитическую активность определяют, как указано выше. Значения исходной активности протеазы и целлюлазы в соответствующих средствах отличаются от ноля.

Использование обладающей одинаковой активностью соответствующей целлюлазы и протеаз с одинаковым диапазоном концентраций (в пересчете на активный белок) позволяет сравнивать реальные ферментативные свойства также и при возможном несоответствии отношений активного вещества к общему белку (удельной активности).

Согласно настоящему изобретению в отсутствие особых указаний соответствующие количественные данные приводят в пересчете на массу жидкого моющего средства.

Многочисленные протеазы, в частности субтилизины, образуются в виде так называемых пребелков, то есть совместно с пропептидом и сигнальным пептидом, причем функция сигнального пептида обычно заключается в обеспечении выведения протеазы из продуцирующей ее клетки в периплазму или окружающую клетку среду, тогда как пропептид обычно необходим для корректного образования складчатой структуры протеазы. Сигнальный пептид и пропептид, как правило, являются N-концевой частью пребелка. Сигнальный пептид в природных условиях отщепляется от остальной протеазы посредством сигнальной пептидазы. Затем происходит поддерживаемое пропептидом корректное окончательное формирование складчатой структуры протеазы. В этом случае протеаза находится в своей активной форме и сама отщепляет пропептид. После отщепления пропептида зрелая протеаза, прежде всего субтилизин, проявляет присущую ей каталитическую активность без первоначально присутствовавших N-концевых аминокислот. Для технического применения в общем случае и, в частности, в соответствии с настоящим изобретением, более предпочтительными, чем пребелки, являются зрелые протеазы, то есть участвующие в процессе ферменты после их получения. Кроме того, протеазы из продуцирующих их клеток после формировния полипептидной цепи можно модифицировать, например, путем присоединения молекул сахара, формилирования, аминирования и так далее. Подобные модификации являются посттрансляционными модификациями и могут, однако, не должны оказывать влияние на функцию протеазы.

Кроме того, зрелая протеаза может быть укорочена с ее N- и/или C-концов, вследствие чего предлагаемое в изобретении моющее или чистящее средство содержит протеазу, укороченную по сравнению с SEQ ID NO. 1, соответственно SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8, то есть фрагмент. В этом случае любые касающиеся идентичности данные относятся к участку, на котором соответствующий фрагмент при выравнивании приведен в соответствие с SEQ ID NO. 1. Однако соответствующий фрагмент в каждом случае включает положение, которое при выравнивании приведено в соответствие с положением 99 SEQ ID NO. 1, и в этом положении содержит соответствующую аминокислоту. В предпочтительном варианте фрагмент включает также одно или несколько других указанных выше положений, в которых он содержит соответствующую аминокислоту. Кроме того, подобный фрагмент обладает протеолитической активностью. Соответствующий другой предпочтительный фрагмент включает аминокислотную последовательность, которая на протяжениии по меньшей мере 50 или по меньшей мере 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 265, 266, 267 или 268 взаимосвязанных положений аминокислот совпадает с SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8 с учетом указанных выше аминокислот в положении 99 и при необходимости также в положениях 3, 4, 61, 154, 188, 193, 199 и/или 211. Эффективность очистки предлагаемым в изобретении жидким моющим или чистящим средством с подобным фрагментом и/или стабильность подобного средства при хранении особенно предпочтительно по меньшей мере аналогичны таковым, характерным для моющего или чистящего средства, которое включает протеазу, содержащую аминокислотную последовательность, соответствующую аминокислотной последовательности в SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8, соответственно определена, как указано выше.

Другим объектом настоящего изобретения является жидкое моющее или чистящее средство, содержащее:

(а) протеазу, выбранную из группы, включающей:

а. протеазу, содержащую аминокислотную последовательность согласно SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8,

b. протеазу, которая по меньшей мере в одном положении содержит измененную по сравнению с SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8 аминокислотную последовательность, причем изменение при отсчете согласно SEQ ID NO. 1 выбрано из группы, включающей:

i. треонин в положении 3 (3Т),

ii. изолейцин в положении 4 (4I),

iii. аланин, треонин или аргинин в положении 61 (61А, 61Т или 61R),

iv. аспарагиновую кислоту или глутаминовую кислоту в положении 154 (154D или 154Е),

v. пролин в положении 188 (188Р),

vi. метионин в положении 193 (193М),

vii. изолейцин в положении 199 (199I),

viii. аспарагиновую кислоту, глутаминовую кислоту или глицин в положении 211 (211D, 211Е или 211G),

ix. комбинации аминокислот от (i) до (viii),

(b) целлюлазу.

Указанные протеазы еще более предпочтительно используют в предлагаемом в изобретении жидком моющем или чистящем средстве. Их получают из SEQ ID NO. 1 путем замещения аргинина в качестве находящейся в положении 99 аминокислоты, используемой в качестве аминокислоты глутаминовой (Е) или аспарагиновой кислоты (D), используемым в качестве аминокислоты аспарагином (N) или глутамином (Q) или используемым в качестве аминокислоты аланином (А), глицином (G) или серином (S) при отсчете согласно SEQ ID NO. 1. Указанные аминокислотные последовательности приведены в протоколе последовательностей в качестве SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 и SEQ ID NO. 8. Помимо предусматриваемой для положения 99 аминокислоты указанные протеазы могут содержать также одну или несколько указанных выше аминокислот в положениях 3, 4, 61, 154, 188, 193, 199 и 211, которые при выравнивании подлежат приведению в соответствие с SEQ ID NO. 1, соответственно отсчету согласно SEQ ID NO. 1. Указанные аминокислоты в указанных положениях способствуют также наличию других предпочтительных свойств у указанных протеаз и/или дополнительно усиливают уже имеющиеся свойства протеаз. В частности, они способствуют повышению протеолитической активности и/или стабильности протеазы в жидком моющем или чистящем средстве, соответственно в образуемом этим моющим или чистящим средством моющем растворе. Все приведенные выше варианты в случае их применимости соответственно относятся к особенно предпочтительным протеазам.

Содержание протеазы в предлагаемом в изобретении средстве в пересчете на активный белок в порядке возрастания предпочтительно составляет от 1×10-8 до 5% масс., от 0,0001 до 1% масс., от 0,0005 до 0,5% масс. или от 0,001 до 0,1% масс., особенно предпочтительно от 0,001 до 0,06% масс.. Содержание целлюлазы в предлагаемом в изобретении средстве в пересчете на активный белок в порядке возрастания предпочтительно составляет от 1×10-8 до 5% масс., от 0,00001 до 1% масс., от 0,00005 до 0,5 % масс. или от 0,0001 до 0,1% масс., особенно предпочтительно от 0,0001 до 0,065% масс. Концентрацию белка можно определять известными методами, например методом ВСА (предусматривающим использование бицинхониновой кислоты, 2,2'-бихинолил-4,4'-дикарбоновой кислоты) или биуретовым методом (A.G. Gornall, C.S. Bardawill, M.M. David, J. Biol. Chem., 177 (1948), cc.751-766). В соответствии с этим концентрацию активного белка определяют путем титрования активных центров с использованием пригодного необратимого ингибитора (для протеазы, например, фенилметилсульфонилфторида) и определения остаточной активности (смотри М. Bender и другие, J. Am. Chem. Soc. 88, 24 (1966), c.5890-5913).

Кроме того, с целью защиты от преждевременной дезактивации протеазу и/или целлюлазу можно адсорбировать на носителях и/или помещать в оболочку из обволакивающих веществ. При этом фермент высвобождается в моющем растворе, то есть в условиях применения, и может проявлять присущее ему каталитическое действие.

В другом варианте осуществления изобретения моющее или чистящее средство отличается тем, что оно содержит также компонент, выбранный из группы, включающей:

i. анионное и/или полианионное вещество,

ii. катионное и/или поликатионное вещество и/или

iii. вещество, содержащее гидроксильную(-ые) и/или полигидроксильную(-ые) группу(-ы).

Установлено, что добавление указанных веществ обеспечивает дополнительное повышение эффективности очистки посредством соответствующих моющих и чистящих средств, в частности жидких моющих и чистящих средств, которые содержат протеазы и целлюлазы, особенно таких, как указано выше, что в особенности относится к сравнительно низким температурам, в частности от 10 до 50°С, от 10 до 40°С, от 10 до 30°С и/или от 20 до 40°С. При комбинировании указанных веществ с подлежащей использованию согласно изобретению протеазой, в частности, возникает синергический эффект, прежде всего, при удалении по меньшей мере одного чувствительного к протеазе загрязнения, в частности, указанного выше типа.

Под указанными выше веществами i. подразумевают анионные или полианионные вещества, которые обладают по меньшей мере одним, предпочтительно несколькими отрицательными зарядами. Речь при этом предпочтительно идет о полимере по меньшей мере с одним отрицательно заряженным мономером, предпочтительно с несколькими отрицательно заряженными мономерами. Таким образом, согласно изобретению предпочтительным полимером данного типа является отрицательно заряженный полимер. Подобными полимерами предпочтительно являются, например, органические кислоты, соответственно их соли, в частности, полиакрилаты, полисахарные кислоты, полиакрилатные сополимеры и/или полисахарные сополимеры. Другими соответствующими предпочтительными соединениями являются полиакрилсульфонаты или поликарбоксилаты и их соли, сополимеры или соли сополимеров.

Примерами подлежащих особенно предпочтительному использованию веществ являются Acusol 587D (полиакрилсульфонат, фирма Rohm & Haas/Dow Chemical), Acusol 445N (натриевая соль поликарбоксилата, фирма Rohm & Haas/Dow Chemical), Acusol 590 (полиакрилатный сополимер, фирма Rohm & Haas/Dow Chemical), Acusol 916 (Rohm & Haas/Dow Chemical), Sokalan CP42 (модифицированная натриевая соль поликарбоксилата, фирма BASF), Sokalan PA 30CL (натриевая соль поликарбоксилата, фирма BASF), Dequest P 9000 (полималеиновая кислота, фирма Thermphos), альгиновая кислота, поли-2-акриламидо-2-метил-1-пропан-сульфокислота, натриевая соль сополимера 4-стиролсульфокислоты с малеиновой кислотой, натриевая соль сополимера акриламида с акриловой кислотой, натриевая соль полиметакриловой кислоты, полиметилвинилэфират малеиновой кислоты или натриевая соль поливинилсульфокислоты.

Под указанными выше веществами ii. подразумевают катионные или поликатионные вещества, которые обладают по меньшей мере одним, предпочтительно несколькими положительными зарядами. Речь при этом предпочтительно идет о полимере по меньшей мере с одним положительно заряженным мономером, предпочтительно с несколькими положительно заряженными мономерами. Таким образом, согласно изобретению предпочтительным полимером данного типа является положительно заряженный полимер. Примерами соответствующих предпочтительных соединений являются соли полиаминов, полиэтиленимины, соответственно их сополимеры, соли полиаллиламинов, соли соединений полидиаллилдиметиламмония или сополимеры акриламидов с диаллилдиметиламмонием.

Под указанными выше веществами iii. подразумевают вещества, которые содержат по меньшей мере одну гидроксильную и/или полигидроксильную группу, предпочтительно несколько гидроксильных и/или полигидроксильных групп. Соответствующими веществами предпочтительно являются, например, поливиниловые спирты, выпускаемые, например, фирмой Kremer Pigmente GmbH & Со. KG под торговым названием Mowiol.

В данном месте настоящего описания необходимо подчеркнуть, что то или иное конкретное вещество может соответствовать одной из указанных выше групп i.-iii. или нескольким группам i.-iii. Так, например, речь может идти об анионном полимере, который содержит одну или несколько гидроксильных и/или полигидроксильных групп. В этом случае вещество относится к группам i. и iii. Кроме того, катионный полимер, который содержит одну или несколько гидроксильных и/или полигидроксильных групп, относится к группам ii. и iii.

Кроме того, в соответствии с настоящим изобретением можно использовать производные указанных выше веществ i. ii. или iii.. В соответствии с изобретением под производным подразумевают вещество, образующееся в результате химического модифицирования одного из указанных выше веществ, осуществляемого, например, путем превращения боковой цепи или ковалентного присоединения другого соединения к веществу. Подобное соединение может относиться, например, к низкомолекулярным соединениям, таким как липиды, моносахариды, олигосахариды, полисахариды или амины, соответственно аминные соединения. Кроме того, вещество может быть гликозилированным, гидролизованным, окисленным, N-метилированным, N-формилированным или N-ацетилированным или может содержать метил, формил, этил, ацетил, трет-бутил, анизил, бензил, трифторацетил, N-гидроксисукцинимид, трет-бутилоксикарбонил, бензоил, 4-метилбензил, тиоанизил, тиокрезил, бензилоксиметил, 4-нитрофенил, бензилоксикарбонил, 2-нитробензоил, 2-нитрофенилсульфенил, 4-толуолсульфонил, пентафторфенил, дифенилметил, 2-хлорбензилоксикарбонил, 2,4,5-трихлорфенил, 2-бромбензилоксикарбонил, 9-флуоренил-метилоксикарбонил, трифенилметил или 2,2,5,7,8-пентаметилхроман-6-сульфонил. Кроме того, под производным подразумевается также ковалентно или нековалентно связанное с макромолекулярным носителем вещество, а также нековалентное включение в пригодных макромолекулярных клатратных структурах. Могут быть реализованы также связи с прочими макромолекулярными соединениями, например с полиэтиленгликолем. К другим вариантам предпочтительного химического модифицирования относится модифицирование одной или нескольких химических групп -СООН, -ОН, =NH, -NH2 или -SH в -COOR, -OR, -NHR, -NR2, -NHR, -NR, -SR, причем:

R означает -CH=CH-R2, -C=C-R2, -C(R2)=CH2, -C(R2)=C(R3), -CH=NR2, -C(R2)=N-R3, замещенную или незамещенную кольцевую систему с 4-7 атомами углерода, замещенный или незамещенный азотсодержащий гетероцикл с 4-7 атомами углерода или цепь с 2-8 атомами углерода и 1-5 двойными или тройными связями, с заместителями, выбранными из группы, включающей R1, R2 или R3, причем:

R1 означает Н, -R, -NO2, -CN, галогеновый заместитель, -N3, алкил с 1-8 атомами углерода, -(CH2)nCO2R2, -алкенил-CO2R2 с 2-8 атомами углерода в алкениле, -O(CH2)nCO2R2, -C(O)NR2R3, -P(O)(OR2)2, алкилзамещенный тетразол-5-ил, -(СН2)nO(СН2)n-арил, -NR2R3, -(CH2)nOR2, -(CH2)nSR2, -N(R2)C(O)R3, -S(O2)NR2R3, -N(R2)S(O2)R3, -(CHR2)nNR2R3, -C(O)R3, (CH2)nN(R3)C(O)R3, -N(R2)CR2R3, замещенный или незамещенный (СН2)n-циклоалкил, замещенный или незамещенный (СН2)n-фенил или замещенный или незамещенный (СН2)n-цикл, причем n означает число больше 1,

R2 означает Н, галогеновый заместитель, -алкил, -галогеналкил, -(СН2)n-фенил, -(СР2)1-3-дифенил, -(СН2)1-4-фенил-N(SO2-алкил с 1-2 атомами углерода)2, -CO(CHR1)n-OR1, -(CHR1)n-гетероцикл, -(CHR1)n-NH-CO-R1, -(CHR1)n-NH-SO2R1, -(CHR1)n-фенил-N(SO2-алкил с 1-2 атомами углерода)2, -(CHR1)n-C(O)(CHR1)-NHR1, -(CHR1)n-C(S)(CHR1)-NHR1, -(СН2)nO(СН2)nCH3, -CF3, ацил с 2-5 атомами углерода, -(CHR1)nOH, -(CHR1)nCO2R1, -(CHR1)n-O-алкил, -(CHR1)n-O-(СН2)n-O-алкил, -(CHR1)n-S-алкил, -(CHR1)n-S(O)-алкил, -(CHR1)n-S(O2)-алкил, -(CHR1)n-S(O2)-NHR3, -(CHR3)n-N3, -(CHR3)nNHR4, алкеновую цепь с 2-8 атомами углерода и 1-5 двойными связями, алкиновую цепь с 2-8 атомами углерода и 1-5 тройными связями, замещенный или незамещенный -(CHR3)n-гетероцикл, замещенный или незамещенный, насыщенный или ненасыщенный -(CHR3)n-циклоалкил, причем n означает число больше 1, и R1 и R3 могут быть одинаковыми или разными,

R3 означает Н, -ОН, -CN, замещенный алкил, -алкенил с 2-8 атомами углерода, замещенный или незамещенный циклоалкил, -N(R1)R2, замещенный или незамещенный гетероцикл с 5-7 атомами углерода или гетеробицикл с 4-7 атомами углерода, -NR1, -NR2, -NR1R2, состоящий из насыщенного или ненасыщенного гетероцикла или гетеробицикла с 4-7 атомами углерода,

R4 означает Н, -(CH2)nOH, -C(O)OR5, -C(O)SR5, -(CH2)nC(O)NR6R7, -O-C(O)-O-R6, аминокислоту или пептид, причем n означает число от 0 до 4,

R5 означает Н,

R6 означает -C(R7)-(CH2)n-O-C(O)-R8, -(CH2)n-C(R7)-O-C(O)R8, -(CH2)n-C(R7)-O-C(O)-O-R8 или -C(R7)-(CH2)n-O-C(O)-O-R8, причем n означает число от 0 до 4, и

R7 и R8 соответственно означают Н, алкил, замещенный алкил, арил, замещенный арил, алкенил, замещенный алкенил, алкинил, замещенный алкинил, гетероцикл, замещенный гетероцикл, алкиларил, замещенный алкиларил, циклоалкил, замещенный циклоалкил или CH2CO2-алкил, причем R7 и R8 могут быть одинаковыми или разными.

Согласно изобретению можно использовать также любые возможные комбинации указанных выше веществ i., ii. или iii. и/или их производных.

Предлагаемое в изобретении жидкое моющее или чистящее средство можно использовать для очистки текстильных изделий и/или твердых поверхностей как таковое или после разбавления водой. Подобное разбавление можно легко реализовать, разбавляя надлежащее количество средства другим количеством воды при определенных массовых соотношениях между средством и водой и при необходимости встряхивая разбавленное средство с целью его равномерного распределения в воде. Возможное массовое или объемное отношение средство:вода при разбавлении составляет от 1:0 до 1:10000 или 1:20000, предпочтительно от 1:10 до 1:2000.

При этом жидкими моющими или чистящими средствами могут являться любые жидкие, соответственно текучие формы применения. Определение подобных средств «текучие» в соответствии с изобретением означает, что они способны к разливу и могут обладать вязкостью, достигающей нескольких 10000 мПа⋅с. Вязкость, которая предпочтительно находится в диапазоне от 5 до 10000 мПа⋅с, можно измерять обычными стандартными методами (например, посредством вискозиметра Брукфильда LVT-II при 20 об/мин и 20°С, шпиндель 3). Предпочтительные средства обладают вязкостью в интервале от 10 до 8000 мПа⋅с, причем особенно предпочтительным является интервал от 120 до 3000 мПа⋅с. Таким образом, жидкое моющее или чистящее средство в соответствии с настоящим изобретением может быть также гелеобразным или пастообразным, может находиться в виде гомогенного раствора или суспензии, может быть пригодно, например, для распыления или может выпускаться в других обычных формах применения. К моющим средствам относятся любые возможные типы моющих средств, в частности моющие средства для текстильных изделий, ковров или природных волокон. Они могут быть предназначены для ручного и/или машинного применения. К моющим средствам относятся также моющие добавки, которые при ручной или машинной стирке текстильных изделий добавляют к непосредственному моющему средству с целью достижения дополнительного эффекта. К чистящим средствам относятся любые средства для очистки и/или дезинфекции твердых поверхностей, в том числе средства, используемые во всех указанных выше формах применения, средства для ручного и машинного мытья посуды, средства для чистки ковров, абразивные чистящие средства, стеклоочистители, ароматизирующие WC-ополаскиватели и так далее. Наконец, средствами для предварительной и дополнительной обработки текстильных изделий, во-первых, являются средства, с которыми реализуют контакт предмета белья перед его непосредственной стиркой, например, с целью растворения прочно прилипших к его поверхности загрязнений, а во-вторых, средства, которые на последующей стадии в процессе непосредственной стирки текстильных изделий придают подвергаемому стирке материалу дополнительные желательные свойства, в частности приятный гриф, несминаемость или низкую способность к приобретению статического заряда. К средствам последнего типа относятся, в частности, кондиционеры белья. Дезинфицирующими средствами являются, например, дезинфицирующие средства для рук, средства для дезинфицирования поверхностей и средства для дезинфицирования инструментов, которые также могут находиться в указанных выше формах применения.

В другом предпочтительном варианте осуществления изобретения моющее или чистящее средство отличается тем, что оно содержит по меньшей мере один другой ингредиент, в частности, выбранный из группы, включающей фосфонат, поверхностно-активное вещество, структурирующее вещество, неводный растворитель, кислоту, водорастворимую соль, загуститель и их комбинации.

Фосфонатами являются соли и органические соединения, в частности эфиры фосфоновой кислоты. К солям относятся первичные (М'Н2РО3, соответственно НР(O)(ОН)(ОМ')) и вторичные (М'2НРО3, соответственно НР(O)(OM')2) фосфонаты, причем М' означает одновалентный металл. Указанные неорганические фосфонаты называют также первичными, соответственно вторичными фосфитами. Неорганические фосфонаты образуются, например, в результате превращения фосфоновой кислоты НР(O)(ОН)2, в частности стабильной таутомерией формы фосфористой кислоты, с одним (первичные) или двумя (вторичные) эквивалентами основания, например, с гидроксидом щелочного металла. В соответствии с изобретением предпочтительными являются органические P-замещенные фосфонаты, которые содержат фосфоруглеродную связь (фосфорорганические соединения). Их общей структуре соответствует формула R1P(O)(OR2)2, в которой R1 и/или R2 означает алкил, арил или водород, причем алкильные, соответственно арильные остатки могут содержать другие заместители или другие химические группы. Органические P-замещенные фосфонаты образуются, например, по реакции Михаэля-Арбузова. Многие из этих фосфонатов растворимы в воде. Некоторые технически важные фосфонаты содержат также аминогруппу (аминогруппы) типа NR-(CH2)x-PO(OH)2 (R означает алкил, арил или водород). Некоторые из этих аминофосфонатов обладают структурным подобием с комлексообразователями, такими как этилендиаминтетрауксусная кислота, нитрилотриацетат или диэтилептриаминпентауксусная кислота, и выполняют аналогичную функцию. К особенно предпочтительным фосфонатам в соответствии с настоящим изобретением относятся, в частности, органофосфонаты например такие, как 1-гидроксиэтан-1,1-дифосфоновая кислота, аминотри(метиленфосфоновая кислота) (называемая также амино-трис(метиленфосфоновой кислотой), соответственно нитролотрис-(метиленфосфоновой кислотой)), диэтилентриаминпента(метилен-фосфоновая кислота), этилендиаминтетра(метиленфосфоновая кислота) (называемая также этилендиаминтетра(метиленфосфоновой кислотой), а также 2-фосфонобутан-1,2,4-трикарбоновая кислота (называемая также 2-фосфонобутан-1,2,4-трикарбоновой кислотой, соответственно 3-карбокси-3-фосфоноадипиновой кислотой), которые чаще всего используют в виде их солей аммония или щелочных металлов. Особенно предпочтительным является диэтилентриаминпента(метиленфосфоновая кислота)-натрий. Данный фосфонат, например, под торговым названием Dequest® 2066 поставляет фирма Thermphos.

Содержание фосфоната в моющем или чистящем средстве предпочтительно составляет от 0,01 до 2,5% масс. и, по возрастающей, предпочтительно от 0,02 до 2% масс., от 0,03 до 1,5% масс., в частности от 0,05 до 1% масс..

В качестве поверхностно-активного вещества (поверхностно-активных веществ) можно использовать анионные, неионные, цвиттер-ионные и/или амфотерные ПАВ. С точки зрения технического применения предпочтительными являются смеси анионных и неионных поверхностно-активны веществ. Суммарное содержание поверхностно-активных веществ в жидком моющем или чистящем средстве предпочтительно составляет менее 60% масс., особенно предпочтительно менее 45% масс. в пересчете на общее жидкое моющее или чистящее средство.

Пригодными неионными поверхностно-активными веществами являются алкоксилированные жирные спирты, алкоксилированные сложные алкиловые эфиры жирных кислот, амиды жирных кислот, алкоксилированные амиды жирных кислот, полигидроксиамиды жирных кислот, простые алкилфенолполигликоли, аминоксиды, алкилполиглюкозиды и их смеси.

В качестве неионных поверхностно-активных веществ предпочтительно используют алкоксилированные, предпочтительно этоксилированные спирты, прежде всего первичные спирты, предпочтительно с 8-18 атомами углерода и в среднем 1-12 молями этиленоксида (ЭО) на моль спирта, спиртовый остаток которых может быть неразветвленным или предпочтительно может быть разветвлен метилом в положении 2, соответственно может содержать неразветвленные и разветвленные метилом остатки в смеси, то есть аналогично тому, как это обычно имеет место в оксоспиртовых остатках. Однако предпочтительными, прежде всего, являются спиртовые этоксилаты с неразветвленными остатками спиртов природного происхождения с 12-18 атомами углерода, например, кокосового спирта, пальмового спирта, жирных спиртов сала или олеилового спирта, содержащие в среднем от 2 до 8 ЭО на моль спирта. К предпочтительным этоксилированным спиртам относятся, например, спирты с 12-14 атомами углерода и тремя, четырьмя или семью ЭО, спирты с 9-11 атомами углерода и семью ЭО, спирты с 13-15 атомами углерода и тремя, пятью, семью или восьмью ЭО, спирты с 12-18 атомами углерода и тремя, пятью или семью ЭО и их смеси, в частности смеси, состоящие из спирта с 12-14 атомами углерода и тремя ЭО и спирта с 12-18 атомами углерода и семью ЭО. Указанные выше степени этоксилирования являются среднестатистическими значениями, которые в случае особого продукта могут являться целым или дробным числом. Предпочтительные спиртовые этоксилаты обладают суженным распределением гомологов. Помимо указанных неионных поверхностно-активных веществ можно использовать также жирные спирты, содержащие более 12 ЭО. Соответствующими примерами являются жирные спирты сала с 14, 25, 30 или 40 ЭО. Согласно изобретению можно использовать также неионные поверхностно-активные вещества, которые содержат одновременно этиленоксидные и пропиленоксидные группы в молекуле. Пригодной является также смесь (сильно) разветвленного этоксилированного жирного спирта с неразветвленным этоксилированным жирным спиртом, например смесь, состоящая из жирного спирта с 16-18 атомами углерода и семью ЭО и 2-пропилгептанола с семью ЭО. Моющие средства, чистящие средства, средства для дополнительной обработки или моющие добавки в качестве неионного поверхностно-активного вещества особенно предпочтительно содержат жирный спирт с 12-18 атомами углерода и семью ЭО или оксоспирт с 13-15 атомами углерода и семью ЭО.

Содержание неионных поверхностно-активных веществ в моющем или чистящем средстве предпочтительно составляет от 3 до 40% масс., предпочтительно от 5 до 30% масс., в частности от 7 до 20% масс. соответственно в пересчете на общее моющее или чистящее средство.

Помимо неионных поверхностно-активных веществ моющее или чистящее средство может содержать также анионные поверхностно-активные вещества. В качестве анионного поверхностно-активного вещества предпочтительно используют сульфонаты, сульфаты, мыла, алкилфосфаты, анионные силиконовые поверхностно-активные вещества и их смеси.

При этом в качестве поверхностно-активных веществ сульфонатного типа предпочтительно можно использовать алкилбензолсульфонаты с 9-13 атомами углерода в алкиле, олефинсульфонаты, то есть смеси, состоящие из алкенсуфонатов и гидроксиалкансульфонатов, а также дисульфонатов, которые получают, например, путем сульфирования моноолефинов с 12-18 атомами углерода с концевой или внутренней двойной связью газообразным триоксидом серы и последующего щелочного или кислотного гидролиза продуктов сульфирования. Пригодными являются также алкансульфонаты с 12-18 атомами углерода и эфиры жирных α-сульфокислот (эфирсульфонаты), например, α-сульфированный метиловый эфир гидрированной кокосовой кислоты, пальмоядровой кислоты или жирные кислоты сала.

Предпочтительными алк(ен)илсульфатами являются соли щелочных металлов, прежде всего натриевые соли кислых эфиров серной кислоты и жирных спиртов с 12-18 атомами углерода, например, жирного спирта кокосового масла, жирного спирта сала, лаурилового спирта, миристилового спирта, цетилового спирта, стеарилового спирта или оксоспиртов с 10-20 атомами углерода, и соответствующих кислых эфиров вторичных спиртов с аналогичными длинами цепи. С точки зрения очистки технический интерес представляют алкилсульфаты с 12-16 атомами углерода, алкилсульфаты с 12-15 атомами углерода и алкилсульфаты с 14-15 атомами углерода. Пригодными анионными поверхностно-активными веществами являются также 2,3-алкилсульфаты.

Пригодными являются также моноэфиры серной кислоты с этоксилированными 1-6 молями этиленоксида неразветвленными или разветвленными спиртами с 7-21 атомами углерода, такими как спирты с 9-11 атомами углерода, разветвленные метилом в положении 2 и этоксилированные в среднем 3,5 молями этиленоксида (ЭО) или жирные спирты с 12-18 атомами углерода и 1-4 ЭО.

Предпочтительными анионными поверхностно-активными веществами являются также мыла. Пригодными являются мыла на основе насыщенных и ненасыщенных жирных кислот, такие как соли лауриновой кислоты, миристиновой кислоты, пальмитиновой кислоты, стеариновой кислоты, (гидрированной) эруковой кислоты и бегеновой кислоты, а также смеси мыл, прежде всего производных природных жирных кислот, например, кокосовой кислоты, пальмоядровой кислоты, кислоты оливкового масла или жирных кислот сала.

Анионные поверхностно-активные вещества, включая мыла, могут находиться в виде соответствующих натриевых, калиевых, магниевых солей или солей аммония. Анионные поверхностно-активные вещества предпочтительно находятся в виде их натриевых солей. Другими предпочтительными противоионами анионных поверхностно-активных веществ являются также протонированные формы холина, триэтиламина или метилэтиламина.

Содержание анионных поверхностно-активных веществ в моющем или чистящем средстве может составлять от 1 до 40% масс., предпочтительно от 5 до 30% масс., еще более предпочтительно от 10 до 25% масс. соответственно в пересчете на общую массу моющего или чистящего средства.

Пригодными структурирующими веществами, которые могут присутствовать в моющем или чистящем средстве, являются, в частности, силикаты, алюмосиликаты (в особенности цеолиты), карбонаты, соли органических дикарбоновых и поликарбоновых кислот, а также смеси указанных веществ.

Органическими структурирующими веществами, которые могут присутствовать в моющем или чистящем средстве, являются, например, поликарбоновые кислоты, используемые в виде соответствующих солей натрия, причем под поликарбоновыми кислотами подразумевают карбоновые кислоты, содержащие более одной кислотной функциональной группы. Соответствующими примерами являются лимонная кислота, адипиновая кислота, янтарная кислота, глутаровая кислота, яблочная кислота, винная кислота, малеиновая кислота, фумаровая кислота, сахарные кислоты, аминокарбоновые кислоты, нитрилотриуксусная кислота, метилглициндиуксусная кислота и их производные, а также смеси указанных соединений. Предпочтительными являются соли поликарбоновых кислот, таких как лимонная кислота, адипиновая кислота, янтарная кислота, глутаровая кислота, винная кислота, сахарные кислоты и смеси указанных кислот.

Пригодными структурирующими веществами являются другие полимерные поликарбоксилаты. К ним относятся, например, соли щелочных металлов с полиакриловой или полиметакриловой кислотой, относительная молекулярная масса которых составляет, например, от 600 до 750000 г/моль.

Пригодными полимерами являются, в частности, полиакрилаты, молекулярная масса которых предпочтительно составляет от 1000 до 15000 г/моль. В связи с превосходной растворимостью предпочтительными представителями данной группы могут быть короткоцепные полиакрилаты, молекулярная масса которых составляет от 1000 до 10000 г/моль, особенно предпочтительно от 1000 до 5000 г/моль.

Пригодными являются также сополимерные поликарбоксилаты, в особенности сополимеры акриловой кислоты с метакриловой кислотой и сополимеры акриловой или метакриловой кислоты с малеиновой кислотой. Для повышения растворимости в воде полимеры могут содержать также мономерные звенья аллилсульфокислоты, такой как аллилоксибензолсульфокислота и металлилсульфокислота.

Однако в жидких моющих или чистящих средствах предпочтительно используют растворимые структурирующие вещества, например, такие как лимонная кислота или акриловые полимеры с молекулярной массой от 1000 до 5000 г/моль.

В соответствии с настоящим изобретением под молекулярной массой полимерных поликарбоксилатов подразумевают среднемассовую молекулярную массу Mw соответствующих кислотных форм, которую в основном определяют методом гель-проникающей хроматографии с использованием УФ-детектора. При этом измерения выполняют в сравнении с используемой в качестве внешнего стандарта полиакриловой кислотой, что в связи со структурным родством последней с исследуемыми полимерами позволяет получать достоверные значения молекулярной массы. Получаемые при этом данные существенно отличаются от данных, получаемых в случае использования в качестве стандарта полистиролсульфокислоты. Значения молекулярной массы, получаемые при использовании полистиролсульфокислоты, как правило, гораздо выше, чем указываемые в настоящем описании значения молекулярной массы.

Подобные органические структурирующие вещества при необходимости могут присутствовать в количестве до 40% масс., в частности до 25% масс., предпочтительно от 1 до 8% масс. В близких к верхнему пределу количествах эти вещества предпочтительно используют в пастообразных или жидких, в особенности водосодержащих средствах.

Предлагаемые в изобретении моющие или чистящие средства являются жидкими средствами, которые в качестве основного растворителя предпочтительно содержат воду. Вместе с тем к моющему или чистящему средству можно добавлять неводный растворитель. К пригодным неводным растворителям относятся одноатомные или многоатомные спирты, алканоламины или простые гликолевые эфиры, если при использовании в указанных концентрациях они способны смешиваться с водой. Растворители предпочтительно выбирают из группы, включающей этанол, н-пропанол, изопропанол, бутанолы, гликоль, пропандиол, бутандиол, глицерин, дигликоль, пропилдигликоль, бутилд и гликоль, гексиленгликоль, метиловый эфир этиленгликоля, этиловый эфир этиленгликоля, пропиловый эфир этиленгликоля, моно-н-бутиловый эфир этиленгликоля, метиловый эфир диэтиленгликоля, этиловый эфир диэтиленгликоля, метиловый эфир пропиленгликоля, этиловый эфир пропиленгликоля, пропиловый эфир пропиленгликоля, монометиловый эфир дипропиленгликоля, моноэтиловый эфир дипропиленгликоля, монометиловый эфир диизопропиленгликоля, моноэтиловый эфир диизопропиленгликоля, метокситригликоль, этокситригликоль, бутокситригликоль, 1-бутоксиэтокси-2-пропанол, 3-метил-3-метоксибутанол, трет-бутиловый эфир пропиленгликоля, ди-н-октиловый эфир, а также смеси указанных растворителей. Однако в качестве неводного растворителя моющее или чистящее средство предпочтительно содержит многоатомный спирт. Многоатомным спиртом может являться, в частности, глицерин, 1,2-пропандиол, 1,3-пропандиол, этиленгликоль, диэтиленгликоль и/или дипропиленгликоль. В частности, моющее или чистящее средство предпочтительно содержит смесь многоатомного спирта с одноатомным спиртом. Неводный растворитель можно использовать в моющем или чистящем средстве в количествах от 0,5 до 15% масс., однако предпочтительно в количестве менее 12% масс.

Для установления необходимого показателя рН, который не должен возникать самопроизвольно в результате смешивания прочих компонентов, средство может содержать системные, экологически безопасные кислоты, в частности лимонную кислоту, уксусную кислоту, винную кислоту, яблочную кислоту, молочную кислоту, гликолевую кислоту, янтарную кислоту, глутаровую кислоту и/или адипиновую кислоту, а также минеральные кислоты, в частности серную кислоту, или основания, в частности гидроксид аммония или гидроксиды щелочных металлов. Содержание указанных регуляторов рН в средствах предпочтительно не превышает 20% масс. и, в частности, составляет от 1,2 до 17% масс.

Кроме того, в соответствии с настоящим изобретением средство может содержать одну или несколько водорастворимых солей, предназначенных, например, для регулирования вязкости. Речь при этом идет о неорганических и/или органических солях. Используемые в данном случае неорганические соли предпочтительно выбраны из группы, включающей бесцветные водорастворимые галогениды, сульфаты, сульфиты, карбонаты, гидрокарбонаты, нитраты, нитриты, фосфаты и/или оксиды щелочных металлов, щелочно-земельных металлов, алюминия и/или переходных металлов, причем помимо указанных солей можно использовать соли аммония. При этом особенно предпочтительными являются галогениды и сульфаты щелочных металлов, и в соответствии с этим неорганическая соль предпочтительно выбрана из группы, включающей хлорид натрия, хлорид калия, сульфат натрия, сульфат калия и их смеси. Используемыми органическими солями являются, например, бесцветные водорастворимые соли щелочного металла, щелочно-земельного металла, аммония, алюминия и/или переходного металла с карбоновой кислотой. Соли предпочтительно выбраны из группы, включающей формиат, ацетат, пропионат, цитрат, малат, тартрат, сукцинат, малонат, оксалат, лактат и их смеси.

Для загущения предлагаемое в изобретении средство может содержать один или несколько загустителей. Загуститель предпочтительно выбран из группы, включающей ксантан, гуар, каррагенан, агар-агар, геллановую камедь, пектин, муку из цареградских стручков и смеси указанных веществ. Указанные вещества являются загустителями, которые обладают эффективностью также в присутствии неорганических солей. В особенно предпочтительном варианте моющее или чистящее средство в качестве загустителя содержит ксантан, поскольку он обеспечивает эффективное загущение и предотвращает макроскопическое разделение непрерывной фазы также в присутствии солей в высоких концентрациях. Кроме того, загуститель стабилизирует обедненную поверхностно-активным веществом непрерывную фазу и предотвращает ее макроскопическое разделение.

Как альтернативу или дополнительно в качестве загустителей можно использовать также (со)полимеры (мет)акриловой кислоты. Пригодными акриловыми и метакриловыми (со)полимерами являются, например, высокомолекулярные сополимеры с полиалкенилполиэфиром, в частности простым аллиловым эфиром сахарозы, пентаэритрита или пропилена, сшитые гомополимеры акриловой кислоты, которые согласно Международной номенклатуре косметических ингредиентов (INCI), принятой Ассоциацией по парфюмерно-косметическим товарам и душистым веществам, называют карбомерами (их называют также карбоксивиниловыми полимерами). Подобные полиакриловые кислоты могут быть поставлены, в частности, под торговыми названиями Polygel® и Carbopol®. Кроме того, пригодными являются, например, следующие сополимеры акриловой кислоты: (i) сополимеры двух или более мономеров, выбранных из группы, включающей акриловую кислоту, метакриловую кислоту и их сложные моноэфиры, предпочтительно образуемые с алканолами с 1-4 атомами углерода (согласно номенклатуре INCI их называют акрилатными сополимерами), которые могут быть поставлены, например, под торговыми названиями Aculyn®, Acusol® или полимер TEGO®; (ii) сшитые высокомолекулярные сополимеры акриловой кислоты, к которым относятся, например, сшитые простым аллиловым эфиром сахарозы или пентаэритрита сополимеры алкилакрилатов с 10-30 атомами углерода с одним или несколькими мономерами, выбранными из группы, включающей акриловую кислоту, метакриловую кислоту и их сложные моноэфиры, предпочтительно образуемые с алканолами с 1-4 атомами углерода (согласно номенклатуре INCI их называют сшитыми полимерами акрилаты/С10-30 алкилакрилаты), которые могут быть поставлены, например, под торговым названием Carbopol®. Другими пригодными полимерами являются (со)полимеры (мет)акриловой кислоты типа Sokalan®.

Может быть предпочтительным присутствие в предлагаемом в изобретении моющем или чистящем средстве (со)полимера (мет)акриловой кислоты в комбинации с другими загустителями, предпочтительно ксантаном.

Моющее или чистящее средство может содержать от 0,05 до 1,5% масс., предпочтительно от 0,1 до 1% масс. загустителя (соответственно в пересчете на общее моющее или чистящее средство). При этом количество используемого загустителя зависит от его типа и необходимой степени загущения.

Предлагаемые в изобретении жидкие, соответственно пастообразные средства в виде содержащих обычный растворитель растворов, как правило, получают путем простого смешивания ингредиентов, которые можно вводить в автоматический смеситель в массе или в виде раствора.

Как указано выше, предлагаемые в изобретении моющие или чистящие средства могут содержать только протеазу и целлюлазу. В качестве альтернативы они могут содержать также другие гидролитические ферменты или другие ферменты в целесообразной для обеспечения эффективности средства концентрации. В соответствии с этим другим объектом настоящего изобретения являются средства, которые содержат также один или несколько других ферментов, в качестве которых в принципе можно использовать любые ферменты, которые в соответствии с уровнем техники пригодны для указанной цели. В качестве других ферментов предпочтительно можно использовать любые ферменты, способные проявлять каталитическую активность в предлагаемом в изобретении средстве, в частности протеазу, амилазу, целлюлазу, гемицеллюлазу, маннаназу, танназу, ксиланазу, ксантаназу, ксилоглюканазу, β-глюкозидазу, пектиназу, каррагеназу, пергидролазу, оксидазу, оксидоредуктазу или липазу, а также их смеси. Общее содержание других ферментов в средстве соответственно предпочтительно составляет от 1×10-8 до 5% масс. в пересчете на активный белок. Содержание каждого из других ферментов в предлагаемых в изобретении средствах предпочтительно составляет (в порядке возрастания) от 1×10-7 до 3% масс., от 0,00001 до 1% масс., от 0,00005 до 0,5% масс., от 0,0001 до 0,1% масс. и особенно предпочтительно от 0,0001 до 0,05% масс. в пересчете на активный белок. Особенно предпочтительно ферменты отличаются синергической эффективностью удаления определенных загрязнений или пятен, то есть ферменты, присутствующие в составе средства, способны повышать характерную для каждой из них эффективность очистки. Еще более предпочтительно подобный синергизм наблюдается между содержащейся согласно изобретению протеазой и другим ферментом предлагаемого в изобретении средства, в частности, между указанной протеазой и целлюлазой, липазой, маннаназой, амилазой и/или пектиназой. Синергические эффекты могут возникать не только между разными ферментами, но и между одним или несколькми ферментами и другими ингредиентами предлагаемого в изобретении средства.

Другим объектом изобретения является применение предлагаемого в изобретении моющего или чистящего средства для удаления находящихся на текстильных изделиях или твердых поверхностях загрязнений, в особенности чувствительных к протеазе и/или целлюлазе загрязнений, то есть для очистки текстильных изделий или твердых поверхностей. Таким образом, предлагаемые в изобретении средства, в частности средства на основе комбинации протеазы с целлюлазой, предпочтительно можно использовать для устранения соответствующих загрязнений с текстильных изделий или твердых поверхностей. Вариантом реализации данного объекта изобретения является, например, ручная стирка, которая предусматривает ручное удаление пятен с текстильных изделий или твердых поверхностей, или применение средств в соответствии с машинной технологией. Любые аспекты, объекты и варианты осуществления настоящего изобретения, относящиеся к предлагаемым в нем моющим или чистящим средствам, применимы также и к указанному объекту изобретения. В соответствии с этим в данном месте описания следует сослаться на приведенное в соответствующем месте описания раскрытие сущности изобретения с указанием, что оно относится также к приведенному выше предлагаемому в изобретении применению.

Другим объектом изобретения является способ очистки текстильных изделий или твердых поверхностей, причем предлагаемое в изобретении моющее или чистящее средство применяют по меньшей мере на одной технологической стадии.

Речь при этом идет как о ручных, так и о машинных технологиях, причем предпочтительными являются машинные технологии в связи с возможностью более точного регулирования, например, используемых количеств и времени воздействия. Технологии очистки текстильных изделий в общем случае отличаются тем, что на нескольких технологических стадиях на подлежащий очистке материал наносят разные активные чистящие вещества, которые по истечении времени воздействия смывают, или подлежащий очистке материал обрабатывают моющим средством или его раствором, соответственно разбавленным раствором иным образом. То же относится к технологиям очистки любых других материалов в виде текстильных изделий, прежде всего твердых поверхностей. Любые возможные технологии стирки или очистки по меньшей мере на одной из технологических стадий могут быть дополнены применением предлагаемого в изобретении моющего или чистящего средства и в подобном случае являются вариантами осуществления настоящего изобретения. Любые аспекты, объекты и варианты осуществления, описанные для предлагаемых в изобретении моющих или чистящих средств, применимы также к объекту настоящего изобретения. В соответствии с этим в данном месте описания следует сослаться на приведенное в соответствующем месте описания раскрытие сущности изобретения с указанием, что оно относится также к приведенному выше предлагаемому в изобретении способу.

В предпочтительном варианте осуществления способ отличается тем, что целлюлаза находится в моющем растворе в концентрации от 0,0000004 до 0,0006% масс., предпочтительно от 0,0000008 до 0,00048% масс., и/или протеаза находится в моющем растворе в концентрации от 0,00009 до 0,0005% масс., предпочтительно от 0,00015 до 0,00035% масс., причем указанные количественные данные приведены в пересчете на содержащийся в моющем растворе активный белок. В другом предпочтительном варианте осуществления способ отличается тем, что его реализуют при температуре от 10 до 50°С, предпочтительно от 10 до 40°С, особенно предпочтительно от 20 до 40°С.

Используемые в предлагаемых в изобретении средствах протеазы предпочтительно можно использовать в соответствии с указанными выше вариантами в предлагаемых в изобретении моющих и чистящих средствах, а также в способе, прежде всего способе стирки и очистки. Таким образом, протеазы предпочтительно можно использовать для обеспечения их протеолитической активности в соответствующих средствах.

В соответствии с этим другим объектом настоящего изобретения является применение протеазы, включающей:

(а1) аминокислотную последовательность, которая по меньшей мере на 80% идентична указанной в SEQ ID NO. 1 аминокислотной последовательности и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты глутаминовую кислоту (Е) или аспарагиновую кислоту (D),

(а2) аминокислотную последовательность, которая по меньшей мере на 80% идентична указанной в SEQ ID NO. 1 аминокислотной последовательности и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты аспарагин (N) или глутамин (Q), или

(а3) аминокислотную последовательность, которая по меньшей мере на 80% идентична указанной в SEQ ID NO. 1 аминокислотной последовательности и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты аланин (А), глицин (G) или серин (S),

для обеспечения протеолитической активности в жидком моющем или чистящем средстве, которое содержит также целлюлазу.

В другом варианте осуществления изобретения указанное выше применение отличается тем, что протеаза NO. 1 содержит также по меньшей мере одну из следующих аминокислот (при отсчете согласно SEQ ID):

(a) треонин в положении 3 (3Т),

(b) изолейцин в положении 4 (4I),

(c) аланин, треонин или аргинин в положении 61 (61А, 61Т или 61R),

(d) аспарагиновую кислоту или глутаминовую кислоту в положении 154 (154D или 154E),

(e) пролин в положении 188 (188Р),

(f) метионин в положении 193 (193М),

(g) изолейцин в положении 199 (199I),

(h) аспарагиновую кислоту, глутаминовую кислоту или глицин в положении 211 (211D, 211Е или 211G),

(i) комбинации аминокислот от (а) до (h).

Другим объектом настоящего изобретения является применение протеазы, выбранной из группы, включающей:

а. протеазу, содержащую аминокислотную последовательность согласно SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8,

b. протеазу, которая по меньшей мере в одном положении содержит измененную по сравнению с SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7 или SEQ ID NO. 8 аминокислотную последовательность, причем изменение при отсчете согласно SEQ ID NO. 1 выбрано из группы, включающей:

i. треонин в положении 3 (3Т),

ii. изолейцин в положении 4 (4I),

iii аланин, треонин или аргинин в положении 61 (61А, 61Т или 61R),

iv. аспарагиновую кислоту или глутаминовую кислоту в положении 154 (154D или 154E),

v. пролин в положении 188 (188Р),

vi. метионин в положении 193 (193М),

vii. изолейцин в положении 199 (199I),

viii. аспарагиновую кислоту, глутаминовую кислоту или глицин в положении 211 (211D, 211Е или 211G),

ix. комбинации аминокислот от (i) до (viii),

для обеспечения протеолитической активности в жидком моющем или чистящем средстве, которое содержит также целлюлазу.

Любые аспекты, объекты и варианты осуществления настоящего изобретения, относящиеся к предлагаемым в нем моющим или чистящим средствам, применимы также и к указанным выше применениям. В соответствии с этим в данном месте описания следует сослаться на приведенное в соответствующем месте описания раскрытие сущности изобретения с указанием, что оно относится также к приведенным выше предлагаемым в изобретении применениям.

Пример. Определение стабильности при хранении предлагаемых в изобретении жидких моющих средств

Используют следующие базовые рецептуры моющего средства:

а) первое жидкое моющее средство, которое обладает следующим составов (все данные указаны в массовых процентах): от 0,3 до 0,5% ксантана, от 0,2 до 0,4% антивспенивающего средства, от 6 до 7% глицерина, от 0,3 до 0,5% этанола, от 4 до 7% сульфоэфира жирного спирта, от 24 до 28% неионных поверхностно-активных веществ, 1% борной кислоты, от 1 до 2% цитрата натрия (дигидрата), от 2 до 4% соды, от 14 до 16% жирных кислот кокосовых орехов, 0,5% 1-гидроксиэтан-(1,1-дифосфоновой кислоты), от 0 до 0,4% поливинилпирролидона, от 0 до 0,05% оптических отбеливателей, от 0 до 0,001% красителя, остальное деминерализованная вода. В качестве целлюлазы средство содержит 0,15% масс. Ecostone N400® (препарат целлюлазы фирмы АВ Enzymes).

b) второе жидкое моющее средство, которое обладает следующим составом:

Ингредиент % масс.
Жирный спирт с 12-18 атомами углерода и семью ЭО 7,5
Неразветвленный алкилбензолсульфонат с 10-13 атомами углерода (натриевая соль) 8,5
Кокосовая жирная кислота (натриевая соль) 14,6
Лаурилсульфоэфир с двумя ЭО (натриевая соль) 13,0
Лимонная кислота (натриевая соль) 3,1
Борная кислота (натриевая соль) 1,0
Полиакрилатный загуститель 0,4
Пропиленгликоль 2,1
Силиконовый антивспениватель 0,2
Препарат целлюлазы Ecostone N400® (фирма АВ Enzymes) 0,1
Вода до 100

Базовые рецептуры моющего средства разных опытных составов смешивали со следующими протеазами (количественные данные указаны в пересчете на активный белок):

состав 1: вариант F49 протеазы из Bacillus lentus с повышенной эффективностью (согласно международной заявке WO 95/23221, аргинин в положении 99 (99R)): 0,4 мг/мл (0,04% масс.) в жидких моющих средствах согласно пунктам а) и b),

состав 2: протеаза, приведенная на фиг.2 (соответствует SEQ ID NO. 3) международной заявки WO 03/057713 (серин в положении 99 (99S, идентичность с SEQ ID NO. 1 менее 80%): 0,4 мг/мл (0,04% масс.) в жидком моющем средстве по пункту а), 0,3 мг/мл (0,03% масс.) в жидком моющем средстве по пункту b),

состав 3: протеаза, содержащая аминокислотную последовательность согласно SEQ ID NO. 2 (глутамин в положении 99 (99Е)): 0,4 мг/мл (0,04% масс.) в жидком моющем средстве по пункту а), 0,3 мг/мл (0,03% масс.) в жидком моющем средстве по пункту b).

Определяют стабильность при хранении моющих средств соответствующих составов 1, 2 и 3. С этой целью моющие средства хранят при температуре 30°С в течение соответствующего указанного времени, после чего определяют соответствующую целлюлолитическую остаточную активность. Подлежащие исследованию образцы в определенных условиях реакции (100 ммолей натрийфосфатного буфера, рН 7,5, 40°С, 15 минут) инкубируют с субстратом (1,25% карбоксиметилцеллюлозы). В щелочных условиях образцы реагируют с гидразидом п-гидроксибензойной кислоты в присутствии висмута с образованием желтого окрашивающего вещества, которое определяют фотометрически при длине волны 410 нм. При этом соответствующее окраске количество высвобождающегося сахара служит мерой ферментативной активности (смотри Lever, Anal. Biochem., 1972, 47 & 1977, 81). Полученные значения целлюлолитической остаточной активности приведены в таблице 1.

Таблица 1
Моющее средство a) b)
В начале хранения Через 4 недели Через 8 недель В начале хранения Через 4 недели Через 8 недель
Состав 1 100% 42% 27% 100% 33% 21%
Состав 2 100% 36% 24% 100% 42% 24%
Состав 3 100% 46% 32% 100% 49% 26%

Из приведенных в таблице 1 данных следует, что предлагаемое в изобретении моющее средство обладает гораздо более высокой целлюлолитической остаточной активностью и вместе с тем стабильностью при хранении по сравнению с моющими средствами составов 1 и 2.

1. Применение протеазы, которая содержит аминокислотную последовательность, по меньшей мере на 80% идентичную указанной в SEQ ID NO. 1 аминокислотной последовательности, и которая в положении 99 при отсчете согласно SEQ ID NO. 1 содержит в качестве аминокислоты глутаминовую кислоту (Е), в качестве средства для повышения стабильности при хранении целлюлазы в жидком моющем или чистящем средстве, включающем целлюлазу и протеазу.

2. Применение по п.1, причем протеаза содержит при отсчете согласно SEQ ID NO. 1 по меньшей мере одну из следующих аминокислот:

(a) треонин в положении 3 (3Т),

(b) изолейцин в положении 4 (4I),

(c) аланин, треонин или аргинин в положении 61 (61А, 61Т или 61R),

(d) аспарагиновую или глутаминовую кислоту в положении 154 (154D или 154Е),

(e) пролин в положении 188 (188Р),

(f) метионин в положении 193 (193М),

(g) изолейцин в положении 199 (199I),

(h) аспарагиновую кислоту, глутаминовую кислоту или глицин в положении 211 (211D, 211Е или 211G),

(i) комбинации аминокислот от (а) до (h).

3. Применение по п.1, причем протеаза содержит

(а) аминокислотную последовательность согласно SEQ ID NO. 2 или

(b) по меньшей мере в одном положении измененную по сравнению с SEQ ID NO. 2 аминокислотную последовательность, причем изменение при отсчете согласно SEQ ID NO. 1 выбрано из группы, состоящей из:

i. треонина в положении 3 (3Т),

ii. изолейцина в положении 4 (4I),

iii. аланина, треонина или аргинина в положении 61 (61А, 61Т или 61R),

iv. аспарагиновой кислоты или глутаминовой кислоты в положении 154 (154D или 154Е),

v. пролина в положении 188 (188Р),

vi. метионина в положении 193 (193М),

vii. изолейцина в положении 199 (199I),

viii. аспарагиновой кислоты, глутаминовой кислоты или глицина в положении 211 (211D, 211Е или 211G),

ix. комбинаций аминокислот от (i) до (viii).

4. Применение по п.1, причем целлюлаза содержится в жидком моющем или чистящем средстве в количестве от 1×10-8 до 5% масс. в пересчете на активный белок.

5. Применение по п.1, причем протеаза содержится в жидком моющем или чистящем средстве в количестве от 1×10-8 до 5% масс. в пересчете на активный белок.

6. Применение по п.1, причем жидкое моющее или чистящее средство дополнительно содержит компонент, выбранный из:

i. анионного и/или полианионного вещества, и/или

ii. катионного и/или поликатионного вещества, и/или

iii. вещества, содержащего гидроксильную(-ые) и/или полигидроксильную(-ые) группу(-ы).

7. Применение по п.1, причем жидкое моющее или чистящее средство содержит по меньшей мере один дополнительный ингредиент, в частности, выбранный из группы, состоящей из фосфоната, поверхностно-активного вещества, структурирующего вещества, неводного растворителя, кислоты, водорастворимой соли, загустителя и комбинаций указанных ингредиентов.

8. Применение по одному из пп.1-7, причем жидкое моющее или чистящее средство содержит по меньшей мере один дополнительный фермент, в частности, протеазу, амилазу, целлюлазу, гемицеллюлазу, маннаназу, танназу, ксиланазу, ксантаназу, ксилоглюканазу, β-глюкозидазу, пектиназу, каррагеназу, пергидролазу, оксидазу, оксидоредуктазу или липазу, а также их смеси.


Похожие патенты:

Изобретение относится к биохимии. Конкретно к потребительским товарам, содержащим протеазы для холодной воды, и способам получения и применения таких товаров.

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении амилазы в жидком моющем или чистящем средстве, включающем амилазу и протеазу.

Изобретение относится к области микробиологии и касается применения штамма Bacillus cereus ГИСК №279 в качестве продуцента ингибитора цитокина ФНО-α. Штамм выделен из испражнений пациента с дисбактериозом кишечника и депонирован в Коллекции Государственного научно-исследовательского института стандартизации и контроля медицинских биологических препаратов им.

Изобретение относится к биотехнологии и представляет собой вариант субтилизина для применения в очистке, представляющий собой последовательность аминокислот, указанную в SEQ ID NO: 5.

Изобретение относится к биотехнологии и представляет собой выделенный вариант субтилизина Bacillus. Изобретение относится также к выделенной нуклеиновой кислоте, кодирующей вариант субтилизина, вектору экспрессии, содержащему нуклеиновую кислоту, клетке-хозяину, способной экспрессировать вариант субтилизина, а также к чистящей композиции, содержащей вариант субтилизина и способу очистки.

Настоящее изобретение относится к биохимии и представляет собой детергентную композицию, которая включает вариант субтилизина, имеющий аминокислотную последовательность, которая приведена в SEQ ID NO 1, и по меньшей мере один дополнительный ингредиент, выбранный из: i) средств для отбеливания, которые выбраны из перкарбонатов, персульфатов и органических надкислот, ii) аминокарбоксилатов, или iii) сульфированных полимеров, или iv) фосфорорганических кислот или их солей и их смесей.

Изобретение относится к биотехнологии и представляет собой варианты субтилизина, сохраняющие его активность. Изобретение относится также к чистящей композиции, содержащей вариант субтилизина, и к способу очистки поверхности и/или изделия, включающего ткань, с помощью указанной композиции.

Группа изобретений относится к биотехнологии. Предложен вариант термолизина, обладающий повышенной эффективностью по сравнению с термолизином дикого типа.

Изобретение относится к области биотехнологии и касается способа мытья посуды. Охарактеризованный способ заключается в обеспечении композиции для мытья посуды и посуды, нуждающейся в очистке, приведении указанной посуды в контакт с указанной композицией для мытья посуды при условиях, эффективно обеспечивающих очистку указанной посуды, где указанная композиция для мытья посуды содержит модифицированный субтилизин, где указанный модифицированный субтилизин, по меньшей мере, на 70% гомологичен последовательности AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR и содержит (i) замену G116V и, по меньшей мере, одну дополнительную мутацию или (ii) замену S126R.

Изобретение относится к биотехнологии и представляет собой выделенный модифицированный полинуклеотид, кодирующий модифицированную полноразмерную протеазу. При этом часть указанного модифицированного полинуклеотида, которая кодирует про-участок указанной полноразмерной протеазы, содержит мутацию, кодирующую замену в одном аминокислотном положении, выбранном из положений, эквивалентных аминокислотным положениям 28-108 и 109 SEQ ID NO:5, 13 или 244, где указанный полинуклеотид имеет нуклеотидную последовательность, идентичную, по меньшей мере, приблизительно на 95% полинуклеотидной последовательности SEQ ID NО:4, 12 или 243 с учетом вырожденности генетического кода, где указанная модифицированная полноразмерная протеаза представляет собой сериновую протеазу, где указанная модифицированная полноразмерная протеаза представляет собой щелочную сериновую протеазу, полученную из предшественника щелочной сериновой протеазы дикого типа, где указанный предшественник щелочной сериновой протеазы представляет собой щелочную сериновую протеазу В.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к штамму Pichia pastoris ВКПМ Y-4269. Настоящий штамм является продуцентом секретируемой термостабильной ксилоглюканазы класса GH74.

Настоящее изобретение относится к области биохимии. Предложен рекомбинантный полипептид, имеющий мутацию с заменой цистеина на серин в С-концевой области и обладающий целлюлазной активностью и улучшенной термостойкостью.

Настоящее изобретение относится к способу получения сахаросодержащей жидкости. Способ включает следующие стадии: стадию добавления целлюлазы из мицелиальных грибов к продукту предварительной обработки целлюлозы для получения гидролизата; стадию добавления отбросной мелассы к указанному гидролизату для получения смешанной сахаросодержащей жидкости и стадию подвергания указанной смешанной сахаросодержащей жидкости твердофазно-жидкостному разделению.

Группа изобретений относится к биотехнологии. Предложены гранула для применения в порошковых моющих средствах и композиция гранулированного моющего средства.
Изобретение относится к биотехнологии и может быть использовано для гидролиза лигноцеллюлозной биомассы. Способ получения ферментов целлюлазы и/или гемицеллюлазы микроорганизма Trichoderma ressei предусматривает по меньшей мере одну стадию роста в присутствии углеродного субстрата, который выбирают из глюкозы, ксилозы, лактозы, остатков, полученных после этанольной ферментации мономерных сахаров ферментативных гидролизатов целлюлозной биомассы и/или сырого экстракта водорастворимых пентоз и по меньшей мере одну стадию продуцирования в присутствии индуцирующего субстрата, в котором указанный индуцирующий субстрат представляет собой смесь, содержащую от 40 до 65 мас.% глюкозы или целлюлозных гидролизатов, от 21 до 25 мас.% лактозы и от 10 до 39 мас.% ксилозы или раствора гемицеллюлолозного лигноцеллюлозного гидролизата, причем сумма этих трех компонентов равна 100%.
Изобретение относится к биотехнологии и микробиологии. Предложен штамм микромицета Aspergillus foetidus 379-К-5-1 - продуцент комплекса пектиназ, β-глюканазы, ксиланазы, целлюлазы, хитиназы, маннаназы и протеазы для деструкции полисахаридов растительного и микробного сырья.

Изобретение относится к биохимии. Описаны варианты ксилоглюканазы, имеющие ряд замен, а также полинуклеотиды, кодирующие указанные варианты ксилоглюканазы.

Изобретение относится к ферментной композиции, способной эффективно расщеплять целлюлозный материал, и может быть использовано при производстве сахаров из целлюлозной биомассы.

Изобретение относится к области биотехнологии. Представлена моющая композиция, содержащая изолированный мутантный вариант исходной ксилоглюканазы, от 2 до 50 мас.% поверхностно-активного вещества и вспомогательный ингредиент, где вариант исходной ксилоглюканазы содержит одну из представленных в описании групп изменений; исходная ксилоглюканаза является ксилоглюканазой, имеющей по меньшей мере 90% идентичности с аминокислотной последовательностью SEQ ID NO:3, представленной в описании; и вариант обладает ксилоглюканазной активностью.

Изобретение относится к области молекулярной биологии и биохимии. Предложена полинуклеиновая кислота, кодирующая слитый белок для обеспечения секреции фермента, расщепляющего клеточную стенку, в микроорганизме класса Clostridia, а также соответствующий рекомбинантный микроорганизм и способ продуцирования и секреции указанного белка.

Изобретение относится к композициям, содержащим липазные ферменты и отбеливающие агенты, а также к способам получения и использованию таких композиций. Описан способ очистки ткани, или твердой поверхности, или другой поверхности при уходе за тканями и бытовом уходе, включающий стадии, на которых: (a) вводят в контакт поверхность с водным раствором, содержащим (i) липазу; и (ii) отбеливающий компонент и (iii) необязательное моющее вспомогательное вещество; (b) промывают и высушивают ткань или твердую поверхность; при этом липаза включает вариант родительской липазы, причем родительская липаза содержит аминокислотную последовательность с, по меньшей мере, 60% идентичностью со зрелым полипептидом SEQ ID NO: 1 и причем вариант липазы имеет аминокислотную последовательность с, по меньшей мере, 60% идентичностью со зрелым полипептидом SEQ ID NO: 1, или его фрагмент, имеющий липазную активность, причем указанный вариант содержит следующие замены: (a) G91A+D96G+T231R+N233R; (b) T37R+N39R+G91A+D96G+T231R+N233R; (c) G91A+D96G+G225R+T231R+N233R; или (d) G91A+D96G+A150G+T231R+N233R, соответствующие указанным положениям в зрелом полипептиде SEQ ID NO: 1, причем вариант имеет липазную активность.

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении целлюлазы в жидком моющем или чистящем средстве, включающем целлюлазу и протеазу. Изобретение обеспечивает пониженную дезактивацию целлюлазы посредством вышеуказанной протеазы, тем самым позволяя сохранить высокую целлюлолитическую остаточную активность в указанном моющем или чистящем средстве даже после 8 недель хранения. 7 з.п. ф-лы, 2 табл., 1 пр.
