Антитела, которые связывают интегрин альфа-v бета-8



Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8
Антитела, которые связывают интегрин альфа-v бета-8

 


Владельцы патента RU 2614252:

ТЕ РИДЖЕНТС ОФ ТЕ ЮНИВЕРСИТИ ОФ КАЛИФОРНИЯ (US)

Изобретение относится к области биотехнологии и иммунологии. Предлагаются антитела с высокой аффинностью к β8-субъединице αvβ8. Также описаны фармацевтическая композиция, содержащая такие антитела, и способы ее использования. Предложенная группа изобретений может быть использована в медицине. 5 н. и 18 з.п. ф-лы, 14 ил., 19 пр.

 

Перекрестная ссылка на родственные заявки

Настоящая заявка испрашивает приоритет по предварительной заявке США №61/524,708, поданной 17 августа 2011 г., и предварительной заявке США №61/646,111, поданной 11 мая 2012 г., содержание которых в полном объеме включено в данный документ в виде ссылки.

Ссылка на "список последовательностей", таблицу или листинг компьютерной программы - Приложение, представленное в текстовом файле ASCII

Список последовательностей, представленный в файле 81906-848664_ST25.TXT, созданном 17 августа 2012 г., 71601 байт, машинный формат IBM-PC, операционная система MS-Windows, включен в настоящий документ в виде ссылки.

Утверждение прав на изобретения, сделанные в рамках, финансируемых из федерального бюджета научных исследований и разработок

Настоящее изобретение было создано при правительственной поддержке согласно гранту №HL63993, NS-44155, U01 AI075443, присужденному Национальными институтами здоровья. Правительство имеет определенные права на изобретение.

Предпосылки создания изобретения

Многофункциональный цитокин TGF-β (трансформирующий фактор роста-β) оказывает влияние на иммунные, эндотелиальные, эпителиальные и мезенхимальные клетки в периоды развития и взрослой жизни беспозвоночных и позвоночных видов. У млекопитающих эти функции опосредуются тремя широко экспрессированными изоформами - TGF-β1, 2 и 3. Все три изоформы взаимодействуют с одними и теми же рецепторами на поверхности клеток (TGFBR2 и ALK5) и передают сигналы через одни и те же внутриклеточные сигнальные пути, которые вовлекают либо канонические (т.е. SMAD), либо неканонические (т.е. MAPK, JUN, PI3K, PP2A, Rho, PAR6) эффекторы передачи сигналов. В каноническом сигнальном пути TGF-β сигнал распространяется от рецептора TGF-β через фосфорилирование цитоплазматических SMAD-2/3, образование комплекса со SMAD-4, транслокацию комплекса SMAD-2/3/4 в ядро и связывание с SMAD элементами ответа, локализованными в промоторных областях многих генов, вовлеченных в фиброгенный ответ. Хотя изоформы TGF-β имеют сходных сигнальных партнеров, каждая из них служит определенным биологическим функциям. Изоформы TGF-β имеют различия в аффинности связывания с TGF-β рецепторами, механизме активации, интенсивности или длительности сигналирования либо в пространственном и/или временном распределении.

Нокаут и модели условной делеции (т.е. делеции гена только в одном органе (conditional deletion)) TGF-β изоформ, рецепторов и сигнальных медиаторов, а также реагенты, блокирующие функцию, мишенью для которых являются все изоформы TGF-β, выявили существенно важную роль TGF-β в развитии Т-клеток, сердца, легких, сосудов и неба. Мыши с дефицитом TGF-β1 либо умирают in utero (внутриутробно) вследствие дефектов васкулогенеза в желточном мешке, либо выживают до взрослого состояния, имея тяжелые аутоиммунные заболевания полиорганного характера. Генетическая делеция SMAD2, т.е. медиатора TGF-β-сигналирования, выявила, что он играет важную роль в раннем паттернинге и образовании мезодермы. Мыши, имеющие недостаток Smad3, являются жизнеспособными и плодовитыми, но у них проявляются мальформации конечностей, иммунная дисрегуляция, колит, карциномы толстой кишки и расширение альвеол. Во взрослых тканях сигнальный путь TGF-β вовлекается во взаимодействия иммунных, мезенхимальных и эпителиальных клеток для поддержания гомеостаза в ответ на стресс со стороны окружающей среды.

Гомеостатические пути, опосредуемые TGF-β, нарушаются в ответ на хронически повторяющееся повреждение. TGF-β является основным профиброгенным цитокином в ответной реакции на повреждение, замедляющим эпителиальное заживление раны. TGF-β ингибирует эпителиальную пролиферацию и миграцию, способствует апоптозу и увеличивает в объеме мезенхимальный компартмент, индуцируя рекрутмент фибробластов, сжимаемость фибробластов и отложение внеклеточного матрикса. Внутритрахеальный перенос аденовирусного рекомбинантного TGF-β1 в легкое грызунов резко увеличивает аккумуляцию фибробластов и экспрессию коллагена I типа и IIΙ типа вокруг дыхательных путей и в легочном интерстиции. Нейтрализующие анти-TGFβ антитела могут блокировать блеомицин или индуцированный радиацией фиброз легких.

Повышенная активность TGF-β может играть определенную роль в фиброзном заболевании легких, гломерулосклерозе и рестенозе сосудов сердца, первично опосредованных TGF-β1. TGF-β1 в организме человека многофункционален, на что указывают наследственные заболевания, вовлекающие либо сам TGF-β1, либо его сигнальные эффекторы. Мутации, которые повышают активность пути TGF-β, приводят к нарушениям метаболизма в костной ткани (т.е. болезнь Камурати-Энгельмана), соединительной ткани (т.е. синдром Марфана) и в аневризмам аорты (т.е. синдром Лойса-Дитца). Мутации, которые приводят к снижению активности пути TGF-β, коррелируют с раком. Однако роль TGF-β как опухолевого супрессора при раке неоднозначна, поскольку TGF-β может также способствовать росту и метастазированию опухолей.

Несмотря на множественные важные функции TGF-β, введение единичной дозы или кратковременное введение нейтрализующего пан-TGF-β антитела переносится хорошо. Побочных эффектов у грызунов при введении им доз, ингибирующих фиброз органов или рост клеток карциномы и метастазирование, не наблюдалось. Это лечение также эффективно ингибирует экспериментальный фиброз. Клинические испытания (I/II фаз) однократной дозы с использованием нейтрализующих пан-TGFβ антител для лечения метастатической почечно-клеточной карциномы, меланомы, фокально-сегментарного гломерулосклероза и идиопатического легочного фиброза продолжаются (Genzyme Corporation, доступ на genzymeclinicalresearch.com).

Краткое описание сущности изобретения

Предлагаются композиции антител, которые могут использоваться для диагностики и лечения заболеваний, ассоциированных с высокой активностью TGF-β, опосредованной αvβ8. В некоторых вариантах осуществления изобретения предлагается выделенное антитело, которое специфически связывает αvβ8, при этом выделенное антитело ингибирует высвобождение активного зрелого TGFβ-пептида, но не ингибирует в значительной мере адгезию латентного TGF-β к αvβ8 на αvβ8-экспрессирующей клетке, при этом выделенное антитело связывает фиксированные (например, фиксированные в формалине) αvβ8-экспрессирующие клетки. Антитело с указанной активностью обозначено как 11Е8, причем этот термин включает аффинно-зрелые, гуманизированные, химерные и меченые версии антител 11Е8, а также их αvβ8-связывающие фрагменты. В некоторых вариантах осуществления изобретения выделенное антитело специфически связывается с эпитопом на β8, расположенным в пределах SEQ ID NO: 1. В некоторых вариантах осуществления изобретения антитело содержит CDR (области, определяющие комплементарность) тяжелой цепи, показанные в SEQ ID NO: 10 (SEQ ID NO: 48, 49 и 50). В некоторых вариантах антитело содержит CDR легкой цепи, показанные в SEQ ID NO: 11 (SEQ ID NO: 51, 52 и 53). В некоторых вариантах антитело содержит CDR тяжелой цепи, показанные в SEQ ID NO: 10, и CDR легкой цепи, показанные в SEQ ID NO: 11. В некоторых вариантах осуществления изобретения антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID NO: 10. В некоторых вариантах антитело содержит вариабельную область легкой цепи, показанную в SEQ ID NO: 11. В некоторых вариантах антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID NO: 10, и вариабельную область легкой цепи, показанную в SEQ ID NO: 11. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи и CDR легкой цепи 11E8Mut28. В некоторых вариантах осуществления изобретения антитело содержит последовательность вариабельной области тяжелой цепи и последовательность вариабельной области легкой цепи 11E8Mut28. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи и CDR легкой цепи 11E8Mut94. В некоторых вариантах антитело содержит последовательность вариабельной области тяжелой цепи и последовательность вариабельной области легкой цепи 11E8Mut94. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи и CDR легкой цепи 11E8Mut39. В некоторых вариантах антитело содержит последовательность вариабельной области тяжелой цепи и последовательность вариабельной области легкой цепи 11E8Mut39. В некоторых вариантах осуществления изобретения выделенное антитело связывается с эпитопом β8 с высокой аффинностью, например, с аффинностью, превышающей аффинность анти-αvβ8 антитела 37Е1, с аффинностью в наномолярном или пикомолярном диапазоне, или с Кд (константа диссоциации) порядка 10-7, 10–8, 10-9 или ниже. В некоторых вариантах осуществления изобретения выделенное антитело меньше 50 килодальтон (кДа), меньше 25 кДа или является одноцепочечным антителом (например, scFv). В некоторых вариантах осуществления изобретения анти-αvβ8 антитело 37Е1 или 37Е1В5 конкурирует с антителом 11Е8 за связывание с αvβ8 на αvβ8-экспрессирующей клетке. Предлагается также фармацевтическая композиция, содержащая описанное здесь выделенное антитело и фармацевтический вспомогательный компонент (эксципиент).

Кроме того, предлагается гуманизированное антитело, которое специфически связывает αvβ8, при этом выделенное антитело ингибирует высвобождение активного зрелого TGF8-пептида, но не ингибирует в значительной мере адгезию латентного TGF-β к αvβ8 на αvβ8-экспрессирующей клетке. Антитело с указанной активностью обозначено как h37E1B5 (гуманизированное 37Е1В5 или Hu37E1B5), причем этот термин относится к меченому h37E1B5 и его αvβ8-связывающим фрагментам. В некоторых вариантах осуществления изобретения гуманизированное антитело специфически связывается с эпитопом на β8, расположенным в пределах SEQ ID NO: 1. В некоторых вариантах осуществления изобретения гуманизированное антитело специфически связывается с эпитопом β8 с высокой аффинностью, например, с аффинностью, превышающей аффинность анти-αvβ8 антитела 37Е1, с аффинностью в наномолярном или пикомолярном диапазоне, или с Кд порядка 10-7, 10-8, 10-9 или ниже. В некоторых вариантах осуществления изобретения выделенное антитело меньше 50 кДа, меньше 25 кДа или является одноцепочечным антителом (например, scFv). В некоторых вариантах осуществления изобретения гуманизированное антитело содержит вариабельную область тяжелой цепи SEQ ID NO: 8 и вариабельную область легкой цепи SEQ ID NO: 9. В некоторых вариантах осуществления изобретения гуманизированное антитело имеет вариабельную область тяжелой цепи SEQ ID NO: 8 и вариабельную область легкой цепи SEQ ID NO: 9. Предлагается также фармацевтическая композиция, содержащая описанное здесь гуманизированное антитело и фармацевтический вспомогательный компонент.

Предлагаются также композиции антител, которые могут использоваться для диагностики заболеваний, ассоциированных с повышенной активностью TGF-β, опосредованной αvβ8. В некоторых вариантах осуществления изобретения предлагается выделенное антитело, которое специфически связывает αvβ8, при этом антитело не ингибирует высвобождение активного зрелого TGFβ-пептида или адгезию латентного TGFβ к αvβ8 на αvβ8-экспрессирующей клетке; при этом выделенное антитело связывает фиксированные (например, фиксированные в формалине) αvβ8-экспрессирующие клетки или ткань и при этом антитело различает уровни экспрессии αvβ8 в клетке или ткани (например, антитело может использоваться для сравнения уровней экспрессии αvβ8 на различных клетках). Антитела с указанной активностью обозначены как 6В9 и 4F1, которые включают аффинно-зрелые, гуманизированные, химерные и меченые версии антител 6В9 и 4F1, а также их αvβ8-связывающие фрагменты. В некоторых вариантах осуществления изобретения выделенное антитело специфически связывается с эпитопом на β8, расположенным в пределах SEQ ID NO: 14. В некоторых вариантах осуществления изобретения эпитоп включает S95 человеческого β8, полноразмерная последовательность которого показана в SEQ ID NO: 17. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи, показанные в SEQ ID NO: 18. В некоторых вариантах антитело содержит CDR легкой цепи, показанные в SEQ ID NO: 19. В некоторых вариантах антитело содержит CDR тяжелой цепи, показанные в SEQ ID NO: 18, и CDR легкой цепи, показанные в SEQ ID NO: 19. В некоторых вариантах осуществления изобретения антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID NO: 18. В некоторых вариантах антитело содержит вариабельную область легкой цепи, показанную в SEQ ID NO: 19. В некоторых вариантах антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID NO: 18, и вариабельную область легкой цепи, показанную в SEQ ID NO: 19. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи и CDR легкой цепи 6B9Mut1. В некоторых вариантах антитело содержит последовательность вариабельной области тяжелой цепи и последовательность вариабельной области легкой цепи 6B9Mut1. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи, показанные в SEQ ID NO: 20. В некоторых вариантах антитело содержит CDR легкой цепи, показанные в SEQ ID NO: 21. В некоторых вариантах антитело содержит CDR тяжелой цепи, показанные в SEQ ID NO: 20, и CDR легкой цепи, показанные в SEQ ID NO: 21. В некоторых вариантах осуществления изобретения антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID NO: 20. В некоторых вариантах антитело содержит вариабельную область легкой цепи, показанную в SEQ ID NO: 21. В некоторых вариантах антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID NO: 20, и вариабельную область легкой цепи, показанную в SEQ ID NO: 21. В некоторых вариантах осуществления изобретения выделенное антитело связывается с эпитопом β8 с высокой аффинностью, например, с аффинностью в наномолярном или пикомолярном диапазоне, или с Кд порядка 10-7, 10-8, 10-9 или ниже. В некоторых вариантах осуществления изобретения выделенное антитело меньше 50 кДа, меньше 25 кДа или является одноцепочечным антителом (например, scFv). В некоторых вариантах осуществления изобретения анти-αvβ8 антитело 6В9 или 4F1 не конкурирует с антителами 37Е1, 37Е1В5 или 11Е8 за связывание с αvβ8 на αvβ8-экспрессирующей клетке. Предлагается также фармацевтическая композиция, содержащая описанные в заявке выделенные антитела и фармацевтический вспомогательный компонент.

Предлагаются также способы снижения TGFβ-сигналирования (снижение активности TGF-β, сокращение высвобождения зрелого активного TGF-β) у индивидуума, предусматривающие введение индивидууму фармацевтической композиции, содержащей антитело 11Е8 или h37E1B5 (описанные выше), для снижения TGFβ-сигналирования у индивидуума. В некоторых вариантах осуществления изобретения индивидуум страдает по меньшей мере одним состоянием (заболеванием, нарушением), выбранным из группы, включающей воспалительное заболевание кишечника (IBD), хроническую обструктивную болезнь легких (COPD), астму, артрит, фиброз печени, фиброз легких, воспалительное аутоиммунное заболевание головного мозга, рассеянный склероз, демиелинизирующее заболевание, нейровоспаление, болезнь почек, аденокарциному, сквамозную карциному, глиому и карциному молочной железы, а снижение TGFβ-сигналирования способствует улучшению состояния.

Предлагаются также способы диагностики αvβ8-ассоциированного заболевания у индивидуума, предусматривающие контактирование клетки, полученной от индивидуума, с описанным выше антителом 11Е8, 6В9 или 4F1 и детекцию связывания выделенного антитела с клеткой, где связывание выделенного антитела с клеткой указывает на то, что индивидуум страдает αvβ8-ассоциированным заболеванием. В некоторых вариантах осуществления изобретения αvβ8-ассоциированное заболевание выбрано из группы, включающей воспалительное заболевание кишечника (IBD), хроническую обструктивную болезнь легких (COPD), астму, артрит, фиброз печени, фиброз легких, воспалительное аутоиммунное заболевание головного мозга, рассеянный склероз, демиелинизирующее заболевание, нейровоспаление, болезнь почек, аденокарциному, сквамозную карциному, глиому и карциному молочной железы. В некоторых вариантах осуществления изобретения (например, в диагностических технологиях in vitro) клетка фиксируется. В некоторых вариантах осуществления изобретения αvβ8-ассоциированным заболеванием является IBD, и клетку получают из кишечника индивидуума (например, толстой кишки или других отделов кишечника). В некоторых вариантах αvβ8-ассоциированным заболеванием является артрит, и клетка является хондроцитом или хрящевой клеткой от индивидуума. В некоторых вариантах αvβ8-ассоциированным заболеванием является фиброз печени, и клетка является стеллатной клеткой печени индивидуума. В некоторых вариантах αvβ8-ассоциированным заболеванием является астма, COPD или фиброз легких, и клетку получают из дыхательных путей индивидуума. В некоторых вариантах осуществления изобретения способ также предусматривает введение фармацевтической композиции (содержащей антитело 11Е8, 37Е1В5 или h37E1B5) индивидууму.

Кроме того, предлагаются способы определения относительного уровня αvβ8-экспрессии на тестируемой клетке. В некоторых вариантах осуществления изобретения способ предусматривает контактирование тестируемой клетки с антителом 6В9, детекцию связывания антитела 6В9 с тестируемой клеткой и сравнение уровня связывания антитела 6В9 с уровнем связывания контрольной клетки для определения, тем самым, относительного уровня экспрессии αvβ8 на тестируемой клетке. В некоторых вариантах осуществления изобретения способ предусматривает контактирование тестируемой клетки с антителом 4F1, детекцию связывания антитела 4F1 с тестируемой клеткой и сравнение уровня связывания антитела 4F1 с уровнем связывания контрольной клетки для определения, тем самым, относительного уровня экспрессии αvβ8 на тестируемой клетке. В некоторых вариантах осуществления изобретения тестируемая клетка фиксируется (например, фиксируется в формалине). В некоторых вариантах контрольная клетка фиксируется. В некоторых вариантах осуществления изобретения контрольная клетка является клеткой дикого типа, нераковой клеткой. В некоторых вариантах контрольная клетка является здоровой клеткой (от индивидуума, не страдающего αvβ8-ассоциированным заболеванием). В некоторых вариантах осуществления изобретения уровень экспрессии является индикатором числа β8-геномных копий в клетке, так что, например, более высокий относительный уровень экспрессии по сравнению с нераковым контролем указывает на то, что тестируемая клетка имеет увеличенное число β8-геномных копий. В некоторых вариантах осуществления изобретения тестируемая клетка присутствует в биологическом образце от индивидуума (например, в in vitro образце биологической жидкости или ткани). В некоторых вариантах тестируемая клетка представляет собой клетку in situ индивидуума. В некоторых вариантах осуществления изобретения способ также предусматривает диагностику у индивидуума αvβ8-ассоциированного заболевания (описанного выше), если уровень экспрессии αvβ8 выше, чем нормальный в тестируемой клетке. Специалисту в данной области понятно, что контрольная клетка может быть клеткой от здорового индивидуума (например, репрезентативной клеткой нормальных уровней экспрессии) или может быть положительным контролем, например, известным как имеющий повышенный уровень экспрессии αvβ8, или может быть клеткой от индивидуума с αvβ8-ассоциированным заболеванием.

Дополнительно предлагается выделенное антитело, которое специфически связывается с αvβ8, при этом указанное антитело не ингибирует высвобождение активного зрелого TGFβ-пептида или адгезию латентного TGF-β к αvβ8 на αvβ8-экспрессирующей клетке. В некоторых вариантах осуществления изобретения выделенное антитело специфически связывается с эпитопом на β8, расположенным в пределах SEQ ID NO: 1. Антитело с указанной активностью обозначено как 14Е5, причем этот термин включает аффинно-зрелые, гуманизированные, химерные и меченые версии антитела 14Е5, а также их αvβ8-связывающие фрагменты. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи, показанные в SEQ ID NO: 12. В некоторых вариантах антитело содержит CDR легкой цепи, показанные в SEQ ID NO: 13. В некоторых вариантах антитело содержит CDR тяжелой цепи, показанные в SEQ ID NO: 12, и CDR легкой цепи, показанные в SEQ ID NO: 13. В некоторых вариантах осуществления изобретения антитело содержит CDR тяжелой цепи и CDR легкой цепи аффинно-зрелого антитела, выбранного из группы, состоящей из 14E5Mut11, 14E5Mut42, 14E5Mut54, 14E5Mut68, 14E5Mut65, 14E5Mut83 и 14E5Mut95. В некоторых вариантах осуществления изобретения антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID NO: 12. В некоторых вариантах антитело содержит вариабельную область легкой цепи, показанную в SEQ ID NO: 13. В некоторых вариантах антитело содержит вариабельную область тяжелой цепи, показанную в SEQ ID No: 12, и вариабельную область легкой цепи, показанную в SEQ ID NO: 13. В некоторых вариантах осуществления изобретения антитело содержит последовательность вариабельной области тяжелой цепи и последовательность вариабельной области легкой цепи аффинно-зрелого антитела, выбранного из группы, состоящей из 14E5Mut11, 14E5Mut42, 14E5Mut54, 14E5Mut68, 14E5Mut65, 14E5Mut83 и 14E5Mut95. В некоторых вариантах осуществления изобретения выделенное антитело связывается с эпитопом β8 с высокой аффинностью, например, с более высокой аффинностью, чем аффинность анти-αvβ8 антитела 37Е1, с аффинностью в наномолярном или пикомолярном диапазоне, или с Кд порядка 10-7, 10-8, 10-9 или ниже. В некоторых вариантах осуществления изобретения выделенное антитело меньше 50 кДа, меньше 25 кДа или является одноцепочечным антителом (например, scFv). В некоторых вариантах осуществления изобретения анти-αvβ8 антитело 37Е1 или 37Е1В5 конкурирует с антителом 14Е5 за связывание с αvβ8 на αvβ8-экспрессирующей клетке.

Предлагаются способы детекции присутствия αvβ8-экспрессирующей клетки, предусматривающие контактирование клетки с антителом 14Е5 и определение того, связывается ли антитело с клеткой, согласно которым связывание антитела с клеткой указывает на присутствие αvβ8-экспрессирующей клетки. В некоторых вариантах осуществления изобретения контактирование проводится in vivo. В некоторых вариантах контактирование проводится in vitro.

Такие способы могут применяться в методах диагностики у индивидуума αvβ8-ассоциированного заболевания, предусматривающих контактирование клетки от индивидуума с антителом 14Е5, описанным выше, и детекцию связывания выделенного антитела с клеткой, согласно которым связывание выделенного антитела с клеткой указывает на то, что индивидуум страдает αvβ8-ассоциированным заболеванием. В некоторых вариантах осуществления изобретения αvβ8-ассоциированное заболевание выбрано из группы, включающей воспалительное заболевание кишечника (IBD), хроническую обструктивную болезнь легких (COPD), астму, артрит, фиброз печени, фиброз легких, воспалительное аутоиммунное заболевание головного мозга, рассеянный склероз, демиелинизирующее заболевание, нейровоспаление, болезнь почек, аденокарциному, сквамозную карциному, глиому и карциному молочной железы. В некоторых вариантах осуществления изобретения αvβ8-ассоциированным заболеванием является IBD, и клетку получают из кишечника (например, толстой кишки или других отделов кишечника) индивидуума. В некоторых вариантах αvβ8-ассоциированным заболеванием является артрит, и клетка является хондроцитом или хрящевой клеткой от индивидуума. В некоторых вариантах αvβ8-ассоциированным заболеванием является фиброз печени, и клетка является стеллатной клеткой печени от индивидуума. В некоторых вариантах αvβ8-ассоциированным заболеванием является астма, COPD или фиброз легких, и клетку получают из дыхательных путей индивидуума. В некоторых вариантах осуществления изобретения способ предусматривает также введение фармацевтической композиции (содержащей антитело 11Е8, 37Е1В5 или h37E1B5) индивидууму.

Краткое описание чертежей

На Фиг. 1 представлено выравнивание вариабельных областей тяжелых и легкой цепи для антител 37Е1, 37Е1В5 и гуманизированного антитела 37Е1В5. Отмечены последовательности CDR и каркасных участков.

На Фиг. 2 показана экспрессия человеческого β8 на стеллатных клетках печени ITGβ8 трансгенных мышей. На верхней панели показан контроль изотипов, в то время как на нижней панели показана экспрессия β8, определение которой производилось с использованием антитела 14Е5.

На Фиг. 3 показана экспрессия β8 на альвеолярных макрофагах легких, дендритных клетках, медиастинальных клетках лимфатических узлов, Т- и В-клетках и приведена сводная таблица данных окрашивания в других органах. A) Макрофаги легких: аутофлуоресцентные+, CD11Chi+, F480+, CD8+, CD11B-, Ly6G-, CD103-, Ly6C+/-, TCR-; B) Дендритные клетки легких: аутофлуоресцентные-, CD11C промежут.+, F480 (в основном отрицательные), CD8+, CD11B+, CD103-/+, Ly6C+/-, TCR-, Ly6G-, GR-1-C); C) Т-клетки легких: TCR αβ+, CD3+, B220-, класса II-, CD19-, неаутофлуоресцентные; D) В-клетки легких: TCR αβ-, CD3-, В220+, класса ΙΙ+, CD19+, неаутофлуоресцентные; E) Дендритные клетки медиастинальных лимфоузлов (MLN): аутофлуоресцентные-, CD11C промежут.+, CD11B+, МНС hi (главный комплекс гистосовместимости) класса II, F480-, Ly6C+/-, Ly6G- (вероятно CD8+, CD103+/-, GR-1+/-); F) В-клетки MLN: TCR αβ-, CD3-, Β220+, класса ΙΙ+, CD19+, неаутофлуоресцентные; G) Сводная таблица данных окрашивания в различных органах. Окрашивание проводилось с использованием гибридомного клона 14Е5.

На Фиг. 4 показано влияние введения 37Е1В5 на размер тонкой кишки (воспаление) у BACtg мышей.

На Фиг. 5 представлен снимок разреза тонкой кишки контрольных (без лечения) мышей и BACtg мышей, получавших лечение антителом 37Е1В5.

На Фиг. 6 показано, что антитела 4F1 и 6В9 специфически связываются с и окрашивают фиксированные в формалине клетки линии 293, экспрессирующие β8 (293 β8), но не трансфицированные клетки 293 (293 WT). Антитела окрашивают также фиксированные в формалине срезы головного мозга от трансгенных по интегрину β8 мышей (ITGβ8 BAC).

Фиг. 7: Гибридомный клон 4F1 специфически окрашивает фиксированные в формалине, залитые парафином головной мозг и легкое ITGβ8 ВАС трансгенных (Tg) мышей. Головной мозг или легкое ITGβ8 ВАС Tg-мышей или мышей дикого типа (WT) фиксировались в течение ночи в 10% буферном растворе формалина и затем подвергались процессу обработки тканей, заливки в парафин и приготовления срезов. Иммуноокрашивание проводилось таким же методом тепло-индуцированного поиска антигенов, какой описан выше, а детекция антител проводилась с использованием коммерческого набора (Dako).

Фиг. 8: Гибридомный клон 6В9 способен обнаруживать варьирование числа копий, как показывает иммуноокрашивание фиксированного в формалине, залитого в парафин головного мозга ITGβ8 ВАС трансгенной (Tg) мыши. Показаны три линии Tg-мышей (В, С и D) в сравнении с WT-мышами (нижняя панель). Число копий следующее: 1 копия (D---линия BAC/WT), 2 копии (В и С---линии BAC/WT; D---линия ВАС/ВАС) или 4 копии (В и С---линии ВАС/ВАС).

Фиг. 9: Рекомбинантный моноклональный кроличий IgG, происходящий из вариабельных доменов клона 4F1, способен обнаруживать варьирование числа копий, как показывает иммуноокрашивание фиксированного в формалине, залитого в парафин легкого ITGβ8 ВАС трансгенных (Tg) мышей. Показаны три линии Tg-мышей (В, С и D) в сравнении с WT-мышами (нижняя панель). Число копий следующее: 1 копия (D---линия BAC/WT), 2 копии (В и С---линии BAC/WT; D---линия ВАС/ВАС) или 4 копии (В и С---линии ВАС/ВАС).

Фиг. 10: Рекомбинантный моноклональный кроличий IgG, происходящий из вариабельных доменов клона 4F1, способен обнаруживать экспрессию αvβ8 иммуноокрашиванием фиксированного в формалине, залитого в парафин человеческого легкого, пораженного фиброзом. Стрелки указывают на окрашивание веретенообразных клеток, представляющих собой фибробласты, вкрапленные в плотную фиброзную соединительную ткань.

Фиг. 11А-11В: Последовательности вариабельной области тяжелой цепи для множества вновь открытых антител и их последующих аффинно-зрелых вариантов (обозначены как "Mut"). Аминокислоты, выделенные жирным шрифтом и подчеркиванием, указывают на отличия от в исходной ("wt") последовательности вариабельной области тяжелой цепи.

Фиг. 12А-12В: Последовательности вариабельной области легкой цепи для множества вновь открытых антител и их последующих аффинно-зрелых вариантов (обозначены как "Mut"). Аминокислоты, выделенные жирным шрифтом и подчеркиванием, указывают на отличия от исходной ("wt") последовательности вариабельной области легкой цепи.

Подробное описание изобретения

I. Введение

Трансформирующий фактор роста β (TGF-β) первоначально был охарактеризован как онкоген, способный индуцировать трансформированный фенотип в клетках неопухолевой природы. С тех пор были найдены иные члены семейства TGF-β на основе присутствия сходных аминокислотных доменов.

Некоторые изоформы TGF-β экспрессируются повсеместно у млекопитающих (TGF-β 1-3), но поддерживаются в неактивной форме за счет нековалентного взаимодействия с пропептидом - ассоциированным с латентностью доменом TGF-β (LAP). Для передачи сигнала TGF-β должен высвободиться из своего неактивного комплекса посредством процесса, называемого активацией TGF-β. Латентный комплекс TGF включает 3 компонента: активный (зрелый) TGFβ-димер, LAP (ассоциированный с латентностью пептид) и LTBP (латентный TGFβ-связывающий белок). LAP - это димер, связанный дисульфидной связью, который представляет собой N-концевой участок белка-предшественника TGF-β. Зрелый TGFβ-бело? представляет собой С-концевой участок (около 25 кДа) предшественника. Связь между TGFβ и LAP расщепляется протеолитически внутри аппарата Гольджи, но TGFβ-пропептид остается связанным с TGF-β нековалентными взаимодействиями. Комплекс TGF-β с LAP называется малым латентным комплексом (SLC). Эта ассоциация LAP и TGF-β обусловливает латентность. LAP-TGFβ-связанные является обратимым, и выделенные очищенные компоненты могут воссоединиться с образованием неактивного SLC. Как SLC, так и более крупный комплекс обозначены в описании как латентный TGF-β, поскольку оба они являются неактивными.

В общем смысле интегрины являются молекулами адгезии и опосредуют прикрепление клеток к белкам внеклеточного матрикса. Интегрин αvβ8 связывается с LAP TGF-β и опосредует активацию TGF-β1 and -β3 (Mu et al. (2002) J. Cell Biol. 159:493). Интегрин αvβ8-опосредованная активация TGF-β необходима для активации TGF-β in vivo (т.е. для высвобождения зрелого TGFβ-полипептида), поэтому αvβ8 является "стражем" TGFβ-функции. Интегрин αvβ8 экспрессируется в нормальном эпителии (например, в эпителии дыхательных путей), мезенхимальных клетках и нейронных тканях. Результаты, приведенные здесь, показывают, что интегрин αvβ8-опосредованная активация TGF-β может привести к развитию COPD (хронической обструктивной болезни легких), фиброза легких, артрита, воспалительного заболевания кишечника, фиброза печени и почек, воспалительных аутоиммунных заболеваний головного мозга и демиелинизирующих заболеваний (например, MS (рассеянный склероз), поперечный миелит, болезнь Девика, синдром Гийена-Барре), нейровоспаления, болезни почек и к росту и метастазированию раковых опухолей.

II. Терминология

Если конкретно не оговаривается иное, то употребляемые в описании научно-технические термины имеют общепринятое значение, понятное специалисту в данной области. См., например, Lackie, Dictionary of Cell and Molecular Biology, Elsevier (4th ed. 2007); Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Springs Harbor Press (Cold Springs Harbor, NY 1989). Любые способы, устройства и материалы, сходные или эквивалентные описанным в заявке, могут применяться при осуществлении настоящего изобретения. Для облегчения понимания некоторых терминов, часто употребляемых в описании, ниже приводятся следующие их определения, не имеющие целью ограничить объем настоящего изобретения.

Термины "анти-αvβ8 антитело", "антитело, специфичное к αvβ8," "антитело к αvβ8" и "анти-αvβ8" употребляются в описании синонимично и относятся к антителу, которое специфически связывается с αvβ8. Равным образом, анти-β8 антитело (и подобные термины) относится к антителу, которое специфически связывается с β8. Описанные здесь анти-αvβ8 антитела и анти-β8 антитела связываются с белком, экспрессированным на αvβ8-экспрессирующих клетках.

Фиксированная клетка - это клетка, которая была подвергнута обработке с целью ингибировать клеточный метаболизм и законсервировать клетку для исследования. Фиксация традиционно практикуется в данной области техники, например, чтобы исследовать цитологические характеристики с помощью гистологии или исследовать экспрессию маркеров на поверхности клеток с помощью иммуноокрашивания и/или проточной цитометрии. Специалисту в данной области понятно, что клетка может фиксироваться в любом из целого ряда известных фиксирующих растворов, содержащих, например, формалин, формальдегид, параформальдегид, метанол, ацетон и др. Ткани могут фиксироваться аналогичным путем.

αvβ8-ассоциированное заболевание - это состояние, характеризующееся присутствием αvβ8-экспрессирующих клеток, при котором либо клетки, экспрессируют повышенный уровень αvβ8, либо количество αvβ8-экспрессирующих клеток увеличено по отношению к нормальному здоровому контролю. TGFβ-ассоциированные заболевания (заболевания, характеризуемые более высокой, чем нормальная, TGFβ-активностью) включают αvβ8-ассоциированные заболевания, так как αvβ8 в определенных условиях вовлекается в активацию TGF-β, как описано здесь.

"Нуклеиновая кислота" относится к дезоксирибонуклеотидам или рибонуклеотидам и их полимерам либо в одно-, либо в двухцепочечной форме и к комплементарным им последовательностям. Термин "полинуклеотид" относится к линейной последовательности нуклеотидов. Термин "нуклеотид", как правило, относится к одной единице полинуклеотида, т.е. мономеру. Нуклеотиды могут быть рибонуклеотидами, дезоксирибонуклеотидами или их модифицированными версиями. Примеры полинуклеотидов, рассматриваемых в изобретении, включают одно- и двухцепочечную ДНК, одно- и двухцепочечную РНК (включая миРНК (малые интерферирующие)) и гибридные молекулы, содержащие смеси одно- и двухцепочечных ДНК и РНК.

Слова "комплементарный" или "комплементарность" относятся к способности нуклеиновой кислоты в одном полинуклеотиде к спариванию с другой нуклеиновой кислотой во втором полинуклеотиде. Например, последовательность A-G-T комплементарна последовательности Т-С-А. Комплементарность может быть частичной, когда только некоторые из нуклеиновых кислот являются сопоставимыми согласно правилу спаривания оснований, или полной, когда все нуклеиновые кислоты являются сопоставимыми согласно правилу спаривания оснований.

Специалистам в данной области известно множество методов измерения специфических ДНК и РНК, которые используют технику гибридизации нуклеиновых кислот (см. Sambrook, Id.). Некоторые методы включают электрофоретическое разделение (например, Саузерн-блоттинг для обнаружения ДНК и нозерн-блоттинг для обнаружения РНК), но измерение ДНК и РНК может также проводиться в отсутствие электрофоретического разделения (например, с помощью количественной ПЦР, дот-блота или анализа на чипе).

Слова "белок", "пептид" и "полипептид" употребляются взаимозаменяемо для обозначения аминокислотного полимера или комплекса из двух или более взаимодействующих или связанных аминокислотных полимеров. Термины применяются к аминокислотным полимерам, в которых один или более аминокислотный остаток является искусственным химическим миметиком соответствующей природной аминокислоты, а также к природным аминокислотным полимерам, к аминокислотным полимерам, содержащим модифицированные остатки, и к аминокислотному полимеру, не встречающемуся в природе.

Термин "аминокислота" относится к природным и синтетическим аминокислотам, а также к аналогам аминокислот и миметикам аминокислот, которые функционируют подобно природным аминокислотам. Природные аминокислоты - это аминокислоты, кодированные генетическим кодом, а также те аминокислоты, которые позднее модифицируются, например, гидроксипролин, γ-карбоксиглутамат и O-фосфосерин. Термин "аналоги аминокислот" относится к соединениям, которые имеют одинаковую с природной аминокислотой основную химическую структуру, например, содержат α-углеродный атом, связанный с водородом, карбоксильной группой, аминогруппой и R-группой, например, гомосерин, норлейцин, метионинсульфоксид, метионин-метил-сульфоний. Такие аналоги могут содержать модифицированные R-группы (например, норлейцин) или модифицированные пептидные остовы, но сохраняют одинаковую с природной аминокислотой основную химическую структуру. Миметики аминокислот относятся к химическим соединениям, которые имеют структуру, отличающуюся от основной химической структуры аминокислоты, но которые функционируют таким же образом, что и природная аминокислота.

Аминокислоты, на которые авторы ссылаются в настоящем описании, могут обозначаться либо общеизвестными трехбуквенными символами, либо однобуквенными символами, рекомендованными Комиссией по биохимической номенклатуре IUPAC-IUB. Подобно этому, нуклеотиды могут обозначаться общепризнанными однобуквенными кодами.

Термин "консервативно модифицированные варианты" применим как к аминокислотным последовательностям, так и к последовательностям нуклеиновых кислот. Что касается конкретных последовательностей нуклеиновых кислот, то консервативно модифицированные варианты относятся к тем нуклеиновым кислотам, которые кодируют идентичные или в основном идентичные аминокислотные последовательности, либо, если нуклеиновая кислота не кодирует аминокислотную последовательность, - к по существу идентичным или ассоциированным (например, смежным от природы) последовательностям. Вследствие вырожденности генетического кода большинство белков кодирует большое число функционально идентичных нуклеиновых кислот. Например, все кодоны GCA, GCC, GCG и GCU кодируют аминокислоту аланин. Так, в каждом положении, где аланин определяется ко доном, кодон может быть заменен на другой из описанных соответствующих кодонов без изменения кодируемого полипептида. Такие вариации нуклеиновых кислот являются "молчащими вариациями", которые представляют собой один из видов консервативно модифицированных вариантов. В контексте изобретения каждая последовательность нуклеиновых кислот, которая кодирует полипептид, описывает также и молчащие вариации нуклеиновых кислот. Специалисту в данной области понятно, что в определенных контекстах каждый кодон в нуклеиновой кислоте (за исключением AUG, который, как известно, является единственным кодоном для метионина, и TGG, который является единственным кодоном для триптофана) может модифицироваться с образованием функционально идентичной молекулы. Следовательно, молчащие вариации нуклеиновой кислоты, которая кодирует полипептид, являются имплицитными в описанной последовательности по отношению к продукту экспрессии, но не по отношению к фактическим последовательностям зондов.

Что касается аминокислотных последовательностей, то специалисту в данной области понятно, что отдельные замены, делеции или добавления в нуклеотидную, пептидную, полипептидную или белковую последовательность, которые изменяют, добавляют или приводят к делеции единичной аминокислоты или небольшого процента аминокислот в кодируемой последовательности, представляют собой "консервативно модифицированный вариант", в котором изменение ведет к замене аминокислоты на химически сходную аминокислоту. В данной области техники хорошо известны таблицы консервативных замен, обеспечивающих функционально сходные аминокислоты. Такие консервативно модифицированные варианты являются дополнением к и не исключают полиморфных вариантов, внутривидовых гомологов и аллелей изобретения. Следующие аминокислоты служат типично консервативными заменами друг для друга: 1) аланин (A), глицин (G); 2) аспарагиновая кислота (D), глутаминовая кислота (E); 3) аспарагин (N), глутамин (Q); 4) аргинин (R), лизин (K); 5) изолейцин (I), лейцин (L), метионин (M), валин (V); 6) фенилаланин (F), тирозин (Y), триптофан (W); 7) серии (S), треонин (T); и 8) цистеин (C), метионин (M) (см., например, Creighton, Proteins (1984)).

Термины "идентичный" или "процент идентичности" в контексте двух или более последовательностей нуклеиновых кислот либо двух или более полипептидов относятся к двум или более последовательностям или подпоследовательностям, которые являются одинаковыми или имеют определенное количество одинаковых нуклеотидов или аминокислот (т.е. их идентичность составляет около 60%, предпочтительно - 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или выше, в пределах определенного участка при сравнении и выравнивании для максимального соответствия в пределах окна сравнения или указанного участка), как показали измерения с использованием алгоритмов сравнения последовательностей BLAST или BLAST 2.0 с параметрами по умолчанию или путем выравнивания вручную и визуальной оценки. См., например, веб-сайт NCBI - ncbi.nlm.nih.gov/BLAST. О таких последовательностях говорят, что они являются "в основном идентичными". Этот термин относится также (или может быть применим) к последовательности, комплементарной тестируемой последовательности нуклеотидов. Термин включает также последовательности, которые содержат делеции и/или добавления, а также последовательности, которые имеют замены. Как описывается ниже, алгоритмы могут подсчитывать пробелы и т.п. В типичных случаях идентичность существует в пределах участка, содержащего эпитоп антитела, или последовательности, насчитывающей по меньшей мере примерно 25 аминокислот или нуклеотидов в длину, либо в пределах области, насчитывающей 50-100 аминокислот или нуклеотидов в длину, либо в пределах всей длины референсной последовательности.

Термин "рекомбинантный" при употреблении применительно, например, к клетке или нуклеиновой кислоте, белку или к вектору, означает, что клетка, нуклеиновая кислота, белок или вектор были модифицированы путем введения гетерологичной нуклеиновой кислоты или белка либо путем изменения нативной нуклеиновой кислоты или белка, или что клетка происходит из клетки, модифицированной таким путем. Так, например, рекомбинантные клетки экспрессируют гены, не встречающиеся в нативной (нерекомбинантной) форме клетки, или экспрессируют нативные гены, которые в противном случае экспрессируются аномально, недостаточно или не экспрессируются вообще.

Термин "гетерологичный" при употреблении применительно к участкам нуклеиновой кислоты означает, что нуклеиновая кислота содержит две или более подпоследовательности, которые в такой взаимосвязи друг с другом не встречаются в природе. Например, нуклеиновая кислота в типичных случаях продуцируется рекомбинантно, имея две или более последовательностей из неродственных генов, занимающих такое местоположение, что образуется новая функциональная нуклеиновая кислота, например, промотор из одного источника, а кодирующая область из другого источника. Равным образом, гетерологичный белок означает, что белок содержит две или более последовательностей, которые в такой взаимосвязи друг с другом не встречаются в природе (например, слитый белок).

Термин "антитело" относится к полипептиду, содержащему каркасную область из гена иммуноглобулина (или его фрагментов), который специфически связывает и распознает антиген, например, β8, особый поверхностный маркер клеток, или любую желательную мишень. В типичных случаях "вариабельная область" содержит антигенсвязывающую область антитела (или его функционального эквивалента) и является наиболее критической в специфичности и аффинности связывания. См. Paul, Fundamental Immunology (2003).

Показательным примером структурной единицы иммуноглобулина (антитела) является тетрамер. Каждый тетрамер состоит из двух идентичных пар полипептидных цепей, причем каждая пара имеет одну "легкую" (около 25 кДа) и одну "тяжелую" цепь (примерно 50-70 кДа). N-конец каждой цепи определяет вариабельную область в примерно от 100 до 110 или более аминокислот, ответственных, главным образом, за распознавание антигена. Термины вариабельная легкая цепь (VL) и вариабельная тяжелая цепь (VH) относятся к этим легким и тяжелым цепям, соответственно.

"Изотип" - это класс антител, определяемых константной областью тяжелой цепи. Гены иммуноглобулина включают каппа, лямбда, альфа, гамма, дельта, ипсилон и мю гены константной области. Легкие цепи классифицируются как каппа или лямбда. Тяжелые цепи классифицируются как гамма, мю, альфа, дельта или ипсилон, которые, в свою очередь, определяют классы изотопов - IgM, IgA, IgD и IgE, соответственно.

Антитела могут существовать как интактные иммуноглобулины или как любые фрагменты из числа хорошо охарактеризованных фрагментов, которые имеют специфическую антигенсвязывающую активность. Такие фрагменты могут продуцироваться расщеплением под действием различных пептидаз. Пепсин расщепляет антитело в шарнирной области ниже дисульфидных связей с образованием F(ab)'2, т.е. димера Fab, который сам по себе является легкой цепью, соединенной с VH-CH1 дисульфидной связью. При умеренных условиях F(ab)'2 может уменьшаться с последующим разрывом дисульфидной связи в шарнирной области и превращением, тем самым, димера F(ab)'2 в мономер Fab'. Мономер Fab', по сути, представляет собой Fab с частью шарнирной области, (см. Fundamental Immunology (Paul ed., 3d ed. 1993). Несмотря на то, что различные фрагменты антитела определяются в рамках расщепления интактного антитела, специалисту в данной области понятно, что такие фрагменты могут синтезироваться de novo (заново) либо химическим путем, либо с применением метода рекомбинантных ДНК. Поэтому термин "антитело" в контексте изобретения включает также фрагменты антитела, либо полученные модификацией полных антител, либо синтезированные de novo с применением метода рекомбинантных ДНК (например, одноцепочечный Fv), либо идентифицированные с помощью библиотек фагового дисплея (см., например, McCafferty et al., Nature 348:552-554 (1990)).

"Моноклональное антитело" относится к клональному получению антител только с одной специфичностью и аффинностью связывания с определенным эпитопом на антигене. "Поликлональное антитело" относится к получению антител, которые направлены против одного антигена, но с различными специфичностью и аффинностью связывания.

В контексте изобретения "V-область" относится к домену вариабельной области антитела, содержащему сегменты каркасного участка 1, CDR1, каркасного участка 2, CDR2, каркасного участка 3, CDR3, и каркасного участка 4. Включение этих сегментов в V-сегмент происходит вследствие перегруппировки генов V-области тяжелой цепи и легкой цепи в процессе дифференцировки В-клеток.

В контексте изобретения "область, определяющая комплементарность (CDR)," относится к трем гипервариабельным участкам в каждой цепи, которые прерывают четыре "каркасных" области, определяемые вариабельными областями легкой и тяжелой цепей. CDR являются ответственными, в первую очередь, за связывание с эпитопом антигена. CDR каждой цепи обычно обозначаются как CDR1, CDR2 и CDR3, причем нумерация идет последовательно, начиная с N-конца, а также обычно идентифицируются цепью, в которой локализуется конкретная CDR. Так, VH CDR3 локализуется в вариабельном домене тяжелой цепи антитела, в котором она находится, в то время как VL CDR1 - это CDR1 из вариабельного домена легкой цепи антитела, в котором она находится.

Последовательности каркасных областей различных легких и тяжелых цепей являются относительно консервативными внутри вида. Каркасная область антитела, т.е. объединенные каркасные области составляющих легких и тяжелых цепей, служит для расположения и выравнивания CDR в трехмерном пространстве.

Аминокислотные последовательности CDR и каркасных областей могут определяться в соответствии с различными хорошо известными в данной области техники системами нумерации, например, по Kabat, Chothia, международной базе данных по иммуногенетике (IMGT) и AbM (см., например, Johnson et al., supra; Chothia & Lesk, (1987) J. Mol. Biol. 196, 901-917; Chothia et al. (1989) Nature 342, 877-883; Chothia et al. (1992) J. Mol. Biol. 227, 799-817; Al-Lazikani et al, J. Mol. Biol 1997, 273(4)). Определения сайтов связывания с антигенами приведены также в следующих источниках: Ruiz et al. Nucleic Acids Res., 28, 219-221 (2000) и Lefranc Nucleic Acids Res. Jan 1; 29(1):207-9 (2001); MacCallum et al., J. Mol. Biol., 262: 732-745 (1996) и Martin et al, Proc. Natl Acad. Sci. USA, 86, 9268-9272 (1989); Martin, et al, Methods Enzymol, 203: 121-153, (1991); Pedersen et al, Immunomethods, 1, 126, (1992) и Rees et al; в Sternberg M.J.E. (ed.), Protein Structure Prediction. Oxford University Press, Oxford, 141-172 1996).

"Химерное антитело" представляет собой молекулу антитела, в которой а) константная область или ее часть изменена, заменена или обменена таким образом, что сайт связывания с антигеном (вариабельная область, CDR или их часть) связывается с константной областью молекулы другого или измененного класса, другой эффекторной функции и/или вида либо с полностью отличающейся молекулой, которая придает новые свойства химерному антителу (например, фермент, токсин, гормон, фактор роста, лекарственное средство и др.); или б) вариабельная область или ее часть изменена, заменена или обменена с вариабельной областью, имеющей отличающуюся или измененную специфичность к антигену (например, CDR и каркасные области из других видов).

Антитело связывается с "эпитопом" на антигене. Эпитоп - это участок (сайт) связывающего взаимодействия со специфическим антителом на антигене; он может включать небольшое число аминокислот или их фрагментов, например, 5 либо 6 или более, например, 20 или более аминокислот либо фрагментов этих аминокислот. В некоторых случаях эпитоп включает небелковые компоненты, например, из углевода, нуклеиновой кислоты или липида. В некоторых случаях эпитоп представляет собой трехмерную структуру. Так, например, если мишенью является белок, то эпитоп может состоять из последовательных аминокислот или аминокислот из различных частей белка, которые сближаются за счет фолдинга белка (например, прерывистый эпитоп). То же справедливо и для других типов молекул-мишеней, которые образуют трехмерные структуры.

Термин "специфически связываться" относится к молекуле (например, антителу или фрагменту антитела), которая связывается с мишенью с аффинностью, по меньшей мере 2-кратно превышающей аффинность соединений, не являющихся мишенями, например, с по меньшей мере 4-, 5-, 6-, 7-, 8-, 9-, 10-, 20-, 25-, 50- или 100-кратно превышающей аффинностью. Например, антитело, которое специфически связывает β8, будет в типичных случаях связываться с β8 с аффинностью, которая по меньшей мере в 2 раза выше аффинности мишени, не являющейся β8 (например, другая субъединица интегрина, к примеру β6).

Термин "связывает" по отношению к виду клеток (например, антитело, которое связывает фиброзные клетки, гепатоциты, хондроциты и др.) в типичных случаях означает, что агент связывает большинство клеток в чистой популяции этих клеток. Например, антитело, которое связывает данный вид клеток, в типичных случаях будет связываться по меньшей мере с 2/3 клеток в популяции указанных клеток (например, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 или 100%). Специалисту в данной области техники понятно, что может иметь место некоторая вариабельность в зависимости от метода и/или порога обнаружения связывания.

В контексте изобретения первое антитело или его антигенсвязывающая часть "конкурирует" за связывание с мишенью со вторым антителом или его антигенсвязывающей частью, если степень связывания второго антитела с мишенью обнаруживаемо снижается в присутствии первого антитела по сравнению со связыванием второго антитела в отсутствие первого антитела. Альтернативный вариант, когда связывание первого антитела с мишенью также обнаруживаемо снижается в присутствии второго антитела, возможен, но необязателен. То есть второе антитело может ингибировать связывание первого антитела с мишенью без того, чтобы первое антитело ингибировало связывание второго антитела с мишенью. Однако, если каждое из антител проявляет поддающееся обнаружению ингибирование связывания другого антитела с его родственным эпитопом или лигандом, будь это в равнозначной, большей или меньшей степени, то про такие антитела говорят, что они "перекрестно конкурируют" друг с другом за связывание соответствующего(их) эпитопа(ов). Настоящее изобретение охватывает как конкурирующие, так и перекрестно конкурирующие антитела. Термин "антитело-конкурент" может быть применим к первому или второму антителу, что может определить специалист в данной области. В некоторых случаях присутствие антитела-конкурента (например, первого антитела) уменьшает степень связывания второго антитела с мишенью по меньшей мере на 10%, например, на 20%, 30%, 40%, 50%, 60%, 70%, 80% или более, к примеру настолько, что степень связывания второго антитела с мишенью может не поддаваться обнаружению в присутствии первого (конкурента) антитела.

Термин "дифференциально экспрессируемый" или "дифференциально регулируемый" относится в большинстве случаев к биомаркеру - белку или нуклеиновой кислоте, который сверхэкспрессируется (положительно (т.е. в сторону повышения) регулируется) или недоэкспрессируется (отрицательно (т.е. в сторону понижения) регулируется) в одном образце по сравнению с по меньшей мере одним другим образцом. В контексте настоящего изобретения термин в большинстве случаев относится к сверхэкспрессии биомаркера (например, αvβ8) на пораженной болезнью клетке, сравниваемой с нормальной клеткой.

Например, термины "сверхэкспрессируемый" или "положительно регулируемый" взаимозаменяемо относятся к белку или нуклеиновой кислоте, вообще - к биомаркеру, который транскрибируется или транслируется на уровне, обнаруживаемо выше контрольного. Термин включает сверхэкспрессию, вызванную транскрипцией, посттранскрипционным процессингом, трансляцией, посттрансляционным процессингом, клеточной локализацией (например, органелла, цитоплазма, ядро, поверхность клетки) и РНК и стабильностью белка. Сверхэкспрессия может быть обнаружена традиционными методами детекции биомаркеров, будь то мРНК (т.е. ОТ-ПЦР, гибридизация) или белок (т.е. проточная цитометрия, получение изображений, ELISA, иммуногистохимические методы). Сверхэкспрессия может составлять 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или более в сравнении с нормальной клеткой.

Термины "агонист", "активатор", "индуктор" и подобные термины относятся к молекулам, которые повышают активность или экспрессию по сравнению с контролем. Агонисты - это агенты, которые, например, связываются с, стимулируют, увеличивают, активируют, усиливают активацию, повышают чувствительность или положительно регулируют активность мишени. Экспрессия или активность может быть выше на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% 100% или более, чем в контроле. В некоторых случаях активация выше в 1,5 раза, в 2, 3,4, 5, 10 или более раз, чем в контроле.

Термины "ингибитор", "репрессор" или "антагонист", или "понижающий (отрицательный) регулятор" взаимозаменяемо относятся к веществу, которое приводит к обнаруживаемому снижению уровня экспрессии или активности по сравнению с контролем. Ингибируемая экспрессия или активность может быть на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или более % меньше, чем в контроле. В некоторых случаях ингибирование может быть в 1,5 раза, 2, 3, 4, 5,10 или более раз выше, чем в контроле.

"Контрольный" образец или значение относится к образцу, который служит в качестве стандарта, обычно известного стандарта, для сравнения с тестируемым образцом. Например, тестируемый образец может быть получен в условиях испытаний, например, в присутствии испытуемого соединения и сравниваться с образцами, полученными в известных условиях, например, в отсутствие испытуемого соединения (отрицательный контроль) или в присутствии известного соединения (положительный контроль). Контроль может также представлять собой среднее значение, рассчитанное на основании ряда испытаний или результатов. Специалисту в данной области понятно, что контроль может предназначаться для оценки любого числа параметров. Например, контроль может быть разработан для сравнения лечебного действия на основании фармакологических данных (например, время полужизни) или терапевтических мер (например, сравнение полезных и/или побочных эффектов). Контроль может быть сконструирован для применения in vitro. Специалист в данной области знает, какой контроль является ценным в каждой конкретной ситуации, и может самостоятельно провести анализ данных сравнения с контрольными значениями. Контроль также является ценным средством для определения значимости данных. Например, если значения данного параметра варьируют в широких пределах в контроле, то варьирование в тестируемых образцах не будет считаться значимым.

"Метка" или "обнаруживаемый фрагмент" является композицией, поддающейся обнаружению спектроскопическими, фотохимическими, биохимическими, иммунохимическими, химическими или другими физическими методами. Например, полезные метки включают 32P, флуоресцентные красители, электронно-плотные реагенты, ферменты (например, традиционно используемые в ELISA), биотин, дигоксигенин или гаптены и белки либо другие объекты, которые могут быть сделаны обнаруживаемыми, например, за счет введения радиоактивной метки в пептид или антитело, специфически реагирующее с пептидом-мишенью. Может использоваться любой, известный в данной области техники, метод конъюгации антитела с меткой, например, методы, описанные в Hermanson, Bioconjugate Techniques 1996, Academic Press, Inc., San Diego.

"Меченая" молекула (например, нуклеиновая кислота, белок или антитело) - это молекула, которая связывается либо ковалентно через линкер или химическую связь, либо нековалентно через ионные, ван-дер-ваальсовы, электростатические или водородные связи с меткой таким образом, что присутствие молекулы может быть обнаружено путем детекции присутствия метки, связанной с молекулой.

Термин "диагностика" относится к относительной вероятности того, что заболевание, такое как рак или воспалительный процесс, наличествует у субъекта. Равным образом, термин "прогноз" относится к относительной вероятности того, что у субъекта может произойти определенный исход болезни в будущем. Например, прогноз может относиться к вероятности того, что у индивидуума возникнет TGFβ- или αvβ8-ассоциированное заболевание, наступит рецидив или предположительно возрастет тяжесть заболевания (например, тяжесть симптомов, скорость функционального спада, выживаемость и др.). Термины не претендуют на абсолютную полноту, что понятно любому из специалистов в области медицинской диагностики.

"Биопсия" или "биологический образец от пациента" в контексте изобретения относится к образцу, полученному от пациента, страдающего или с подозрением на TGFβ- или αvβ8-ассоциированное заболевание. В некоторых вариантах осуществления изобретения образец может представлять собой биопсию ткани, например, игольчатую биопсию, тонкоигольчатую биопсию, хирургическую биопсию и др. Образец также может представлять собой образец крови или фракции крови, например, фракции лейкоцитов, сыворотки или плазмы крови. Образец может включать образец ткани с закрытым повреждением или с подозрением на повреждение, хотя биологический образец может происходить также из другого места, например, места предположительного метастазирования, лимфатического узла или из крови. В некоторых случаях биологический образец может быть также из места, прилегающего к повреждению или с подозрением на повреждение.

"Биологический образец" может быть получен от пациента, например, это биопсия, полученная от животного, например, животной модели, или из культивированных клеток, например, клеточной линии или клеток, удаленных из организма пациента и выращенных в культуре для наблюдения. Биологические образцы включают ткани и биологические жидкости организма, например, кровь, фракции крови, лимфу, слюну, мочу, фекалии и др.

Термины "терапия", "лечение" и "облегчение" относятся к любому снижению тяжести симптомов. В случае лечения воспалительного процесса "лечение" может относиться к снижению, например, уровней воспалительных цитокинов в крови, уровней активного зрелого TGF-β в крови, устранению боли, отека, рекрутинга иммунных клеток и др. В случае лечения рака "лечение" может относиться к уменьшению, например, размера опухоли, количества раковых клеток, скорости роста, метастатической активности, клеточной смерти нераковых клеток и др. В контексте изобретения термины "лечить" и "предупреждать" не претендуют на абсолютную полноту. "Лечение" и "предупреждение (профилактика)" могут относиться к отсрочке возникновения заболевания, облегчению симптомов, улучшению выживаемости пациента, увеличению времени или коэффициента выживаемости и др. Лечение и профилактика могут быть полными (остаточные симптомы не обнаруживаются) или частичными, так чтобы симптомы были менее частыми или менее тяжелыми, чем у пациента без описанного здесь лечения. Эффект лечения может сравниваться с индивидуумом или группой индивидуумов, не получающих лечения, либо с тем же пациентом до начала лечения или в разное время в ходе лечения. В некоторых аспектах тяжесть заболевания снижается по меньшей мере на 10% по сравнению, например, с индивидуумами до начала лечения или с контрольным индивидуумом, не получающим лечения. В некоторых аспектах тяжесть заболевания снижается по меньшей мере на 25%, 50%, 75%, 80% или 90% или в некоторых случаях до более не обнаруживаемых симптомов с помощью стандартных методов диагностики.

Термины "эффективное количество", "эффективная доза", "терапевтически эффективное количество" и др. относятся к такому количеству терапевтического агента, которое является достаточным для облегчения заболевания, описанного выше. Например, для заданного параметра терапевтически эффективное количество показывает повышение или снижение эффекта лечения по меньшей мере на 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90% или по меньшей мере на 100%. Терапевтическая эффективность может также выражаться как "-кратное" повышение или снижение. Например, терапевтически эффективное количество может оказывать по меньшей мере 1,2-кратный, 1,5-кратный, 2-кратный, 5-кратный или более эффект по сравнению с контролем.

В контексте изобретения термин "фармацевтически приемлемый" употребляется синонимично с физиологически приемлемым и фармакологически приемлемым. Фармацевтическая композиция в большинстве случаев содержит агенты для буферизации и консервации в хранении и может включать буферы и носители для соответствующей доставки композиции в зависимости от способа введения.

Термины "доза" и "дозировка" употребляются в контексте изобретения взаимозаменяемо. Доза относится к количеству активного ингредиента, даваемому индивидууму при каждом введении (приеме). В рамках настоящего изобретения доза может относиться к концентрации антитела или ассоциированных компонентов, например, к количеству терапевтического агента или к дозе радиоактивной метки. Доза будет варьировать в зависимости от ряда факторов, включая частоту введения (приема); размер и переносимость индивидуумом; степень тяжести заболевания; риск побочных эффектов; способ введения (приема) и метод визуализации контрастного вещества (если таковое присутствует). Специалисту в данной области понятно, что доза может меняться в зависимости от вышеперечисленных факторов или на основе терапевтического прогресса. Термин "дозировочная форма" относится к конкретному формату лекарственного средства и зависит от способа введения (приема). Например, дозировочная форма может быть жидкой, например, физиологический раствор для инъекций.

"Субъект", "пациент", "индивидуум" и подобные термины употребляются взаимозаменяемо и относятся, за исключением случаев конкретного называния, к млекопитающим, таким как человек и приматы, не относящиеся к человеку, а также кроликам, крысам, мышам, козам, свиньям и другим видам млекопитающих. Термин необязательно указывает на то, что у субъекта диагностировано конкретное заболевание, но в типичных случаях относится к индивидууму, находящемуся под медицинским наблюдением. Пациент может быть индивидуумом, который обращается за лечением, мониторингом состояния, реабилитацией или изменением существующей схемы лечения и др.

"Воспалительное состояние" относится к любому воспалению в организме индивидуума и может быть временным (например, в ответ на воздействие патогена или аллергена) или хроническим. Воспаление характеризуется воспалительными цитокинами, такими как IFN-гамма, IL-6 и TNF-альфа, которые рекрутируют и активируют макрофаги и другие лейкоциты. В некоторых случаях воспаление может развиться в хроническое опасное заболевание или аутоиммунное заболевание (например, рассеянный склероз (MS), волчанка, ревматоидный артрит, болезнь Крона). Воспаление может быть местным (например, в месте локализации инфекции или облучения) или системным (например, атеросклероз, высокое кровяное давление). В некоторых вариантах осуществления изобретения описанные здесь композиции антител и способы могут применяться для лечения воспалительных состояний.

"Рак", "опухоль", "трансформированный" и подобные термины включают предраковые, неопластические, трансформированные и раковые клетки и могут относиться к солидной опухоли или к несолидному раку (см., например, Edge et al. AJCC Cancer Staging Manual (7th ed. 2009); Cibas & Ducatman Cytology: Diagnostic principles and clinical correlates (3rd ed. 2009)). Рак включает как доброкачественные, так и злокачественные новообразования (аномальный рост). "Трансформация" относится к спонтанным или индуцированным фенотипическим изменениям, например, иммортализации клеток, морфологическим изменениям, росту аберрантных клеток, пониженному контактному торможению и фиксации (закреплению) и/или злокачественности (см. Freshney, Culture of Animal Cells a Manual of Basic Technique (3rd ed. 1994)). Хотя трансформация может быть вызвана инфекцией трансформирующим вирусом и введением новой геномной ДНК или поглощением экзогенной ДНК, она также может произойти спонтанно или как следствие воздействия канцерогена.

Термин "рак" может относиться к карциномам, саркомам, аденокарциномам, лимфомам, лейкемии, солидному и лимфоидному раку и др. Примеры различных видов рака включают, но не ограничиваются перечисленным, рак легких (например, немелкоклеточный рак легких или NSCLC), рак яичников, рак простаты, колоректальный рак (рак прямой кишки), рак печени (т.е. гепатокарцинома), рак почек (т.е. гипернефрома), рак мочевого пузыря, рак молочной железы, рак щитовидной железы, рак плевры, рак поджелудочной железы, рак матки, рак шейки матки, рак мужских половых желез (яичек), рак анального канала, рак желчных протоков, карциноидные опухоли желудочно-кишечного тракта, рак пищевода, рак желчного пузыря, рак аппендикса, рак тонкой кишки, рак желудка, рак центральной нервной системы, рак кожи, хориокарциному, раковые образования головы и шеи, рак крови, остеогенную саркому, фибросаркому, нейробластому, глиому, меланому, В-клеточную лимфому, неходжкинскую лимфому, лимфому Беркитта, мелкоклеточную лимфому, крупноклеточную лимфому, моноцитическую лейкемию, миелогенную лейкемию, острую лимфоцитарную лейкемию, острую миелоцитическую лейкемию (AML), хроническую миелоидную лейкемию (CML) и множественную миелому. В некоторых вариантах осуществления изобретения описанные здесь композиции антител и способы могут применяться для лечения рака.

III. Антитела, специфичные к αvβ8

А. Гуманизированное антитело 37Е1В5

Мышиное моноклональное антитело 37Е1 (IgG2a) селективно блокирует взаимодействие человеческого интегрина αvβ8 с его лигандом - трансформирующим фактором роста-β (TGF-β). Антитело отличается тем, что оно селективно блокирует αvβ8-опосредованную активацию TGF-β (высвобождение зрелого TGFβ-полипеπтида), но не препятствует связыванию αvβ8 с иммобилизованным или секретированным TGF-β. Это дает высокую степень селективности в нарушении только активации TGF-β, а не способности αvβ8 к адгезии к клеткам. К тому же, системная инактивация TGF-β является нежелательной в некоторых случаях. Специфическая активность антитела 37Е1 обеспечивает терапевтический инструмент целенаправленного действия для снижения уровней TGF-β.

Вариабельные области тяжелой и легкой цепей 37Е1 очищали с тем, чтобы получить антитела с повышенной аффинностью. На Фиг. 1 приведены специфические аминокислотные замены, которые придают повышенную аффинность к одинаковым эпитопам на β8. Улучшенное (с повышенной аффинностью) антитело было обозначено как 37Е1В5. Оно проявляет повышенную аффинность in vitro и более высокую эффективность в ингибировании опосредованной интегрином αvβ8 активации TGF-β в культивируемых клетках. Эффективная терапевтическая доза антитела 37Е1В5 in vitro находится в пикомолярном диапазоне. Была создана гуманизированная версия 37Е1В5, которая сохраняет высокую аффинность связывания β8, как показано на фиг. 1. Как и родительские антитела 37Е1 и 37Е1В5, гуманизированная версия 37Е1В5 блокирует αvβ8-опосредованную активацию TGF-β, но не препятствует связыванию αvβ8 с иммобилизованным или секретированным TGF-β.

Таким образом, предлагаются антитела, которые содержат CDR 1-3 тяжелой цепи, которые могут быть найдены в последовательностях вариабельной области тяжелой цепи SEQ ID NO: 4, 6 и 8. Последовательностями CDR 1-3 тяжелой цепи являются соответственно RYWMS (SEQ ID NO: 94), EINPDSSTINYTSSLKD (SEQ ID NO: 95) и LITTEDY (SEQ ID NO: 96). Кроме того, предлагаются антитела, которые содержат CDR 1-3 легкой цепи, которые могут быть найдены в последовательностях вариабельной области легкой цепи SEQ ID NO: 5 или SEQ ID NO: 7 и 9. Последовательностями CDR 1-3 легкой цепи из SEQ ID NO: 5 являются соответственно KASQDINSYL (SEQ ID NO: 97), RANRLVD (SEQ ID NO: 98) и LQYDEFPYT (SEQ ID NO: 99). Последовательности вариабельной области легкой цепи SEQ ID NO: 7 и 9 содержат одинаковые последовательности CDR1 и CDR3, такие как SEQ ID NO: 5, но отличаются по CDR2 (YANRLVD, SEQ ID NO: 100).

В некоторых вариантах осуществления изобретения предлагаются антитела, содержащие:

последовательность вариабельной области тяжелой цепи включающую SEQ ID NO: 94, 95 и 96, и последовательность вариабельной области легкой цепи, включающую SEQ ID NO: 97, 98 и 99;

последовательность вариабельной области тяжелой цепи, включающую SEQ ID NO: 94, 95 и 96, и последовательность вариабельной области легкой цепи, включающую SEQ ID NO: 97, 100 и 99; или

последовательность вариабельной области тяжелой цепи, выбранную из группы, состоящей из SEQ ID NO: 4, 6 и 8, и последовательность вариабельной области легкой цепи, выбранную из группы, состоящей из SEQ ID NO: 5, 7 и 9, в любой комбинации.

В некоторых вариантах осуществления изобретения антитело содержит последовательность вариабельной области тяжелой цепи SEQ ID NO: 8 и последовательность вариабельной области легкой цепи SEQ ID NO: 9.

В. 11Е8

Антитело 11Е8 связывает эпитоп на αvβ8, который сходен с эпитопом 37Е1В5, но также связывает и фиксированные клетки (например, фиксированные в формалине). Подобно 37Е1В5, 11Е8 специфически связывает αvβ8 и ингибирует высвобождение активного зрелого TGFβ-пептида без ингибирования адгезии латентного TGF-β к αvβ8. Поскольку 11Е8 может связывать αvβ8 как на нефиксированных, так и на фиксированных в формалине клетках и может снижать высвобождение зрелого TGF-β, оно (т.е. 11Е8) пригодно для выявления (например, диагностики или мониторинга), лечения и для комбинированного выявления/лечения.

Вариабельные области тяжелых и легкой цепи (с подчеркнутыми CDR) для антитела 11Е8 приводятся ниже:

SEQ ID NO: 10 - вариабельная область тяжелой цепи для 11Е8 (CDR 1-3 подчеркнуты; SEQ ID NO: 48-50, соответственно)

EVQLQQSGPELMKTGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGDILPGSGTTNYNEKFKGRATVTADRSSNTAYMQLSSLTYGDSAVYYCATWGWDTYWDQGTSVTVSS

SEQ ID NO: 11 - вариабельная область легкой цепи для 11Е8 (CDR 1-3 подчеркнуты; SEQ ID NO: 51-53, соответственно)

DIVMTQSPSSLSASLGDRVTISCSASQGISNYLNWYQQKPDGTVKLLIYYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSNLPYTFGGGTKLEIKR

Таким образом, предлагаются антитела, которые содержат последовательности CDR тяжелой цепи SEQ ID NO: 48, 49 и 50 и последовательности CDR легкой цепи SEQ ID NO: 51, 52 и 53. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи SEQ ID NO: 10 и/или вариабельную область легкой цепи SEQ ID NO:11.

Как показано на фиг. 11А-В и 12А-В, были обнаружены аффинно-зрелые антитела 11Е8, которые обозначены как 11E8Mut28, 11E8Mut94 и 11Е839.

Аффинно-зрелое антитело 11E8Mut28 содержит изменение в CDR3 тяжелой цепи (WGWDSY; SEQ ID NO: 54) и изменение в CDR3 Легкой цепи (QQFSNLPYT; SEQ ID NO: 55). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат:

участки CDR тяжелой цепи SEQ ID NO: 48, 49 и 54 и участки CDR легкой цепи SEQ ID NO: 51, 52 и 53 легкой цепи или

участки CDR тяжелой цепи SEQ ID NO:48, 49 и 50 и участки CDR легкой цепи SEQ ID NO: 51, 52 и 55 легкой цепи, или

участки CDR тяжелой цепи SEQ ID NO: 48, 49 и 54 и участки CDR легкой цепи SEQ ID NO: 51, 52 и 55 легкой цепи.

11E8Mut28 также содержит изменения в FR3 тяжелой цепи (KAAITADTSSNTSYLQLSSLTSEDSAVYYCAR; SEQ ID NO: 56) и FR4 тяжелой цепи (WGQGTLVTVSS; SEQ ID NO: 57). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 56 или 57 (например, SEQ ID NO: 32), и необязательно вариабельную область легкой цепи, содержащую SEQ ID NO: 23.

Аффинно-зрелое антитело 11E8Mut94 содержит изменение в CDR2 и CDR3 тяжелой цепи (DILPGSGTTNYNEKFEG, SEQ ID NO: 90, и WGWDSY, SEQ ID NO: 54, соответственно). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат:

участки CDR тяжелой цепи SEQ ID NOS: 48, 90 и 54 и участки CDR легкой цепи SEQ ID NOS: 51, 52 и 53 легкой цепи.

11E8Mut94 также содержит изменения в FR2 тяжелой цепи (WVKQRPGHGFEWIG, SEQ ID NO: 91), в FR3 тяжелой цепи (RAAITADTSSNTSYMQLSSLTSEDSAVYYCAR, SEQ ID NO: 92) и в FR4 тяжелой цепи (WGQGTLVTVSS; SEQ ID NO: 57). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 91, 92 или 57 (например, SEQ ID NO: 88), и необязательно вариабельную область легкой цепи, содержащую SEQ ID NO: 89. 11E8Mut94 содержит также изменения в FR1 легкой цепи (DIKMTQTPSSLSASLGDRVTISC, SEQ ID NO: 93). В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 93, например, SEQ ID NO: 89, и необязательно тяжелой цепи - SEQ ID NO: 88.

Аффинно-зрелое антитело 11E8Mut39 содержит изменение в CDR1 тяжелой цепи (TYWIE; SEQ ID NO: 112), в CDR2 тяжелой цепи (HTLPGSGTTNYNEKFKG; SEQ ID NO: 113), в CDR1 легкой цепи (STSQDVSSYLN; SEQ ID NO: 105) и в CDR2 легкой цепи (YASNLHS; SEQ ID NO: 107). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат:

участки CDR тяжелой цепи SEQ ID NO: 112, 113 и 50 и участки CDR легкой цепи SEQ ID NO: 51, 52 и 53,

участки CDR тяжелой цепи SEQ ID NO: 48, 49 и 50 и участки CDR легкой цепи SEQ ID NO: 105, 107 и 53 или

участки CDR тяжелой цепи SEQ ID NO: 112, 113, 50 и участки CDR легкой цепи SEQ ID NO: 105, 107 и 53.

11E8Mut39 содержит также изменения в FR1 тяжелой цепи (QVQLQQSGPELMKTGASVKISCKATGYTFS; SEQ ID NO: 106), в FR3 тяжелой цепи (RATITADRPSNTSYMQLSSLTYGDSAVFYCAT; SEQ ID NO: 114) и в FR4 тяжелой цепи (WDHGTSVTVSS; SEQ ID NO: 108). 11E8Mut39 содержит изменения в FR1 легкой цепи (DIMMTQTPSSLSASLGDRVTISC; SEQ ID NO: 115) и в FR4 легкой цепи (FGGGTKLEIKA; SEQ ID NO: 111). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 106, 114 или 108 (например, SEQ ID NO: 102), и необязательно вариабельную область легкой цепи, содержащую SEQ ID NO: 104. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 115 или 111 (например, SEQ ID NO: 104), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 102.

С. 14Е5

Антитело 14Е5 связывает эпитоп на αvβ8, подобный эпитопу для 37Е1В5. Подобно 37Е1В5 и 14Е5 специфически связывает αvβ8, но, в отличие от 37Е1В5, 14Е5 не ингибирует высвобождение активного зрелого TGFβ-пептида или адгезию латентного TGF-β к αvβ8. Поскольку антитело 14Е5 специфично к αvβ8, но не блокирует активность, оно пригодно для выявления, например, для диагностики или мониторинга in vivo.

Вариабельные области тяжелой и легкой цепи (с подчеркнутыми CDR) для антитела 14Е5 приводятся ниже:

SEQ ID NO: 12 - вариабельная область тяжелой цепи для 14Е5 (CDR1-3 подчеркнуты; SEQ ID NO: 58-60, соответственно)

ΕVQLQQSGAELMKPGASVKISCKATGYTFSTYWIEWIKQRPGHGLEWIGHILPGSVITNYNEKFKGKAAITADTSSNTSYMQLSSLTSEDSAVYYCARWGWDSYWGQGTLVTVSS

SEQ ID NO: 13 - вариабельная область легкой цепи для 14Е5 (CDR 1-3 подчеркнуты; SEQ ID NO: 61-63, соответственно)

DIEMTQSPSSLSASLGDRVTISCSTSQDISSSLNWYQQKPDGTVTLLIYYTSNLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKLPYTFGGGTKLEIKR

Таким образом, предлагаются антитела, которые содержат участки CDR тяжелой цепи SEQ ID NO: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 61, 62 и 63. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи последовательности SEQ ID NO: 12 и/или вариабельную область легкой цепи последовательности SEQ ID NO: 13.

Как показано на фиг. 11А-В и 12А-В, были выявлены семь аффинно-зрелых антител 14Е5, обозначенные как 14E5Mut11, 14E5Mut42, 14E5Mut54, 14E5Mut68, 14E5Mut65, 14E5Mut83 и 14E5Mut95. Эти аффинно-зрелые антитела содержат изменения в последовательностях CDR и FR, описанные ниже. В некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат CDR и FR из 14Е5 и аффинно-зрелые формы 14Е5 в различных комбинациях.

14E5Mut11 содержит изменение в CDR1 тяжелой цепи (TNWIE, SEQ ID NO: 64), изменение в CDR1 легкой цепи (SASQGISKYLN, SEQ ID NO: 65), изменение в CDR2 легкой цепи (YTSSLHS, SEQ ID NO: 66) и изменение в CDR3 легкой цепи (QQYSNLPYT, SEQ ID NO: 67). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат комбинации CDR из 14Е5 и 14E5Mut11, например:

участки CDR тяжелой цепи SEQ ID NO: 64, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 61, 62 и 63 или

участки CDR тяжелой цепи SEQ ID NO: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 65, 66 и 67, или

участки CDR тяжелой цепи SEQ ID NO: 64, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 65, 66 и 67.

14E5Mut11 также содержат изменения в FR1 и FR2 легкой цепи (DELMTQSPSSLSASLGDRVTISC, SEQ ID NO: 68 и WYQQKPDGTVKLLTY, SEQ ID NO: 69, соответственно). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 68 или 69 (например, SEQ ID NO: 24), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 33.

14E5Mut42 содержит изменение в CDR1 легкой цепи (SASQGISNYLN, SEQ ID NO: 70), изменение в CDR2 легкой цепи (YTSSLHS, SEQ ID N0: 66) и изменение в CDR3 легкой цепи (QQYSDLPYT, SEQ ID NO: 71). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат комбинации CDR из 14Е5 и 14E5Mut42, например:

участки CDR тяжелой цепи SEQ ID NOS: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NOS: 70, 66 и 71.

14E5Mut42 также содержит изменения в FR1 тяжелой цепи (EVPLQQSGAELMKPGASVKISCKATGYTFS, SEQ ID NO: 72), в FR1 и FR2 легкой цепи (DIVMTQTPSSLSASLGDRVTISC, SEQ ID NO: 73 и WYQQKPDGTVKLLTY, SEQ ID NO: 69, соответственно). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 72 (например, SEQ ID NO: 34), необязательно вместе с вариабельной областью легкой цепи, содержащей SEQ ГО N0:25. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 73 или 69 (например, SEQ ID NO: 25), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 34.

14E5Mut54 содержит изменение в CDR1 тяжелой цепи (TNWIE, SEQ ID NO: 64), изменение в CDR1 легкой цепи (SASQGISNYLN, SEQ ID NO: 70), изменение в CDR2 легкой цепи (YTSSLHS, SEQ ID NO: 66) и изменение в CDR3 легкой цепи (QQYSNLPYT, SEQ ID NO: 67). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат комбинации CDR из 14Е5 и 14E5Mut54, например:

участки CDR тяжелой цепи SEQ ID NO: 64, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 61, 62 и 63 или

участки CDR тяжелой цепи SEQ ID NO: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 67, или

участки CDR тяжелой цепи SEQ ID NO: 64, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 67.

14E5Mut54 также содержит изменения в FR3 тяжелой цепи (KAAITADTSSNTSYMQLTSLTSEDSAVYYCAR, SEQ ID NO: 74) и в FR1 и FR2 легкой цепи (DILMTQTPSSLSASLGDRVTIRC, SEQ ID NO: 75 и WYQQKPDGTVKLLTY, SEQ ID NO: 69, соответственно). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 74 (например, SEQ ID NO: 35), необязательно с вариабельной областью легкой цепи, содержащей SEQ ID NO: 26. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 75 или 69 (например, SEQ ID NO: 26), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 35.

14E5Mut68 содержит изменение в CDR2 тяжелой цепи (DILPGSGTTNYNEKFKG, SEQ ID NO: 76), изменение в CDR1 легкой цепи (SASQGISNYLN, SEQ ID NO: 70), изменение в CDR2 легкой цепи (YTSSLHS, SEQ ID NO: 66) и изменение в CDR3 легкой цепи (QQYSELPYT, SEQ ID NO: 77). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат комбинации CDR из 14Е5 и 14E5Mut68, например:

участки CDR тяжелой цепи SEQ ID NO: 58, 76 и 60 и участки CDR легкой цепи SEQ ID NO: 61, 62 и 63 или

участки CDR тяжелой цепи SEQ ID NO: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 77, или

участки CDR тяжелой цепи SEQ ID NO: 58, 76 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 77.

14E5Mut68 также содержит изменения в FR3 тяжелой цепи (RATVTADRSSNTSYMQLSSLTSEDSAVYYCAR, SEQ ID NO: 78) и в FR1 и FR2 легкой цепи (DIKMTQSPSSLSASLGDRVTISC, SEQ ID NO: 79 и WYQQKPDGTVKLLTY, SEQ ID NO: 69, соответственно). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 78 (например, SEQ ID NO: 36), необязательно с вариабельной областью легкой цепи, содержащей SEQ ID NO: 27. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 79 или 69 (например, SEQ ID NO: 27), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 36.

14E5Mut65 содержит изменение в CDR1 тяжелой цепи (TNWIE, SEQ ID NO: 64), изменение в CDR1 легкой цепи (SASQGISNYLN, SEQ ID NO: 70), изменение в CDR2 легкой цепи (YTSSLHS, SEQ ID NO: 66) и изменение в CDR3 легкой цепи (QQFSNLPYT, SEQ ID NO: 80). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат комбинации CDR из 14Е5 и 14E5Mut65, например:

участки CDR тяжелой цепи SEQ ID NO: 64, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 61, 62 и 63 или

участки CDR тяжелой цепи SEQ ID NO: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 80, или

участки CDR тяжелой цепи SEQ ID NO: 64, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 80.

14E5Mut65 также содержит изменения в FR1 и FR3 тяжелой цепи (QVQLQQSGAELMKPGASVKISCKATGYSFS, SEQ ID NO: 81 и

KAAITADTSSNTSYMQLSSLTSDDSAVYYCAR, SEQ ID NO: 82) и в FR1 и FR2 легкой цепи (DIKMTQSPSSLSASLGDRVTISC, SEQ ID NO: 79, и WYQQKPDGTVKLLTY, SEQ ID NO: 69, соответственно). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 81 или 82 (например, SEQ ID NO: 37), необязательно с вариабельной областью легкой цепи, содержащей SEQ ID NO: 28. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 79 или 69 (например, SEQ ID NO: 28), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 37.

14E5Mut83 содержит изменение в CDR1 тяжелой цепи (THWIE, SEQ ID NO: 83), изменение в CDR1 легкой цепи (SASQGISNYLN, SEQ ID NO: 70), изменение в CDR2 легкой цепи (YTSSLHS, SEQ ID NO: 66) и изменение в CDR3 легкой цепи (QQYSDLPYT, SEQ ID NO: 71). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат комбинации CDR из 14Е5 и 14E5Mut83, например:

участки CDR тяжелой цепи SEQ ID NO: 83, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 61, 62 и 63 или

участки CDR тяжелой цепи SEQ ID NO: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 71, или

участки CDR тяжелой цепи SEQ ID NO: 83, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 71.

14E5Mut83 также содержит изменения в FR1 тяжелой цепи (EVQLQQSGAVLMKPGASVKISCKATGYTFS, SEQ ID NO: 84) и в FR1 и FR2 легкой цепи (DDLMTQSPSSLSASLGDRVTISC, SEQ ID NO: 68, и WYQQKPDGTVKLLTY, SEQ ID NO: 69, соответственно). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 84 (например, SEQ ID NO: 38), необязательно с вариабельной областью легкой цепи, содержащей SEQ ID NO: 29. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 68 или 69 (например, SEQ ID NO: 29), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 38.

14E5Mut95 содержит изменение в CDR1 легкой цепи (SASQGISNYLN, SEQ ID NO: 70), изменение в CDR2 легкой цепи (YTSSLHS, SEQ ID NO: 66) и изменение в CDR3 легкой цепи (QQYSDLPYT, SEQ ID NO: 71). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат комбинации CDR из 14Е5 и 14E5Mut95, например:

участки CDR тяжелой цепи SEQ ID NO: 58, 59 и 60 и участки CDR легкой цепи SEQ ID NO: 70, 66 и 71.

14E5Mut95 также содержит изменения в FR1 и FR3 тяжелой цепи (EVQLQQTGAELMKPGASVKISCKATGYTFS, SEQ ID NO: 85 и

KAVITADTSSNTSYMQLSSLTSEDSAVYYCAR, SEQ ID NO: 86) и в FR1 и FR2 легкой цепи (DIEMTQSPSSLSASLGDRVTISC, SEQ ID NO: 87 и WYQQKPDGTVKLLTY, SEQ ID NO: 69, соответственно). Так, в некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи, содержащую SEQ ID NO: 86 (например, SEQ ID NO: 39), необязательно с вариабельной областью легкой цепи, содержащей SEQ ID NO: 30. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 87 или 69 (например, SEQ ID NO: 30), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 29.

D. 6В9

Антитело 6В9 связывает эпитоп на β8, включенный в аминокислоты 61-105 человеческого β8 (положения аминокислот по отношению к полноразмерной последовательности β8, представленной в SEQ ID NO: 17), который не взаимодействует в значительной мере с мышиным β8. Как показано в примерах, серии 95 вовлекается в эпитоп (либо связывается напрямую, либо косвенным путем вовлекается в структуру эпитопа), поскольку замена серина на пролин по этому положению существенно препятствует связыванию. Антитело 6В9 не конкурирует за связывание с 37Е1В5, 11Е8 или 14Е5. К тому же, антитело 6В9 способно обнаруживать β8 на нефиксированных и фиксированных в формалине клетках и тканях и различать уровни экспрессии β8, например, на клетках, которые экспрессируют различные уровни β8 (см. Примеры и фиг. 6 и 8). Уровни экспрессии могут также служить индикатором числа геномных копий β8 в клетке и патогенеза.

Вариабельные области тяжелой и легкой цепи (с подчеркнутыми CDR) для антитела 6В9 приводятся ниже:

SEQ ID NO: 18 - вариабельная область тяжелой цепи для 6В9 (CDR 1-3 подчеркнуты; SEQ ID NO: 40-42, соответственно)

QVQLQQSGAELVRPGTSVKVSCKASGYAFTDYLIEWVKQRPGQGLEWIGVINPETGGTNYNAKFKGKATLTADKSSSSAYMQLSSLTSGDSAVYFCAREAGNYIYAMDYWGQGTSVTVSS

SEQ ID NO: 19 - вариабельная область легкой цепи для 6В9 (CDR 1-3 подчеркнуты; SEQ ID NO: 43-45, соответственно)

DIQMTQSPASLSASVGETVTITCRASVNIYSYLVWYQQKQGKSPQLLVHNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHHGTPYTFGGGTKLEIKR

Таким образом, предлагаются антитела, которые содержат участки CDR тяжелой цепи SEQ ID NO: 40, 41 и 42 и участки CDR легкой цепи SEQ ID NO: 43, 44 и 45. В некоторых вариантах осуществления изобретения антитела содержат SEQ ID NO: 18 вариабельной области тяжелой цепи и/или SEQ ID NO: 19 вариабельной области легкой цепи.

Как показано на фиг. 11А-В и 12-А-В, было выявлено аффинно-зрелое антитело 6 В9, обозначенное как 6B9Mut1. Примечательно, что это аффинно-зрелое антитело содержит изменение в CDR2 тяжелой цепи (VINPETGGTNYNAKFRG; SEQ ID NO: 46). Таким образом, в некоторых вариантах осуществления изобретения предлагаются антитела, которые содержат CDR тяжелой цепи SEQ ID NO: 40, 46 и 42 и CDR легкой цепи SEQ ID NO: 43,44 и 45.

6B9Mut1 также содержит изменение в FR1 легкой цепи

(DIVMTQSPASLSASVGETVTITC; SEQ ID NO: 47). В некоторых вариантах осуществления изобретения антитела содержат вариабельную область легкой цепи, содержащую SEQ ID NO: 47 (например, вариабельная область может содержать SEQ ID NO: 23), и необязательно вариабельную область тяжелой цепи, содержащую SEQ ID NO: 18.

Е. 4F1

Антитело 4F1 также связывает эпитоп на β8, включенный в аминокислоты 61-105 β8 (положения аминокислот по отношению к полноразмерной последовательности β8, приведенной в SEQ ID NO: 17), который не взаимодействует в значительной мере с мышиным β8. Как показано в примерах, серии 95 вовлекается в эпитоп, так как замена серина на пролин по этому положению существенно препятствует связыванию. Антитело 4F1 не конкурирует за связывание с 37Е1В5, 11Е8 или 14Е5. К тому же, антитело 4F1 способно обнаруживать β8 на нефиксированных и фиксированных в формалине клетках и тканях и различать уровни экспрессии β8, например, на клетках, которые экспрессируют различные уровни β8 (Примеры и фиг. 6, 7, 9 и 10). Уровни экспрессии могут также служить индикатором числа геномных копий β8 в клетке и патогенеза.

Вариабельные области тяжелой и легкой цепи (с подчеркнутыми CDR) для антитела 4F1 приводятся ниже:

SEQ ID NO: 20 - вариабельная область тяжелой цепи для 4F1 (CDR 1-3 подчеркнуты; SEQ ID NO: 116-118, соответственно)

QVQLQQSGAELWPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGTGGTNYNKKFKVKATLTADKSSSTAYMQLGGLTFDDSAVYFCAREGNARTYYYAMDYWGQGTSVTVSS

SEQ ID NO: 21 - вариабельная область легкой цепи для 4F1 (CDR 1-3 подчеркнуты; SEQ ID NO: 119-121, соответственно)

DIEMTQTPASLSASVGETVTITCRASENIYSYLVWYQQKQGKSPQVLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHNGTPYTFGGGTKLEIKR

Таким образом, предлагаются антитела, которые содержат участки CDR тяжелой цепи SEQ ID NO: 116, 117 и 118 и участки CDR легкой цепи SEQ ID NO: 119, 120 и 121. В некоторых вариантах осуществления изобретения антитела содержат вариабельную область тяжелой цепи последовательности SEQ ID NO: 20 и/или вариабельную область легкой цепи последовательности SEQ ID NO: 21.

F. Анти-αvβ8 антитела

Предлагаются антитела, которые специфически связываются с интегрином αvβ8, но не связываются в значительной мере с другими интегринами (например, αvβ6, αvβ3 и др.). Антитела по настоящему изобретению связываются со специфическим эпитопом или областью эпитопа в пределах αvβ8. Эпитоп может быть конформационным (нелинейным) или неконформационным эпитопом. Такое антитело может связываться только с β8, т.е. эпитоп локализуется в β8, или с нелинейным эпитопом, который включает части обеих субъединиц, или с эпитопом, который зависит от взаимодействия αv и β8. Антитела настоящего изобретения включают описанные выше специфичные к αvβ8 антитела, а также их гуманизированные, химерные и/или меченые версии и αvβ8-связывающие фрагменты и/или варианты.

В некоторых вариантах осуществления изобретения антитело связывается с β8 и ингибирует активацию TGF-β, например, в сравнении с активацией TGF-β в отсутствие антитела. В некоторых вариантах антитело не снижает адгезию αvβ8-экспрессирующих клеток к TGF-β, т.е. антитело не снижает αvβ8-опосредованную адгезию клеток к TGF-β. В некоторых вариантах антитело может снижать связывание растворимого αvβ8 с TGF-β по сравнению со связыванием αvβ8 в отсутствие антитела. В некоторых вариантах антитело может связываться с эпитопом на β8, который локализуется в пределах SEQ ID NO: 11. В некоторых вариантах эпитоп включает по меньшей мере одну аминокислоту, выбранную из аминокислот R79, I85, S95, P100, I108, P109, R128, Н140 и F179 человеческого β8. В некоторых вариантах эпитоп включает по меньшей мере одну аминокислоту, выбранную из аминокислот I74, N88, I107, Т110, I125, R175 и F180 человеческого β8. В некоторых вариантах эпитоп включает по меньшей мере одну аминокислоту, выбранную из аминокислот I125, R128, R175, F179 и F180 человеческого β8. В некоторых вариантах осуществления изобретения антитело связывает человеческий, но не мышиный, β8.

Сайт связывания, т.е. эпитоп, антитела, направленного против данного антигена, может определяться с помощью известных в данной области техники методов. Например, может проводиться конкурентный анализ (например, конкурентный ELISA) с использованием антитела с известным эпитопом. Если тестируемое антитело конкурирует за связывание с антигеном, то оно, по всей вероятности, разделяет по меньшей мере часть одного и того же эпитопа с другим антителом. Эпитоп может также локализоваться путем обмена доменами или селективного мутагенеза антигена. То есть каждая область или каждая аминокислота антигена может быть "обменена" или заменена на аминокислоту или компонент, о которых известно, что они не взаимодействуют с тестируемым антителом. Если замена данной области или аминокислоты снижает связывание тестируемого антитела с антигеном, несущим замену, по сравнению с антигеном без замены, то такая область или аминокислота, вероятно, будет вовлекаться в эпитоп.

В некоторых вариантах осуществления изобретения антитело является гуманизированным антителом 37Е1В5 с вариабельной областью тяжелой цепи, содержащей SEQ ID NO: 8, и вариабельной областью легкой цепи, содержащей SEQ ID NO: 9. Изотипом антитела может быть IgG1, IgG2, IgG2a, IgG3 или IgG4.

Описанные здесь антитела могут быть поликлональными или моноклональными. Поликлональные сыворотки как правило содержат смешанные популяции антител, специфически связывающихся с несколькими эпитопами по всей длине αvβ8. Однако поликлональные сыворотки могут быть специфичными к конкретному сегменту ανβ8. В некоторых вариантах осуществления изобретения антитело является химерным, гуманизированным (см. Queen et al, Proc. Natl. Acad. Sci. USA 86:10029-10033 (1989) и WO 90/07861, US 5693762, US 5693761, US 5585089, US 5530101 и Winter, US 5225539) или человеческим антителом (Lonberg et al, WO 93/12227 (1993); US 5877397, US 5874299, US 5814318, US 5789650, US 5770429, US 5661016, US 5633425, US 5625126, US 5569825, US 5545806, Nature 148, 1547-1553 (1994), Nature Biotechnology 14, 826 (1996), Kucherlapati, WO 91/10741 (1991) EP 1481008, Bleck, Bioprocessing Journal 1 (Sept/Oct. 2005), US 2004132066, US 2005008625, WO 2004072266, WO 2005065348, WO 2005069970 и WO 2006055778. В некоторых вариантах осуществления изобретения антитела представляют собой гуманизированные или химерные формы 37Е1В5, 11Е8 или 14Е5. Для гуманизированных или химерных антител может использоваться человеческий изотип IgG1, IgG2, IgG3 или IgG4. Некоторые антитела специфически связываются с αvβ8 с аффинностью связывания, превышающей или равной примерно 107, 108, 109, 1010, 1011 или 1012 М-1 (например, с Кд (константой диссоциации) в микромолярном (10-6), наномолярном (10-9), пикомолярном (10-12) или меньшем диапазоне).

G. Обнаружение активности TGF-β и влияние анти-αvβ8 антител

Для определения влияния антитела на активность TGF-β существует ряд биоанализов TGF-β. Например, активация TGF-β может тестироваться анализом в совместной культуре (сокультуре). Тестируемые клетки, экспрессирующие αvβ8, совместно культивируются с TMLC-клетками, т.е. с эпителиальными клетками легких норки, стабильно трансфицированными фрагментом чувствительного к TGF-β промотора, контролирующего ген люциферазы (Abe et al. (1994) Annal Biochem 216:276). TMLC-клетки высокочувствительны к TGF-β с очень низким фоном TGFβ-активации. Поэтому TMLC-клетки могут использоваться в сокультуре с другими клеточными линиями или не содержащими клеток фракциями для обнаружения присутствия активного TGF-β с применением люминесценции для индикации показаний. Анализы могут проводиться в присутствии или в отсутствие анти-TGFβ-блокирующего антитела (10 мкг/мл, 1D11; R&D Systems), анти-β8 (20 мкг/мл, 37Е1В5) или анти-β6 (150 мкг/мл, 10D5), как описано в (Abe (1994); Munger (1999)).

Для измерения активного TGF-β в опухолевой ткани равные навески опухолевой ткани можно измельчить и инкубировать в стерильной питательной среде DME в течение 30 мин при 4°C. Супернатанты, содержащие активный TGF-β, можно собрать после центрифугирования (20g) при 4°C. Осадки от центрифугирования можно инкубировать в бессывороточной питательной среде DME в течение 20 мин при 80°C для активации SLC (вторичный лимфоидный хемокин), после чего можно собрать супернатанты. Затем супернатанты, содержащие активный или активированный нагревом (латентный) TGF-β, добавляют к предварительно высеянным на чашки TMLC-клеткам с или без 1D11. Для анализа ингибиторов протеазы ингибиторы добавляют в самом начале совместного культивирования клеток. Максимальная доза каждого ингибитора определяется как наиболее высокая концентрация, которая не ингибирует способность TMLC-клеток реагировать на рекомбинантный активный TGF-β. Для измерения активности растворимого TGF-β из культивированных клеток, клетки инкубируют в 100 мкл полной среды с или без 37Е1 или 10D5 в течение 1 ч при 37°C в условиях щадящего вращения. Не содержащие клеток супернатанты собирают центрифугированием (20g) в течение 5 мин при 4°C и добавляют к предварительно высеянным на чашки TMLC-клеткам в присутствии или в отсутствие 1D11. Для анализов растворимых рецепторов используют кондиционированную среду, полученную из ночных культур клеток. Относительные единицы люциферазы определяются как активность минус фоновая активность репортерных TMLC-клеток.

IV. Способы создания антител

Для получения и применения подходящих антител, как описанные здесь, например, рекомбинантных, моноклональных или поликлональных антител могут использоваться многочисленные способы, известные в данной области техники (см., например, Kohler & Milstein, Nature 256:495-497 (1975); Kozbor et al., Immunology Today 4: 72 (1983); Cole et al., pp. 77-96 in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. (1985); Coligan, Current Protocols in Immunology (1991); Harlow & Lane, Antibodies, A Laboratory Manual (1988); и Goding, Monoclonal Antibodies: Principles and Practice (2d ed. 1986)). Гены, кодирующие тяжелые и легкие цепи представляющего интерес антитела, могут клонироваться из клетки, например, гены, кодирующие моноклональное антитело, могут клонироваться из гибридомы и использоваться для продуцирования рекомбинантного моноклонального антитела. Библиотеки генов, кодирующих тяжелые и легкие цепи моноклональных антител, также могут быть получены из гибридомы или клеток плазмы. Произвольные комбинации продуктов генов тяжелых и легких цепей генерируют обширный пул антител с различной антигенной специфичностью (см., например, Kuby, Immunology (3rd ed. 1997)). Способы получения одноцепочечных антител или рекомбинантных антител (патент США №4946778, патент США №4816567) могут адаптироваться к получению антител к полипептидам настоящего изобретения. Так, трансгенные мыши или другие организмы, например, другие млекопитающие, могут использоваться для экспрессирования гуманизированных или человеческих антител (см., например, патенты США №№5545807; 5545806; 5569825; 5625126; 5633425; 5661016, Marks et al., Bio/Technology 10:779-783 (1992); Lonberg et al, Nature 368:856-859 (1994); Morrison, Nature 368:812-13 (1994); Fishwild et al., Nature Biotechnology 14:845-51 (1996); Neuberger, Nature Biotechnology 14:826 (1996); и Lonberg & Huszar, Intern. Rev. Immunol. 13:65-93 (1995)). Альтернативно, для идентификации антител и гетеромерных Fab-фрагментов, которые специфически связываются с селективными антигенами, может применяться технология фагового дисплея (см., например, McCafferty et al., Nature 348:552-554 (1990); Marks et al., Biotechnology 10:779-783 (1992)). Могут быть получены также биспецифические антитела, т.е. способные распознавать два разных антигена (см., например, WO 93/08829, Traunecker et al., EMBO J. 10:3655-3659 (1991); и Suresh et al., Methods in Enzymology 121:210 (1986)). Антитела могут также представлять собой гетероконъюгаты, например, два ковалентно связанных антитела или иммунотоксина (см., например, патент США №4676980, WO 91/00360, WO 92/200373 и ЕР 03089).

Антитела могут быть получены с использованием ряда систем экспрессии, включая системы экспрессии на основе прокариотических и эукариотических клеток. В некоторых вариантах осуществления изобретения система экспрессии является системой экспрессии на основе клеток млекопитающих, таких как гибридома, или системой экспрессии на основе СНО-клеток (клеток яичников китайского хомячка). Многие такие системы широко доступны от коммерческих поставщиков. В вариантах осуществления изобретения, в которых антитело содержит и VH-, и VL-область, эти VH- и VL-области могут экспрессироваться с помощью одного вектора, например, в дицистронной экспрессионной единице или под контролем различных промоторов. В других вариантах VH- и VL-области могут экспрессироваться с помощью разных векторов. VH- или VL-области, описанные здесь, необязательно могут содержать метионин на N-конце.

Антитело, описанное здесь, может также продуцироваться в разных форматах, включая Fab, Fab', F(ab')2, scFv или dAB. Фрагменты антитела могут быть получены множеством способов, включающих расщепление интактного антитела ферментом, таким как пепсин (для получения F(ab')2-фрагментов) или папаин (для получения Fab-фрагментов), либо синтез de novo. Фрагменты антитела могут быть синтезированы также с применением метода рекомбинантных ДНК. В некоторых вариантах осуществления изобретения анти-β8 антитело содержит F(ab')2-фрагменты, которые специфически связывают β8. Антитело по изобретению может также включать константную область антитела человека. См., например, Fundamental Immunology (Paul ed., 4d ed. 1999); Bird, et al., Science 242:423 (1988); и Huston, et al., Proc. Natl Acad. Sci. USA 85:5879 (1988).

Методы гуманизации или приматизации антител, не принадлежащих человеку, также известны в данной области техники. В большинстве случаев гуманизированное антитело содержит один или более аминокислотных остатков, интродуцированных в него из источника, который не является человеком. Эти аминокислотные остатки, происходящие не от человека, часто называют импортными остатками, которые в типичных случаях берутся из импортного вариабельного домена. Гуманизация может проводиться в основном по методу Winter et al. (см., например, Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988) и Presta, Curr. Op. Struct. Biol. 2:593-596 (1992)) с заменой CDR или последовательностей CDR грызунов соответствующими последовательностями человеческого антитела. Такие гуманизированные антитела являются химерными антителами (патент США №4816567), в которых вариабельный домен, значительно меньший чем интактный человеческий, заменен на соответствующую последовательность от вида, не являющегося человеком. На практике гуманизированные антитела представляют собой в типичных случаях человеческие антитела, в которых некоторые остатки CDR и возможно некоторые остатки FR заменены остатками с аналогичных сайтов в антителах грызунов.

В некоторых случаях антитело или фрагмент антитела может конъюгироваться с другой молекулой, например, полиэтиленгликолем (ПЭГилирование) или сывороточным альбумином для достижения пролонгированной полужизни in vivo. Примеры ПЭГилирования фрагментов антител приводятся в Knight et al. Platelets 15:409, 2004 (для abciximab); Pedley et al., Br. J. Cancer 70:1126, 1994 (для анти-СЕА антитела); Chapman et al., Nature Biotech. 17:780, 1999; и Humphreys, et al., Protein Eng. Des. 20: 227, 2007). Антитело или фрагмент антитела может также метиться или конъюгироваться с терапевтическим агентом, как описывается ниже.

Специфичность связывания антитела может определяться в рамках сравнительных констант диссоциации (Кд) антитела к мишени (например, β8) по сравнению с константой диссоциации антитела и других материалов в окружающей среде или вообще к не имеющим никакого отношения молекулам. В типичных случаях Кд антитела по отношению к несвязанному материалу будет по меньшей мере в 2, 3, 4, 5, 10, 20, 50, 100, 200 или более раз выше, чем Кд по отношению к мишени.

Желательная аффинность антитела, например, высокая (от пикомолярных (пМ) до низких наномолярных (нМ) значений), средняя (от низких нМ до 100 нМ) или низкая (около 100 нМ или выше) может быть различной в зависимости от того, используется ли это антитело как диагностическое или как терапевтическое. Например, антитело со средней аффинностью может быть более успешным для локализации в желательной ткани по сравнению с антителом с высокой аффинностью. Следовательно, антитела, имеющие разные аффинности, могут использоваться для диагностических и терапевтических целей.

Целевой фрагмент в типичных случаях связывается с Кд менее примерно 1000 нМ, например, менее 250, 100, 50, 20 или еще менее нМ. В некоторых вариантах осуществления изобретения Кд аффинного агента составляет менее 15, 10, 5 или 1 нМ. В некоторых вариантах Кд составляет от 1 до 100 нМ, от 0,1 до 50 нМ, от 0,1 до 10 нМ или от 1 до 20 нМ. Величина константы диссоциации (Кд) может определяться хорошо известными методами и может вычисляться даже для сложных смесей методами, раскрытыми, например, в Caceci et al., Byte (1984) 9:340-362.

Аффинность антитела (или любого целевого агента) к мишени может определяться методами, известными в данной области техники, например, методами, описанными в обзоре Ernst et al. Determination of Equilibrium Dissociation Constants, Therapeutic Monoclonal Antibodies (Wiley & Sons ed. 2009).

Могут использоваться количественный ELISA и подобные методы определения аффинности на основе чипов. ELISA (иммуносорбентный сигнальный анализ со связанным ферментом) является методом на основе антител. В некоторых случаях антитело, специфичное к представляющей интерес мишени, связывается с субстратом и контактирует с образцом, предположительно содержащим мишень. Затем поверхность промывается для удаления несвязанных веществ. Детекция связывания мишени может осуществляться различными путями, например, путем проведения второй стадии с меченым антителом, прямого мечения мишени или мечения первичного антитела меткой, обнаруживаемой при связывании антигена. В некоторых случаях антиген связывается с субстратом (например, с субстратом с высокой аффинностью к белкам или взаимодействием стрепавидин - биотин) и детектируется с использованием меченого антитела (или другого целевого фрагмента). Разработано несколько модификаций оригинальных методов ELISA и все они известны в данной области техники (см. обзор Lequin (2005) Clin. Chem. 51:2415-18).

Кд, Kon и Koff могут также определяться с применением поверхностного плазмонного резонанса (SPR), например, путем измерения с помощью системы Biacore Т100. Обзор SPR-методов см., например, в Hahnfeld et al. Determination of Kinetic Data Using SPR Biosensors, Molecular Diagnosis of Infectious Diseases (2004). В типичном эксперименте SPR один участник взаимодействия (мишень или целевой агент) иммобилизуется на SPR-активном, покрытом слоем золота предметном стекле в проточной кювете, затем вводится образец, содержащий второго участника взаимодействия, таким образом, чтобы он растекался по поверхности. При падении света заданной частоты на поверхность изменения оптической отражательной способности золота будут указывать на связывание и кинетику связывания.

Аффинность связывания может также определяться путем фиксации биотинилированного участника взаимодействия на стрептавиденовом (SA) сенсорном чипе. Другой участник взаимодействия контактирует с чипом и детектируется, например, как описано в Abdessamad et al. (2002) Nuc. Acids Res. 30:e45.

V. Фармацевтические композиции и их применение

Описанные здесь анти-αvβ8 антитела (включая их αvβ8-связывающие фрагменты, меченые антитела, иммуноконъюгаты, фармацевтические композиции и др.) могут применяться для выявления, лечения, облегчения или предупреждения хронической обструктивной болезни легких (COPD) и астмы.

Описанные здесь анти-αvβ8 антитела (включая их αvβ8-связывающие фрагменты, меченые антитела, иммуноконъюгаты, фармацевтические композиции и др.) могут применяться для выявления, лечения, облегчения или предупреждения воспалительного заболевания кишечника.

Описанные здесь анти-αvβ8 антитела (включая их αvβ8-связывающие фрагменты, меченые антитела, иммуноконъюгаты, фармацевтические композиции и др.) могут применяться для выявления, лечения, облегчения или предупреждения воспалительного аутоиммунного заболевания головного мозга, рассеянного склероза, демиелинизирующего заболевания (например, поперечного миелита, болезни Девика, синдрома Гийена-Барре), нейровоспаления, болезни почек или глиомы.

Описанные здесь анти-αvβ8 антитела (включая их αvβ8-связывающие фрагменты, меченые антитела, иммуноконъюгаты, фармацевтические композиции и др.) могут применяться для выявления, лечения, облегчения или предупреждения артрита.

Описанные здесь анти-αvβ8 антитела (включая их αvβ8-связывающие фрагменты, меченые антитела, иммуноконъюгаты, фармацевтические композиции и др.) могут применяться для выявления, лечения, облегчения или предупреждения различных фиброзных заболеваний, таких как фиброз дыхательных путей, идиопатический фиброз легких, неспецифическая интерстициальная пневмония, постинфекционный фиброз легких, диффузное альвеолярное поражение, коллагеново-сосудистая болезнь, ассоциированная с фиброзом легких, лекарственно-обусловленный фиброз легких, силикоз, асбестово-обусловленный фиброз легких, респираторный бронхиолит, респираторный бронхиолит, ассоциированный с интерстициальной болезнью легких, десквамативный интерстициальный фиброз, криптогенная организующаяся пневмония, хроническая гиперчувствительная пневмония, лекарственно-обусловленный фиброз легких или печени, ренальный фиброз (фиброз почек) и фиброз печени (например, индуцированный алкоголем, употреблением лекарств, стеатогепатитом, вирусной инфекцией (например, гепатитом B или C), холестазом и др.).

Описанные здесь анти-αvβ8 антитела (включая их олф8-связывающие фрагменты, меченые антитела, иммуноконъюгаты, фармацевтические композиции и др.) могут применяться для выявления, лечения, облегчения симптомов или предупреждения аденокарциномы, сквамозной карциномы, карциномы молочной железы и роста и метастазирования рака.

Специалисту в данной области понятно, что природа фармацевтической композиции и способ ее введения частично зависят от состояния, на которое направлено лечение.

Композиции, предназначенные для перорального приема, могут состоять из (а) жидких растворов, таких как эффективное количество упакованной нуклеиновой кислоты, суспендированной в разбавителях, таких как вода, физиологический раствор или PEG 400; (б) капсул, саше или таблеток, каждая из которых содержит предопределенное количество активного ингредиента в виде жидкостей, порошков, гранул или желатина; (в) суспензий в соответствующей жидкости и (г) пригодных для данной цели эмульсий. Таблеточные формы могут включать одно или более из лактозы, сахарозы, маннитола, сорбитола, фосфатов кальция, кукурузного крахмала, картофельного крахмала, микрокристаллической целлюлозы, желатина, коллоидного диоксида кремния, талька, стеарата магния, стеариновой кислоты и других вспомогательных веществ - красителей, наполнителей, связующих веществ, разбавителей, буферных агентов, увлажнителей, консервантов, ароматизаторов, красящих веществ, дезинтеграторов и фармацевтически приемлемых носителей. Формы в виде пастилок для рассасывания могут содержать активный ингредиент во вкусо-ароматическом компоненте, например, сахарозе, а также пастилки, содержащие активный ингредиент в инертной основе, такой как желатин и глицерин или эмульсии сахарозы и камеди акации, гели и подобные формы, содержащие носители в дополнение к активному ингредиенту, известны в данной области техники.

Фармацевтическая композиция, содержащая описанное здесь антитело (или его αvβ8-связывающий фрагмент), может вводиться отдельно или в комбинации с другими подходящими компонентами и может изготовляться в форме аэрозольных составов ("распыляемых"), подлежащих употреблению в виде ингаляций. Аэрозольные составы могут помещаться в приемлемые сжатые пропелланты, такие как дихлордифторметан, пропан, азот и др.

Композиции, пригодные для ректального применения, включают, например, суппозитории, которые состоят из упакованной нуклеиновой кислоты с суппозиторной основой. Подходящие суппозиторные основы включают природные или синтетические триглицериды или парафиновые углеводороды. Дополнительно могут использоваться также желатиновые ректальные капсулы, которые состоят из комбинации выбранного соединения с основой, включающей, например, жидкие триглицериды, полиэтиленгликоли и парафиновые углеводороды.

Композиции, пригодные для парентерального введения, такие как, например, для внутрисуставного (в суставы), внутривенного, внутримышечного, внутриопухолевого, внутрикожного, внутрибрюшинного и подкожного введения, включают водные и неводные, изотонические стерильные инъекционные растворы, которые могут содержать антиоксиданты, буферы, бактериостаты и растворенные вещества, делающие композицию изотонической с кровью предполагаемого реципиента, и водные и неводные стерильные суспензии, которые могут содержать агенты, облегчающие суспендирование, солюбилизаторы, загустители, стабилизаторы и консерванты. В практике настоящего изобретения композиции могут применяться, например, для внутривенной инфузии, перорального приема, для местного, внутрибрюшинного, внутривезикального или внутриоболочечного введения. Антитела в типичных случаях вводятся парентерально или внутривенно. Композиции соединений могут быть представлены в герметичных контейнерах, таких как ампулы или флаконы, рассчитанных на одну дозу или несколько доз.

Растворы и суспензии для инъекций могут приготовляться из стерильных порошков, гранул и таблеток ранее описанных видов. Методы приготовления парентерально вводимых композиций известны или очевидны специалистам в данной области и более подробно описаны в таких публикациях, как Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980).

Композиции для введения в типичных случаях содержат описанное здесь антитело (например, анти-αvβ8 антитело или его αvβ8-связьшающий фрагмент либо иммуноконъюгат), растворенное в фармацевтически приемлемом носителе, например, в водном носителе. Может использоваться множество носителей, например, буферный солевой раствор. Эти растворы являются стерильными и в большинстве случаев не содержат нежелательных веществ. Указанные композиции могут стерилизоваться традиционными, хорошо известными способами стерилизации. Композиции могут содержать фармацевтически приемлемые вспомогательные вещества, требующиеся для приближения к физиологическим условиям, такие как pH-регулирующие и буферизующие агенты, например, ацетат натрия, хлорид натрия, хлорид калия, хлорид кальция, лактат натрия и др. Концентрация активного агента в этих композициях может варьировать в широких пределах и может выбираться, в первую очередь, с учетом объема жидкости, вязкости, массы тела и т.п. в соответствии с конкретным выбранным методом введения и нуждами пациента.

Композиция может также содержать дополнительные активные соединения, включая хемотерапевтические агенты, цитотоксические агенты, цитокины, ингибиторы роста и антигормональные агенты. Активные ингредиенты могут изготовляться в виде препаратов пролонгированного действия (например, полупроницаемые матрицы твердых гидрофобных полимеров (например, полиэфиры, гидрогели (например, поли(2-гидроксиэтилметакрилат) или поли(виниловый спирт)), полилактиды. Антитела и иммуноконъюгаты могут заключаться в микрокапсулы, изготовленные, например, техникой коацервации или полимеризацией на границе раздела фаз, например, гидроксиметилцеллюлозные или желатиновые микрокапсулы и поли(метилметакрилат)ные микрокапсулы, соответственно, в коллоидных системах доставки лекарственного средства к месту его действия (например, липосомы, микросферы альбумина, микроэмульсии, наночастицы и нанокапсулы), или в макроэмульсии.

VI. Диагностические композиции и их применение

Интегрин αvβ8 экспрессируется на фибробластах, стеллатных клетках, хондроцитах, активированных макрофагах и подгруппах Т- и В-клеток. Экспрессия интегрина αvβ8 повышается в фибробластах при COPD и фиброзе легких и может использоваться в качестве суррогатного маркера увеличенной массы фибробластных клеток. Поэтому описанные в настоящем документе антитела могут широко применяться в стратегиях получения биоизображений для выявления фибровоспалительных процессов. Описанные в настоящем документе терапевтические и диагностические антитела могут использоваться при воспалительном заболевании кишечника (IBD), хронической обструктивной болезни легких (COPD), астме, артрите, фибровоспалительном нарушении печени, при индуцированном алкоголем поражении печени, неалкогольном стеатогепатите (NASH), вирусном гепатите и первичном билиарном циррозе печени (РВС), при отторжении трансплантата после пересадки печени, аутоиммунном гепатите, аутоиммунном нарушении, красной волчанке, склеродермии, дерматомиозите, буллезном пемфигоиде, вульгарном пемфигоиде, фиброзе легких, воспалительном аутоиммунном заболевании головного мозга, рассеянном склерозе, демиелинизирующем заболевании, нейровоспалении, болезни почек, гломерулонефрите, гепатоцеллюларной карциноме (НСС), аденокарциноме, сквамозной карциноме, глиоме, меланоме, простате, карциномах яичников, матки или молочной железы.

Как объяснялось выше, описанные здесь анти-αvβ8 антитела (включая их αvβ8-связывающие фрагменты, аффинно-зрелые варианты и варианты антител меньше 50 либо 25 кДа или scFv) могут применяться для диагностики либо in vivo, либо in vitro (например, с использованием биологического образца, полученного от индивидуума). Антитело в типичных случаях конъюгируется или иным образом связывается с детектируемой меткой. Связь может быть прямой, например, ковалентной связью или косвенной, например, с помощью вторичного связывающего агента, хелатора или линкера.

Меченое антитело может вводиться индивидууму с целью определения применимости предполагаемого лечения. Например, меченое антитело может использоваться для обнаружения плотности интегрина β8 в пораженной области. Для терапии, нацеленной на активность TGF-β или αvβ8 (снижение активности TGFβ или αvβ8), плотность β8 в типичных случаях является высокой относительно непораженной ткани. Меченое антитело может также указывать на то, что пораженная область доступна для лечения. Поэтому пациенты для лечения могут подбираться на основании результатов получения изображений. Анатомическая характеристика, в частности, определяющая точные границы рака, может выполняться с помощью стандартных методов получения изображений (например, компьютерно-томографического (СТ) сканирования, магнитно-резонансной томографии (MRI), позитронно-эмиссионного томографического (PET) сканирования и др.). Такие методы могут проводиться in vivo с использованием любых из описанных здесь антител. В некоторых вариантах осуществления изобретения используется меченое антитело 14Е5, поскольку оно не влияет на уровни TGF-β.

Любое из описанных здесь антител также может использоваться для in vitro методов диагностики или мониторинга, например, с применением клеток или ткани из образца от пациента. В некоторых вариантах осуществления изобретения используется меченое антитело 11Е8 (или его β8-связывающий фрагмент либо аффинно-зрелый вариант), поскольку оно способно связывать фиксированные клетки, а также нефиксированные клетки. В некоторых вариантах используется меченое антитело 6В9 (или его β8-связывающий фрагмент либо аффинно-зрелый вариант), поскольку оно способно связывать фиксированные клетки, а также нефиксированные клетки, и не конкурирует за связывание β8 с терапевтическими антителами, такими как 11Е8, 37Е1 или 37Е1В5. В некоторых вариантах осуществления изобретения используется меченое антитело 4F1 (или его β8-связывающий фрагмент либо аффинно-зрелый вариант), поскольку оно способно связывать фиксированные клетки, а также нефиксированные клетки, и не конкурирует за связывание β8 с терапевтическими антителами, такими как 11Е8, 37Е1 или 37Е1В5.

В некоторых вариантах осуществления изобретения диагностическое антитело представляет собой одноцепочечный вариабельный фрагмент (scFv). Интактные антитела (например, IgG) могут использоваться для радиоиммунотерапии или целенаправленной доставки терапевтических агентов, так как эти антитела демонстрируют высокое поглощение и способность к удержанию. В некоторых случаях устойчивость циркуляции интактного mAbs может приводить к высокому уровню фона (Olafsen et al. (2012) Tumour Biol. 33:669-77; Cai et al. (2007) J Nucl Med. 48:304-10). ScFv (в типичных случаях с молекулярной массой ~25 кДа) быстро экскретируется почками, но является моновалентным и может обладать пониженной аффинностью. Проблема моновалентности может быть решена с помощью современной инженерии антител (как показано в настоящем документе), благодаря которой можно улучшить аффинность от низких значений наномолярного (нМ) диапазона до значений пикомолярного (пМ) диапазона. Такие антитела имеют достаточно короткий период полужизни, чтобы быть полезными в качестве визуализирующих агентов, и показывают характеристики связывания, подходящие для нацеливания на ткани (Cortez-Retamozo et al. (2004) Cancer Res. 64:2853-7). Как показано здесь, авторами изобретения создан ряд производных антитела scFV с очень высокой аффинностью - 4F1, 6В9 и 14Е5, которые можно превратить в платформы для гуманизированных scFv. Эти улучшенные антитела не блокируют функцию и поэтому могут использоваться в комбинации с терапевтическим агентом, который воздействует на β8.

Диагностический агент, содержащий описанное здесь антитело, может включать любой диагностический агент, известный в данной области техники, как указано, например, в следующих ссылках: Armstrong et al., Diagnostic Imaging, 5th Ed., Blackwell Publishing (2004); Torchilin, V.P., Ed., Targeted Delivery of Imaging Agents, CRC Press (1995); Vallabhajosula, S., Molecular Imaging: Radiopharmaceuticals for PET and SPECT, Springer (2009). Термины "детектируемый агент", "детектируемый фрагмент", "метка", "визуализирующий агент" и подобные термины употребляются в описании синонимично. Диагностический агент может быть детектирован множеством способов, в том числе и как агент, обеспечивающий и/или усиливающий детектируемый сигнал. Детектируемые сигналы включают, но не ограничиваются, гамма-излучающий, радиоактивный, эхогенный, оптический, флуоресцентный сигналы, сигнал поглощения, магнитный или томографический сигналы. Методы визуализации диагностического агента могут включать, но не ограничиваться, однофотонную эмиссионную компьютерную томографию (SPECT), магнитно-резонансную томографию (MRI), оптическую томографию, позитронно-эмиссионную томографию (PET), компьютерную томографию (СТ), рентгенографию, гамма-томографию и т.п. PET является особенно чувствительной и количественной и поэтому чрезвычайно важна для характеристики фибротических процессов in vivo (Olafsen et al. (2012) Tumour Biol. 33:669-77; Cai et al. (2007) J Nucl Med. 48:304-10). Она выходит за рамки сопутствующей диагностики (companion diagnostics) и в большинстве случаев полезна для диагностики, клинической стадии и наблюдения пациентов с фибротическими процессами при любом режиме лечения.

В описанные здесь диагностические агенты могут вводиться радиоизотопы, и они могут включать радионуклиды, которые испускают гамма-лучи, позитроны, бета- и альфа-частицы и рентгеновские лучи. Подходящие радионуклиды включают, но не ограничиваются, 225Ас, 72As, 211At, 11В, 128Ba, 212Bi, 75Br, 77Br, 14C, 109Cd, 62Cu, 64Cu, 67Cu, 18F, 67Ga, 68Ga, 3H, 166Ho, 123I, 124I, 125I, 130I, 131I, 111In, 177Lu, 13N, 15O, 32P, 33P, 212Pb, 103Pd, 186Re, 188Re, 47Sc, 153Sm, 89Sr, 99mTc, 88Y и 90Y. В некоторых вариантах осуществления изобретения радиоактивные агенты могут включать 111In-DTPA, 99mTc(CO)3-DTPA, 99mTc(CO)3-ENPy2, 62/64/67Cu-TETA, 99mTc(СО)3-IDA и 99mTc(СО)3триамины (циклические или линейные). В других вариантах агенты могут включать DOTA и его различные аналоги с 111In, 177Lu, 153Sm, 88/90Y, 62/64/67Cu или 67/68Ga. В некоторых вариантах наночастица может метиться путем введения липидов, прикрепленных к хелатам, например, DTPA-липида, как описано в следующих ссылках: Phillips et al., Wiley Interdisciplinary Reviews: Nanomedicine and Nanobiotechnology, 1(1): 69-83 (2008); Torchilin, V.P. & Weissig, V., Eds. Liposomes 2nd Ed.: Oxford Univ. Press (2003); Elbayoumi, T.A. & Torchilin, V.P., Eur. J. Nucl. Med. Mol Imaging 33:1196-1205 (2006); Mougin-Degraef, M. et al, Int'l J. Pharmaceutics 344:110-117 (2007).

В некоторых вариантах осуществления изобретения диагностический агент может включать хелаторы, которые связываются, например, с ионами металлов, используемыми в различных методах диагностической визуализации. Примеры хелаторов включают, но не ограничиваются, этилендиаминтетрауксусную кислоту (EDTA), [4-(1,4,8,11-тетраазациклотетрадек-1-ил)метил]бензойную кислоту (СРТА), циклогександиаминтетрауксусную кислоту (CDTA), этилен-бис(оксиэтиленнитрило)тетрауксусную кислоту (EGTA), диэтилентриаминпентауксусную кислоту (DTPA), лимонную кислоту, гидроксиэтил-этилендиаминтриуксусную кислоту (HEDTA), иминодиуксусную кислоту (IDA), триэтилентетраамингексауксусную кислоту (ТТНА), 1,4,7,10-тетраазациклододекан-тетра(метиленфосфоновую кислоту) (DOTP), 1,4,8,11-тетраазациклотетрадекан-тетрауксусную кислоту (TETA), 1,4,7,10-тетраазациклододекан-1,4,7,10-тетрауксусную кислоту (DOTA), N1,N1-бис(пиридин-2-ил-метил)этан-1,2-диамин (ENPy2) и их производные.

В некоторых вариантах осуществления изобретения диагностический агент может сочетаться с вторичным лигандом связывания или с ферментом (ферментной меткой), что дает окрашенный продукт при контакте с хромогенным субстратом. Примеры подходящих ферментов включают уреазу, щелочную фосфатазу, гидрогенпероксидазу (корня хрена) и глюкозооксидазу. Вторичные лиганды связывания включают, например, соединения биотин и авидин или стрептавидин, известные в данной области техники.

В некоторых вариантах осуществления изобретения диагностические агенты могут включать оптические агенты, такие как флуоресцентные агенты, фосфоресцентные агенты, хемилюминесцентные агенты и т.п. Многочисленные агенты (например, красители, зонды, метки или индикаторы) известны в данной области техники и могут использоваться в настоящем изобретении. (См., например, Invitrogen, The Handbook - А Guide to Fluorescent Probes and Labeling Technologies, Tenth Edition (2005)). Флуоресцентные агенты могут включать различные органические и/или неорганические мелкие молекулы или различные флуоресцентные белки и их производные. Например, флуоресцентные агенты могут включать, но не ограничиваться, цианины, фталоцианины, порфирины, индоцианины, родамины, феноксазины, фенилксантены, фенотиазины, феноселеназины, флуоресцеины, бензопорфирины, сквараины, дипирролопиримидоны, тетрацены, хинолины, пиразины, коррины, крокониевые красители, акридоны, фенантридины, родамины, акридины, антрахиноны, аналоги халькогенопирилия, хлорины, нафталоцианины, метановые красители, индолениевые красители, азосоединения, азулены, азаазулены, трифенилметановые красители, индолы, бензоиндолы, индокарбоцианины, бензоиндокарбоцианины и BODIPY™-производные.

VII. Способы лечения

Описанные здесь анти-αvβ8 антитела и их αvβ8-связьюающие фрагменты или иммуноконъюгаты могут вводиться индивидууму известными методами, такими как внутривенное введение, например, в виде болюса или в виде непрерывной инфузии в течение определенного периода времени, внутримышечно, внутрибрюшинно, интрацереброспинально, подкожно, внутрисуставно, интрасиновиально, интратекально, перорально, местно (например, чрескожно) или введение путем ингаляции. Введение может быть локальным или системным.

Композиции могут вводиться для терапевтического или профилактического лечения. При терапевтическом применении композиции вводятся пациенту, страдающему заболеванием (например, IBD, раком, фиброзом (легких или печени), COPD, астмой, артритом и др.), в "терапевтически эффективной дозе". Количества, эффективные для такого применения, зависят от заболевания, от которого лечится пациент, метода введения композиций, тяжести состояния и общего состояния здоровья пациента. Может проводиться однократное или многократное введение композиций в зависимости от дозировки и частоты применения, которые требуются и хорошо переносятся пациентом. Описанные здесь композиции могут вводиться человеку и другим животным, в частности, млекопитающим. Поэтому методы введения применимы и к терапии человека, и к ветеринарии. Другие известные методы терапии рака могут применяться в комбинации со способами изобретения. Например, композиции для применения согласно изобретению могут использоваться также для выявления клетки-мишени или придания ей чувствительности к другим терапевтическим агентам против рака, таким как 5FU, винбластин, актиномицин D, цисплатин, метотрексат и др. Описанные здесь композиции могут также комбинироваться с радиотерапией или иммунотерапией, а также с иными разрабатывающимися в данный момент способами лечения.

Комбинированная терапия рассчитана на совместное введение (прием) отдельных композиций или единичной фармацевтической композиции и последовательное введение их в любом порядке.

Для определения терапевтически эффективной дозы сначала можно ввести индивидууму малую дозу анти-αvβ8 антитела (или его αvβ8-связывающего фрагмента либо иммуноконъюгата), а затем можно постепенно увеличивать эту дозу до тех пор, пока состояние индивидуума не начнет улучшаться. Например, начальная суточная доза может составлять примерно от 0,001 мг/кг до 1 мг/кг. Диапазоны суточной дозы примерно от 0,01 мг/кг до 500 мг/кг или примерно от 0,1 мг/кг до 200 мг/кг, или примерно от 1 мг/кг до 100 мг/кг, или примерно от 10 мг/кг до 50 мг/кг могут применяться в последующие временные промежутки, если состояние индивидуума не изменилось при минимальной дозе. Как отмечалось выше, специалисту в данной области понятно, что при определении терапевтически эффективной дозы следует учитывать ряд переменных параметров. Доза, вводимая пациенту, должна быть достаточной для достижения со временем положительной ответной реакции у пациента на метод лечения. Размер дозы будет определяться также наличием, природой и степенью проявления вредных побочных эффектов, которые сопровождают введение конкретной композиции (или комбинированной терапии) конкретному пациенту.

VIII. Примеры

A. Пример 1. Антитело 37Е1В5

Последовательности V-области тяжелых и легких цепей антител 37Е1, 37Е1В5 и гуманизированного антитела 37Е1В5 (h37E1B5 или Hu37E1B5) представлены на фиг. 1. Указаны каркасные и CDR области. Гуманизированное антитело 37Е1В5 сохраняет высокую аффинность и активность антитела 37Е1В5.

В in vitro культуре 37Е1 при концентрации примерно 200 мкг/мл ингибирует высвобождение активного зрелого TGFβ-пептида. Как объяснялось выше, 37Е1В5 показывает намного более высокую аффинность и активно в пикомолярном диапазоне. 37Е1В5 при 10 мкг/мл чрезвычайно эффективно в ингибировании высвобождения активного зрелого TGFβ-пептида в in vitro культуре.

B. Пример 2. Получения антител 11Е8 и 14Е5

Антитела 11Е8 и 14Е5 продуцировались в гибридомных клетках, созданных путем слияния миеломных клеток SP2/0 с лимфоцитами от специфически иммунизированных мышей. Мышей иммунизировали путем подкожной инъекции сконструированной версии секретированного очищенного интегрина αvβ8.

C. Пример 3. Характеристика β8-эпитопа

Химерные конструкты интегрина β8, в которых мышиные последовательности заменены на человеческий ITGβ8, использовались для локализации связывающих эпитопов для антител 37Е1В5, 11Е8 и 14Е5. Локализация эпитопа осуществляется путем связывания антитела, окрашивания клеточной поверхности и детекции проточной цитометрией. Эпитоп локализовался в пределах участка аминокислот 121-180 человеческого интегрина β8 (относительно последовательности β8, представленной в SEQ ID NO: 17). Все три антитела связываются с человеческим β8, но не с мышиным β8. Следовательно, по меньшей мере одно из 9 различий неконсервативных аминокислот или 7 различий минорных аминокислот (обозначены + в средней линии последовательности) включаются в связывающий эпитоп или воздействуют на 3-мерную структуру домена таким образом, чтобы отличить мышиный белок от человеческого белка. Эпитоп оказывается в положении того, что известно как Psi гибрид и альфа1-спираль и альфа 1-линкерная область Бета-I домена субъединицы интегрина β8, и обнаруживается на поверхности молекулы.

Μ itgβ8 121 GEVSVQLHPGAEANFMLKVRPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMALY 180

GEVS+QL PGAEANFMLKV PLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLS+KMA +

H ITGβ8 121 GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF 180

SEQ ID NO: 1 представляет область человеческого интегрина β8, которая включает 37Е1В5-эпитоп (аминокислоты 121-180). SEQ ID NO: 2 представляет гомологичную мышиную последовательность, которая не связывается антителом 37Е1В5. R в положении 140 мышиной последовательности является полиморфным и может также быть H. Выровненная последовательность представлена как SEQ ID NO: 3.

Чтобы определить, какая(ие) аминокислота(ы) включается в 37Е1В5-эпитоп, проводились дальнейшие исследования замены домена в пределах этой области, в которой мышиная последовательность заменена на человеческую. Замена аминокислот 125-180 в интегрине β8 на мышиные значительно снижала связывание 37Е1В5. Таким образом, эпитоп на человеческом интегрине β8 включает по меньшей мере одну аминокислоту, выбранную из I125, R128, R175, F179 и F180.

D. Пример 4. Характеристика антитела 11Е8

Антитело 11Е8 иммунопреципитирует секретированный αvβ8 и распознает эпитоп субъединицы β8, который присутствует на β8-трансфицированных человеческих эмбриональных клетках почек линии 293 и клетках карциномы толстой кишки человека линии SW480, но не на мнимо трансфицированных клетках.

11Е8 специфически блокирует αvβ8-опосредованную активацию TGF-β в ITGβ8-трансфицированных клетках линии SW480. Подобно 37Е1В5, антитело 11Е8 является антителом с высокой аффинностью и показывает TGFβ-блокирующую активность при очень низкой концентрации (40 мкг/ил in vitro была наименьшей тестируемой концентрацией). 11Е8 не блокирует активацию TGF-β, опосредованную другими (не β8) механизмами.

К тому же, 11Е8 распознает эпитоп β8, который присутствует на фиксированных в формалине клетках, что делает его особенно пригодным для исследований локализации в человеческих тканях. Антитело 11Е8 активно in vitro и in vivo и может применяться в качестве терапевтического агента для снижения αvβ8-опосредованной активности TGF-β. Способность 11Е8 связываться с фиксированными клетками полезна для ускорения получения официального одобрения и для подбора группы пациентов (например, чтобы подтвердить экспрессию αvβ8 в представляющей интерес ткани до начала лечения), характеристики популяций пациентов (например, на основании локализации αvβ8-экспрессии, ответной реакции на различные терапевтические агенты и др.) и мониторинга прогрессирования болезни (например, в ходе курса лечения антителом 11Е8 или другим терапевтическим агентом).

Для более точной характеристики эпитопа антитела 11Е8 был проведен конкурентный анализ с 37Е1В5. Добавление немеченого 37Е1В5 ингибировало связывание меченого антитела 11Е8 с ITGβ8 (человеческий интегрин β8) - трансфицированными клетками линии SW480 и αvβ8-экспрессирующими клетками Puro. Результат показывает, что эпитопы этих антител в значительной мере перекрываются.

Получены последовательности вариабельной области для 11Е8, представленные в SEQ ID NO: 10 и 11. CDR 1-3 тяжелой цепи 11Е8: SYWTE, DILPGSGTTNYNEKFKG и WGWDTY, соответственно. CDR 1-3 легкой цепи 11Е8: SASQGISNYLN, YTSSLHS, QQYSNLPYT, соответственно.

E. Пример 5. Характеристика антитела 14Е5

Как указывалось выше, антитело 14Е5 распознает человеческий, но не мышиный, интегрин β8 и связывает эпитоп в пределах участка аминокислот 120-180. Антитело 14Е5 связывает αvβ8 на αvβ8-экспрессирующих клетках как in vitro, так и in vivo, но не ингибирует высвобождение зрелого активного TGF-β. Антитело 14Е5 полезно для применения в диагностических целях или для подбора популяции пациентов, поскольку оно связывает с высокой аффинностью и хорошо работает в FACS (активируемый флуоресценцией анализ клеток)-анализах.

Для более точной характеристики эпитопа антитела 14Е5 был проведен конкурентный анализ с 37Е1В5. Добавление немеченого 37Е1В5 ингибировало связывание меченого антитела 14Е5 с ITGβ8-трансфицированными клетками линии SW480 и αvβ8-экспрессирующими клетками Puro. Результат показывает, что эпитоп для этих антител является перекрывающимся.

Получены последовательности вариабельной области для 14Е5, представленные в SEQ ID NO: 12 и 13. CDR 1-3 тяжелой цепи 14Е5: TYWIE, HILPGSVITNYNEKFKG, WGWDSY, соответственно. CDR 1-3 легкой цепи 14Е5: STSQDISSSLN, YTSNLHS, QQYSKLPYT, соответственно.

F. Пример 6. Роль интегрина αvβ8 в ремоделировании дыхательных путей

TGF-β вовлекается в воспалительный и фибротический ответ. IL-1β положительно (в сторону повышения) регулирует экспрессию β8, который сверхэкспрессируется в дыхательных путях пациентов, страдающих COPD. Для определения взаимодействий β8, TGF-β и IL-1β in vivo была сконструирована мышиная модель β8-о?осредованного ремоделирования дыхательных путей. Результаты показывают, что IL-1-β-индуцированная, β8-опосредованная активация TGF-β играет критическую роль в ремоделировании дыхательных путей.

β8 был делегирован в линии мышей C57BL/6 с использованием Cre/LoxP системы. Внутритрахеальный аденовирусный IL-1β использовали в качестве модели воспаления у мышей в возрасте от 6 до 9 недель с одним фланкированным loxP-сайтами аллелем интегрина β8 и одним нокаутированным аллелем (фланкированный/-). Либо аденовирусный человеческий IL-1β (Ad-hIL-1β), либо контрольный аденовирус вводили внутритрахеально с или без Ad-Cre.

Мышей, экспрессирующих слитую рекомбиназу Cre-ER(T) под контролем промотора коллаген-Iα2, использовали для того, чтобы показать, что фибробласты играют главную роль в αvβ8-опосредованной активации TGF-β в индуцированном блеомицином фиброзе легких, индуцированном овальбумином ремоделировании дыхательных путей и в Ad-IL1β-индуцированном ремоделировании дыхательных путей. Морфологические изменения дыхательных путей оценивали гистологией. Экспрессия генов некоторых воспалительных цитокинов в разные моменты времени после введения Ad-hIL-1β выявила последовательную индукцию генов, которые характеризуют воспалительный ответ.

Результаты, полученные на условно нокаутированных по β8 мышах, показали, что β8 требуется для IL-1β-индуцированного транзиентного воспаления дыхательных путей и фиброза. Введение человеческого IL-1β мышам, экспрессирующим β8, привело к β8-опосредованной активации TGF-β, индукции мышиных генов ccl2 и ccl20 (лиганды СС-хемокинов 2 и 20, которые вовлекаются в воспалительные ответы), рекрутингу дендритных клеток и к инициации и стабильному сохранению адаптивного иммунного ответа.

Данные исследований на условно нокаутированных по β8 мышах показали снижение воспалительного и фибротического ответа как на Ad-hIL-1β, так и на овальбумин, что приводит к защите от ремоделирования дыхательных путей. Таким образом, таргетинг β8 снижает IL-1β-индуцированную и индуцированную овальбумином активацию TGF-β в ремоделировании дыхательных путей и в индуцированном блеомицином остром повреждении легких.

G. Пример 7. Анти-интегрин β8 антитело снижает экспрессию коллагена I типа

Увеличение продукции ЕСМ (внеклеточного матрикса) и увеличение сократимости фибробластов являются отличительными признаками фибротических ответов, проявляющимися в утолщении стенки дыхательных путей и увеличении коллагена I типа (ColI) и актина гладких мышц (α-SMA). Нейтрализующее анти-β8 антитело использовали для оценки влияния аутокринной αvβ8-опосредованной активации TGF-β на профибротический ответ. Лечение фибробластов дыхательных путей β8-блокирующими антителами ингибировало экспрессию α-SMA и секрецию ColI, что указывает на влияние αvβ8-опосредованной активации TGF-β на фенотип миофибробластов. Совместное культивирование фибробластов дыхательных путей со сквамозными метапластическими эпителиальными клетками бронхов человека приводило к увеличению экспрессии ColI-белка фибробластами дыхательных путей, которая была IL-1β- и фибробласт β8-зависимой. Увеличение в экспрессии ColI могло почти полностью ингибироваться - трансфекцией фибробластов дыхательных путей миРНК β8, что указывает на то, что ингибирование β8-опосредованной активации TGF-β может снижать профибротические ответы и улучшать фибротические состояния.

H. Пример 8. Экспрессия интегрина β8 в фибробластах пациентов с COPD

Экспрессию интегрина β8 детектировали в фибробластах из легких от пациентов, страдающих COPD, с применением окрашивания ткани и первичной культуры; она была выше, чем в непораженной COPD ткани. Экспрессия интегрина β8 также была значительно повышена в фибробластах, выделенных у пациентов с идиопатическим легочным фиброзом, по сравнению с фибробластами от пациентов контрольной группы. COPD-фибробласты увеличивали также экспрессию IL-1β-зависимого интегрина αvβ8 по сравнению с фибробластами легких от пациентов контрольной группы. Эти данные демонстрируют, что αvβ8 является как ниже расположенной мишенью, так и патологическим медиатором IL-1β-активности.

Описанные здесь анти-β8 антитела (например, 37Е1В5, 14Е5 и 11Е8) могут использоваться в терапевтических и/или диагностических целях при заболеваниях, в которых интегрин β8 экспрессируется, а IL-1β и/или TGF-β играют патологическую роль.

I. Пример 9. Интегрин β8-нейтрализующее антитело снижает индуцированное воспаление дыхательных путей

Человеческий ВАС-клон RP11-431K20 использовали для получения трансгенных мышей, экспрессирующих человеческий интегрин β8 (ITGβ). От этих мышей вывели мышей с одним функциональным аллелем мышиного itgβ8 для последующего получения F1-поколения мышей с человеческим ITGβ8 и одной функциональной копией мышиного itgβ8. Этих мышей скрещивали с целью получения F2-поколения, что дало жизнеспособных ВАС ITGβ8, то есть itgβ8-/-мышей, но только с копией человеческого гена, что демонстрируя спасение от летальности itgβ8-/- с помощью человеческого ITGβ8.

Этих мышей использовали для индуцирования ремоделирования дыхательных путей с применением модели внутритрахеальной доставки аденовирусного IL-1β. В названной модели воспроизводимо индуцируется устойчивое ремоделирование дыхательных путей с иммунологическим профилем, сходным с хронической обструктивной болезнью легких (COPD) человека.

Антитело 37Е1В5 в дозе 7 мг/кг блокировало в значительной мере воспаление дыхательных путей с существенным снижением нейтрофилов в бронхоальвеолярном лаваже. Гистологически воспаление стенок дыхательных путей и фиброз значительно уменьшились при введении антитела 37Е1В5. К тому же, фибробласт-специфическая делеция itgβ8 может в значительной мере ингибировать индуцированное аденовирусным IL-1β ремоделирование дыхательных путей.

Мышей с фибробласт-специфической делецией itgβ8 использовали также для изучения аллергического ремоделирования дыхательных путей (индуцированные овальбумином воспаление дыхательных путей, фиброз и метаплазия слизистой). Ремоделирование резко снижалось у itgβ8-/- мышей по сравнению с мышами дикого типа. Аллергическая модель также зависит и от IL-1β, и от TGF-β. Эти данные показывают, что itgβ8 играет определенную роль во врожденных и адаптивных иммунных ответах, опосредованных IL-1β и TGF-β. IL-1β вызывает увеличение интегрина β8 во многих типах клеток, включая фибробласты из дыхательных путей и легких и астроциты, а IL-1β-индуцированная экспрессия β8 наблюдается как у мышей, так и у человека.

J. Пример 10. Человеческие хондроциты суставного хряща экспрессируют интегрин αvβ8

Взрослый суставной хрящ был изъят из суставной полости колена у пациента, которому проводятся плановые операции по восстановлению коленного сустава из-за хронического остеоартрита. Первичные хондроциты выращивали до достижения 70% конфлюэнтности и определяли экспрессию интегринового рецептора путем окрашивания клеток и проточной цитометрии. Использовали антитела анти-β8 (37Е1В5) и анти-β6 (Е7Р6). Устойчивое окрашивание было обнаружено в случае 37Е1В5, тогда как при использовании Е7Р6 никакого окрашивания не наблюдалось. Первичные хондроциты культивировали совместно с TMLC (трансформированные клетки легкого норки) TGFβ-репортерными клетками (Annes et al. (2004) J. Cell Biol. 165:723) в биоанализе TGF-β в присутствии или в отсутствие анти-β8 (37Е1В5) или анти-β6 антител. Анти-β8 антитело продуцировало надежную блокаду активации TGF-β, в то время как анти-β6 антитело не показало такого эффекта.

Результаты указывают не только на экспрессию αvβ8 в хондроцитах, но и на то, что экспрессия приводит к активации TGF-β. Таким образом, ингибирование αvβ8 может применяться для лечения заболеваний суставов, ассоциированных с активированным TGF-β, таких как артрит и синовиальный фиброз (см., например, Bakker et al. (2001) Osteoarthritis and Cartilage 9:128).

K. Пример 11. Стеллатные клетки печени экспрессируют αvβ8

Стеллатные клетки печени являются сократимыми клетками, которые могут продуцировать коллаген в ответ на активированный TGF-β и тип паренхимальных клеток, вовлеченный в фиброз печени. Фиброз печени имеет ряд триггеров, включающих алкоголь, лекарственные препараты и анестетики, инфекцию (например, гепатит B и C), аутоиммунитет, холестаз (избыток желчи) и неалкогольный стеатогепатит.

Проводили детекцию экспрессии интегрина β8 у описанных выше трансгенных мышей (человеческий ITGβ8, но не мышиный igtβ8) с тем, чтобы определить, может ли активность TGF-β в печени быть мишенью для описанного здесь β8-специфического антитела.

На Фиг. 2 показано, что значительный процент стеллатных клеток печени экспрессирует β8 как показало определение с использованием антитела 14Е5.

L. Пример 12. Αнти-β8 антитела снижают воспаление тонкой кишки

Симптомы воспалительного заболевания кишечника (IBD) наблюдали у описанных выше трансгенных мышей, которые экспрессируют человеческий IGTβ8, но не мышиный igtβ8. Симптомы включают потерю веса и расширение и воспаление тонкой кишки, а также сколиоз. Фиг. 3 показывает селективную визуализацию (gating) иммунных клеток в кишечнике указанных мышей. На Фиг. 3A показаны общие параметры селективной визуализации, в то время как на фиг. 3B-3E показан паттерн экспрессии β8 на CD4+, CD8+, В-клетках и NK-клетках, соответственно. NK-клетки не экспрессируют β8 на поддающемся детекции уровне. Дендритные клетки из кишечника IGTβ8-мышей также демонстрируют экспрессию β8.

Поэтому IGTβ8-мышей использовали для определения действия анти-β8 антитела 37Е1В5 in vivo. IGTβ8-трансгенных мышей лечили путем внутрибрюшинного (IP) введения 3 мг 37Е1В5/кг дважды в неделю в течение 8 недель. На Фиг. 4 показано, что лечение антителом 37Е1В5 значительно снижало расширение тонкой кишки, ассоциированное с воспалением. На Фиг. 5 также представлено действие лечения антителом, при сравнении сегмента кишечника, взятого от IGTβ8 и контрольной (не получавшей лечение) мышей, с сегментом кишечника мыши, получавшей лечение антителом (В5).

M. Пример 13. Антитела 4F1 и 6В9 связывают человеческий β8 на фиксированных клетках и ткани

Гибридомные клоны 4F1 и 6В9 специфически окрашивают фиксированные в формалине, залитые в парафин человеческие эмбриональные клетки почек HEK293, трансфицированные ΙΤGβ8 и головным мозгом ITGβ8 BAC-трансгенных (Tg) мышей. Стабильно трансфицированные клетки 293, экспрессирующие человеческий интегрин αvβ8 (293 β8) или нет (293 WT), фиксировали в течение ночи в 10% буферном растворе формалина, гранулировали а затем заключали в "агарозные плати" и проводили рутинные операции (обработка ткани, заливка в парафин и приготовление срезов). Образцы головного мозга от ITGB8 ВАС Tg-мышей обрабатывались аналогичным образом. Иммуноокрашивание проводили с применением метода восстановления антигена теплом (heat induced antigen retrieval), а антитела детектировали с помощью коммерческого набора (Dako). 6В9 использовали при 25 мкг/мл вкупе с восстановлением антигена теплом (102С) в течение 10 минут. 4F1 использовали при 50-100 мкг/мл вкупе с восстановления антигена теплом (95С) в течение 10 минут. Результаты, приведенные на фиг. 6 показывают, что антитела специфичны к β8 и способны связывать β8 на фиксированной ткани.

Для гибридомного клона 4F1 головной мозг или легкое ITGβ8 BAC трансгенных (Tg) мышей или мышей дикого типа (WT) фиксировали в течение ночи в 10% буферном растворе формалина и затем проводили рутинные операции (обработка ткани, заливка в парафин и приготовление срезов). Иммуноокрашивание проводили с применением такого же метода восстановления антигена теплом, какой описан выше, а антитела детектировали с помощью коммерческого набора. Результаты представлены на фиг. 7.

N. Пример 14. Антитела 6В9 и 4F1 способны различать клетки с различным числом геномных копий β8

Гибридомный клон 6В9 способен связываться с β8 на фиксированной ткани и обнаруживать изменение числа копий. На Фиг. 8 приведено иммуноокрашивание фиксированного в формалине, залитого в парафин головного мозга ITGβ8 BAC трансгенной (Tg) мыши. Головной мозг ITGβ8 BAC Tg-мышей или WT-мышей фиксировали в течение ночи в 10% буферном растворе формалина и затем проводили рутинные операции (обработка ткани, заливка в парафин и приготовление срезов). Иммуноокрашивание проводили, как описано выше. Показаны три линии Tg-мышей (В, С и D) в сравнении с WT-мышами, экспрессирующие 1 копию (D--линия BAC/WT), 2 копии (В и С--линии BAC/WT; D--линия ВАС/ВАС) или 4 копии (В and С-линии ВАС/ВАС).

Равным образом, рекомбинантный моноклональный кроличий IgG, происходящий из вариабельных доменов 4F1, может обнаруживать варьирование в числе копий. На Фиг.9 показаны результаты иммуноокрашивания фиксированного в формалине, залитого в парафин легкого ITGβ8 ВАС трансгенной (Tg) мыши. Легкие ITGβ8 ВАС Tg-мышей или WT-мышей фиксировали в течение ночи в 10% буферном растворе формалина и затем проводили рутинные операции (обработка ткани, заливка в парафин и приготовление срезов). Иммуноокрашивание проводили, как описано выше. Показаны три линии Tg-мышей (В, С и D) в сравнении с WT-мышами, экспрессирующие 1 копию (D--линия BAC/WT), 2 копии (В и С--линии BAC/WT; D--линия ВАС/ВАС) или 4 копии (В and С-линия ВАС/ВАС).

Антитела 4F1 и 6В9 могут обнаруживать различия в экспрессии между одной и двумя копиями ITGβ8 в фиксированных в формалине, залитых в парафин тканях, полученных от BAC ITGβ8 мышей. Поэтому эти антитела являются потенциально полезными как диагностические агенты для выявления увеличенной экспрессии β8 в рамках сопутствующей диагностики к терапии антителами (например, 37Е1В5, 11Е8 и их β8-связывающие фрагменты и аффинно-зрелые варианты).

O. Пример 15. Детекция β8 на фиксированной патологической ткани легких человека

Рекомбинантный моноклональный кроличий IgG, происходящий из вариабельных доменов 4F1, может обнаруживать экспрессию αvβ8 путем иммуноокрашивания фиксированного в формалине, залитого в парафин человеческого фиброзного легкого. Образцы легких человека были получены из удаленной в ходе хирургической операции патологической ткани от пациента с эмфиземой и подплевральным рубцеванием. Ткань фиксировали в течение ночи в 10% буферном растворе формалина и затем выполняли рутинных операций (обработка тканей, заливка в парафин и приготовление срезов). Иммуноокрашивание проводили, как описано выше. Результаты представлены на фиг. 10. Стрелки указывают на окрашивание веретенообразных клеток, представляющих собой фибробласты, вкрапленные в плотную фиброзную соединительную ткань.

P. Пример 16. Картирование эпитопов для антител 6В9 и 4F1

Химерные конструкты интегрина β8, в которых мышиные последовательности заменены на человеческий ITGβ8, использовали для локализации связывающих эпитопов для антител 6В9 и 4F1. Локализация эпитопа осуществлялась путем связывания антитела, окрашивания клеточной поверхности и детекции проточной цитометрией. Эпитоп был локализован в пределах аминокислот 61-105 человеческого интегрина. Антитела 6В9 и 4F1 связываются с человеческим β8, но не с мышиным β8. По меньшей мере одно из 3 различий неконсервативных аминокислот или 2 различий минорных аминокислот (обозначены + в выровненной последовательности) включаются в связывающий эпитоп или воздействуют на 3-мерную структуру домена таким образом, чтобы отличить мышиный белок от человеческого белка.

Мышиная 61 LGPECGWCVQEDFVSGGSGSERCDTVSSLISKGCPVDSIEYLSVH 105

LGPECGWCVQEDF+SGGS SERCD VS+LISKGC VDSIEY SVH

Человеческая 61 LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVH 105

SEQ ID NO: 14 представляет область человеческого интегрина β8, которая включает эпитоп (аминокислоты 61-105). SEQ ID NO: 15 представляет гомологичную мышиную последовательность, которая не связывается антителом 4F1 или 6В9. Выровненная последовательность представлена как SEQ ID NO: 16.

Аминокислотная замена в этой области проводилась для того, чтобы определить, какая(ие) аминокислота(ы) включены в β8-эпитоп. В таблице ниже показано, что остаток серина в положении 95 последовательности человеческого β8 включен в эпитопы 6В9 и 4F1.

Q. Пример 17. Характеристика антител 6В9 и 4F1

Получены последовательности вариабельных областей для 6В9, представленные как SEQ ID NO: 18 и 19. CDR 1-3 тяжелой цепи 6В9: DYLDE, VINPETGGTNYNAKFKG и EAGNYIYAMDY, SEQ ID NO: 40-42, соответственно. CDR 1-3 легкой цепи 6В9: RASVNIYSYLV, NAKTLAE и QHHHGTPYT, SEQ ID NO: 43-45, соответственно.

Получены последовательности вариабельных областей для 4F1, представленные в SEQ ID NO: 20 и 21. CDR 1-3 тяжелой цепи 4F1: NYLIE, VINPGTGGTNYNKXFKV и EGNARTYYYAMDY, SEQ ID NO: 116-118, соответственно. CDR 1-3 легкой цепи 4F1: RASENIYSYLV, NAKTLAE и QHHNGTPYT, SEQ ID NO: 119-121, соответственно.

R. Пример 18. Характеристика эпитопов антител 37Е1В5, 14Е5 и 11Е8

Как показано выше, SEQ ID NO: 1 представляет область человеческого интегрина β8, которая включает β8-эпитоп (аминокислоты 120-180) для антител 37Е1В5, 14Е5 и 11Е8. SEQ ID NO: 2 представляет гомологичную мышиную последовательность, которая не связывается в значительной мере антителами.

Аминокислотная замена в этой области проводилась для того, чтобы определить, какая(ие) аминокислота(ы) включены в β8-эпитоп. В таблице ниже показано, какие из аминокислот 175-180 последовательности SEQ ID NO: 1 включены в эпитоп для каждого

S. Пример 19. Определение аффинности одноцепочечных антител Fv

Авторами изобретения также определялась аффинность описанных антител, включая их аффинно-зрелые версии. Как правило аффинность Кд одноцепочечного антитела в 10-100 раз выше аффинности соответствующего Ig (т.е. одноцепочечное антитело имеет в 10-100 раз меньшую аффинность, чем соответствующий Ig).

Описанные здесь примеры и варианты осуществления изобретения приводятся только в иллюстративных целях; специалистами в данной области могут быть предложены в свете вышеизложенного различные модификации или изменения, которые включены в пределах сущности и области применения настоящей заявки и прилагаемой формулы изобретения. Все публикации, веб-сайты, номера доступа, патенты и патентные заявки, перечисленные в описании, включены в него в полном объеме в виде ссылок.

1. Выделенное антитело, которое специфически связывает αvβ8, где антитело содержит:

участки CDR тяжелой цепи SEQ ID NO: 48, SEQ ID NO: 49 и SEQ ID NO: 50 и участки CDR легкой цепи SEQ ID NO: 51, SEQ ID NO: 52 и SEQ ID NO: 53;

участки CDR тяжелой цепи SEQ ID NO: 48, SEQ ID NO: 49 и SEQ ID NO: 54 и участки CDR легкой цепи SEQ ID NO: 51, SEQ ID NO: 52 и SEQ ID NO: 55;

участки CDR тяжелой цепи SEQ ID NO: 48, SEQ ID NO: 90 и SEQ ID NO: 54 и участки CDR легкой цепи SEQ ID NO: 51, 52 и 53; или

участки CDR тяжелой цепи SEQ ID NO: 112, SEQ ID NO: 113 и SEQ ID NO: 50 и участки CDR легкой цепи SEQ ID NO: 105, 107 и 53.

2. Выделенное антитело по п. 1, связанное с детектируемой меткой.

3. Выделенное антитело по п. 1, которое является гуманизированным.

4. Выделенное антитело по п. 1, которое является антителом scFv.

5. Гуманизированное антитело, которое специфически связывает αvβ8,

при этом антитело ингибирует высвобождение активного зрелого пептида TGFβ, но существенно не ингибирует адгезию латентного TGFβ к αvβ8 на αvβ8-экспрессирующей клетке, и при этом антитело содержит вариабельную область тяжелой цепи согласно SEQ ID NO: 8 и вариабельную область легкой цепи согласно SEQ ID NO: 9.

6. Фармацевтическая композиция, уменьшающая сигналирование TGFβ, где фармацевтическая композиция содержит выделенное или гуманизированное антитело по любому из предшествующих пунктов в фармацевтически приемлемом вспомогательном веществе.

7. Способ снижения TGFβ-сигналирования в организме индивидуума, предусматривающий введение терапевтически эффективной дозы фармацевтической композиции по п. 6 индивидууму, тем самым снижая TGFβ-сигналирование у индивидуума.

8. Способ по п. 7, в котором индивидуум страдает по меньшей мере одним состоянием, выбранным из группы, включающей воспалительное заболевание кишечника (IBD), хроническую обструктивную болезнь легких (COPD), астму, артрит, фиброз печени, фиброз легких, воспалительное аутоиммунное заболевание головного мозга, рассеянный склероз, демиелинизирующее заболевание, нейровоспаление, болезнь почек, аденокарциному, сквамозную карциному, глиому и карциному молочной железы, и в котором снижение TGFβ-сигналирования приводит к улучшению состояния.

9. Способ по п. 7, в котором индивидуум страдает воспалительным заболеванием кишечника (IBD) и в котором снижение TGFβ-сигналирования приводит к облегчению IBD.

10. Способ по п. 7, в котором индивидуум страдает хронической обструктивной болезнью легких (COPD) и/или фиброзом легких и в котором снижение TGFβ-сигналирования приводит к облегчению COPD и/или фиброза легких.

11. Способ по п. 7, в котором индивидуум страдает артритом и в котором снижение TGFβ-сигналирования приводит к облегчению артрита.

12. Способ по п. 7, в котором индивидуум страдает астмой и в котором снижение TGFβ-сигналирования приводит к облегчению астмы.

13. Способ по п. 7, в котором индивидуум страдает фиброзом печени и в котором снижение TGFβ-сигналирования приводит к облегчению фиброза печени.

14. Способ диагностики αvβ8-ассоциированного заболевания у индивидуума, предусматривающий

контактирование клетки от индивидуума с выделенным антителом по любому из пп. 1-4 и

детекцию связывания выделенного антитела с клеткой,

в котором αvβ8-ассоциированное заболевание выбрано из группы, включающей воспалительное заболевание кишечника (IBD), хроническую обструктивную болезнь легких (COPD), астму, артрит, фиброз печени, фиброз легких, воспалительное аутоиммунное заболевание головного мозга, рассеянный склероз, демиелинизирующее заболевание, нейровоспаление, болезнь почек, аденокарциному, сквамозную карциному, глиому и карциному молочной железы, и

в котором связывание выделенного антитела с клеткой указывает на то, что индивидуум страдает αvβ8-ассоциированным заболеванием.

15. Способ по п. 14, в котором клетка фиксируется.

16. Способ по п. 14, в котором контактирование происходит in vitro.

17. Способ по п. 14, в котором контактирование происходит in vivo.

18. Способ по п. 14, в котором αvβ8-ассоциированным заболеванием является воспалительное заболевание кишечника.

19. Способ по п. 14, в котором αvβ8-ассоциированным заболеванием является артрит.

20. Способ по п. 14, в котором αvβ8-ассоциированным заболеванием является фиброз печени.

21. Способ по п. 14, в котором αvβ8-ассоциированным заболеванием является хроническая обструктивная болезнь легких (COPD) и/или фиброз легких.

22. Способ по п. 14, в котором αvβ8-ассоциированным заболеванием является астма.

23. Способ по п. 14, также предусматривающий введение индивидууму фармацевтической композиции по п. 6.



 

Похожие патенты:

Изобретение относится к биохимии. Описан фармацевтический состав для лечения ангиогенных заболеваний, содержащий антитело, которое связывается с VEGF, в аргинин ацетатном буфере, рН 4,5-6,0, и поверхностно-активное вещество, где антитело представляет собой бевацизумаб.

Изобретение относится к области биохимии, в частности к биспецифическому двухвалентному антителу, которое специфично связывается с фактором роста эндотелия сосудов человека (VEGF) и с ангиопоэтина-2 человека (ANG-2).

Изобретение относится к биохимии. Представлено химерное, CDR-привитое, гуманизированное или рекомбинантное человеческое антитело или его фрагмент, который специфически связывается с человеческим EFNA4.

Изобретение относится к биохимии. Описано рекомбинантное антитело, его фрагмент, нейтрализующие VEGF человека, содержащие вариабельную область тяжелой цепи (VH), где VH содержит CDRH1, CDRH2 и CDRH3 последовательности SEQ ID NO: 8, SEQ ID NO: 20 и SEQ ID NO: 32 соответственно, и вариабельную область легкой цепи (VL), где VL содержит CDRL1, CDRL2 и CDRL3 последовательности SEQ ID NO: 43, SEQ ID NO: 55 и SEQ ID NO: 66 соответственно и где вариабельная область тяжелой цепи содержит аминокислотную последовательность SEQ ID NO: 164 и вариабельная область легкой цепи содержит аминокислотную последовательность SEQ ID NO: 87.

Изобретение относится к биохимии. Описано применение антител или их фрагментов, которые специфично связывают hDH4 и блокируют взаимодействие между Dll4 и Notch-рецептором для предупреждения, лечения или ослабления сахарного диабета 1-го типа у субъекта.

Изобретение относится к биохимии. Раскрыто антитело или его связывающий фрагмент, которое(ый) специфически связывается с дельта-подобным лигандом 4 (DLL4) и включает: VH CDR 1, которая содержит аминокислотную последовательность NYGIT (аминокислотные остатки 31-35 SEQ ID NO: 30), и VH CDR 2, которая содержит аминокислотную последовательность WISAYNGNTNYAQKLQD (аминокислотные остатки 50-66 SEQ ID NO: 30), VH CDR 3, которая содержит аминокислотную последовательность DRVPRIPVTTEAFDI (аминокислотные остатки 99-113 SEQ ID NO: 30), и VL CDR 1, которая содержит аминокислотную последовательность SGSSSNIGSYFVY (аминокислотные остатки 23-35 SEQ ID NO: 32), VL CDR 2, которая содержит аминокислотную последовательность RNNQRPS (аминокислотные остатки 51-57 SEQ ID NO: 32), VL CDR 3, которая содержит аминокислотную последовательность AAWDDSLSGHWV (аминокислотные остатки 90-101 SEQ ID NO: 32).

Изобретение относится к биохимии. Раскрыты антитело человека или антиген-связывающий фрагмент антитела человека, которые специфически связывают и ингибируют ангиопоэтин-подобный белок 4 человека (hANGPTL4).

Изобретение относится к биотехнологии. Описан способ получения рекомбинантного моноклонального антитела против CD3*CD19 формата флексибоди.

Изобретение относится к области биотехнологии и представляет собой способ получения биспецифического антигенсвязывающего белка, содержащего: две легкие цепи и две тяжелые цепи полноразмерного антитела, включающего два Fab-фрагмента и специфически связывающегося с первым антигеном; и два дополнительных Fab-фрагмента антитела, которое специфически связывается со вторым антигеном, где указанные дополнительные Fab-фрагменты оба слиты посредством пептида-коннектора с С- или N-концами тяжелых цепей, указанных в подпункте а); где пептидом-коннектором является (Gly-x-Ser)n, или (Gly-x-Ser)nGlym(х=3, n=3, 4, 5 или 6 и m=0,1, 2 или 3), или (х=4, n=2,3, или 5 и m=0, 1, 2 или 3) и где в Fab-фрагментах осуществлены следующие модификации: I) в обоих Fab-фрагментах, указанных в подпункте а), или в обоих Fab-фрагментах, указанных в подпункте б), вариабельные домены VL и VH заменены друг на друга и/или константные домены CL и СН1 замены друг на друга; II) в обоих Fab-фрагментах, указанных в подпункте а), вариабельные домены VL и VH заменены друг на друга и константные домены CL и СН1 заменены друг на друга, и в обоих Fab-фрагментах, указанных в подпункте б), вариабельные домены VL и VH заменены друг на друга или константные домены CL и СН1 заменены друг на друга; III) в обоих Fab-фрагментах, указанных в подпункте а), вариабельные домены VL и VH заменены друг на друга или константные домены CL и СН1 заменены друг на друга, и в обоих Fab-фрагментах, указанных в подпункте б), вариабельные домены VL и VH заменены друг на друга и константные домены CL и СН1 заменены друг на друга; IV) в обоих Fab-фрагментах, указанных в подпункте а), вариабельные домены VL и VH заменены друг на друга и в обоих Fab-фрагментах, указанных в подпункте б), константные домены CL и СН1 заменены друг на друга; или V) в обоих Fab-фрагментах, указанных в подпункте а), константные домены CL и СН1 заменены друг на друга и в обоих Fab-фрагментах, указанных в подпункте б), вариабельные домены VL и VH заменены друг на друга; а способ включает этапы: а) трансформацию клетки-хозяина экспрессионными векторами, которые содержат молекулы нуклеиновых кислот, кодирующие указанный биспецифический антигенсвязывающий белок; б) культивирования клетки-хозяина в условиях, которые позволяют синтезировать молекулу этого биспецифического антигенсвязывающего белка; и в) выделение молекулы указанного биспецифического антигенсвязывающего белка из указанной культуры.

Изобретение относится к области биотехнологии, конкретно к химерным полипептидам фактора роста фибробластов (FGF), и может быть использовано в медицине для лечения ожирения, диабета, высокого содержания глюкозы в крови, метаболического синдрома и гиперхолестеринемии.

Изобретение относится к области биохимии. Описана группа изобретений, включающая способ получения иммуноглобулина человека и препарат иммуноглобулина человека, полученный вышеуказанным способом.

Группа изобретений относится к области фармацевтики и медицины и касается конъюгата белок-активное вещество, имеющего аминокислотный мотив, который может распознаваться с помощью изопреноид-трансферазы, где активное вещество ковалентно связано посредством по меньшей мере одного линкера с изосубстратом, где изосубстрат содержит по меньшей мере одну изопреноидную единицу и является распознаваемым изопреноид-трансферазой, которая присоединена к цистеиновому остатку аминокислотного мотива.

Группа изобретений относится к области фармацевтики и медицины и касается жидкой композиции (варианты), в которой длительно действующий конъюгат INFα и Fc-фрагмента иммуноглобулина ковалентно связаны посредством непептидного полимера, и включает стабилизатор, содержащий буфер, сахарный спирт, неионное поверхностно-активное вещество и изотоническое средство, при этом не содержит человеческого альбумина сыворотки и других потенциальных факторов, вредных для организма.

Изобретение относится к области медицины, а именно к ветеринарии и иммунологии, и может быть использовано для получения бруцеллезной моноспецифической сыворотки. Для этого проводят иммунизацию кроликов разовой дозой штамма В.

Изобретение относится к области биохимии. Заявлено антитело к BLyS.

Изобретение относится к области биотехнологии. Предложен способ получения содержащей IgM композиции иммуноглобулинов из фракции плазмы.
Изобретение относится к медицине, а именно к онкологии, и может быть использовано для лечения местнораспространенного нерезектабельного рака пищевода. Для этого больным в условиях процедурного кабинета после обработки кожи передней грудной стенки раствором антисептика вводят внутрикожно по 0,3 мл аутологичной дендритно-клеточной вакцины по две инъекции с каждой стороны грудины примерно между III и IV, IV и V ребрами.

Изобретение относится к области биохимии, в частности к антителу или его фрагменту, где антитело или его фрагмент специфически связывается с белком CAPRIN-1, ДНК, его кодирующему, а также к конъюгату указанного антитела или его фрагмента с противоопухолевым средством.

Настоящее изобретение относится к области биотехнологии и иммунологии. Предложены выделенные полинуклеотиды, кодирующие вариабельные области легкой и тяжелой цепи антитела против человеческого EGFR; анти-EGFR антитело и фрагмент антитела; а также вектор, клетка-хозяин и способ получения анти-EGFR антитела или его фрагмента.

Изобретение относится к области биотехнологии и иммунологии. Описано блокирующее AGR2 моноклональное антитело и, в частности, гуманизированное моноклональное антитело для блокирования AGR2.

Изобретение относится к области биотехнологии, конкретно к стабильным фармацевтическим композициям слитого белка TNFR:Fc. Получают фармацевтические композиции, а также наборы для их применения, отличающиеся физической стабильностью TNFR:Fc за счет использования системы цитратного буфера в концентрации от 25 до 120 мМ и аминокислоты, выбранной из группы, включающей лизин и пролин и их фармацевтически приемлемых солей в концентрации от 15 до 100 мМ в качестве стабилизатора. Изобретение позволяет обеспечить стабильность фармацевтических композиций этанерцепта для длительного хранения. 4 н. и 10 з.п. ф-лы, 1 ил., 17 табл., 3 пр.
Наверх