Стабильное при хранении жидкое моющее или чистящее средство, содержащее протеазу и амилазу

В случае жидкого моющего или чистящего средства, содержащего протеазу и амилазу, должна быть улучшена стабильность при хранении. Этого удается добиться благодаря применению протеазы, содержащей аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 70% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E или R99D в комбинации с заменами аминокислот S3T, V4I и V199I. 4 н. и 10 з.п. ф-лы, 1 табл., 1 пр.


Настоящее изобретение относится к области жидких моющих и чистящих средств. Изобретение предпочтительно относится к содержащим ферменты жидким моющим и чистящим средствам, которые содержат некоторые протеазы в комбинации с амилазой, и, кроме того, относится к способам, в которых используют такие средства. Изобретение относится также к применению некоторых протеаз в жидких моющих или чистящих средствах, содержащих амилазу.

В моющих и чистящих средствах предпочтительно применяют протеазы субтилизинового типа. Источником протеаз, применяемых в моющих или чистящих средствах, известных в предшествующем уровне техники, первоначально являются микроорганизмы, например, видов Bacillus, Streptomyces, Humicola, Thermomyces или Pseudomonas, и/или их производят по существу известными биотехнологическими способами с помощью приемлемых микроорганизмов, например с помощью трансгенных экспрессирующих организмов вида Bacillus или с помощью мицелиальных грибов.

В частности, в современных жидких моющих средствах все в большей степени содержатся другие ферменты, в данном случае предпочтительно амилазы. Амилаза представляет собой фермент, который катализирует гидролиз гликозидных связей, в частности, в полисахаридах, таких, как крахмал. Из числа амилаз в моющих и чистящих средствах часто применяют α-амилазы, которые гидролизуют α-(1-4)-гликозидные соединения амилозы. Согласно классификации ферментов КФ, представляющей собой числовую систему классификации ферментов, α-амилазы кодируются шифром КФ (от английского "Enzyme Commission number" ("шифр по классификации Комиссии по ферментам") и относятся, следовательно, к третьему из шести главных классов ферментов, т.е. к гидролазам (E.C. 3.-.-.-), в данном случае к гликозилазам (E.C. 3.2.-.-) и также к гликозидазам (E.C. 3.2.1.-), т.е. к ферментам, которые гидролизуют O- и/или S-гликозильные соединения. При разложении крахмала α-амилазами образуются декстрины, из которых образуются мальтоза, глюкоза и разветвленные олигосахариды. Следовательно, амилазы при очистке предпочтительно действуют против крахмалсодержащих остатков и катализируют их гидролиз.

В международных заявках WO 95/23221 и WO 92/21760 описаны варианты щелочной протеазы, происходящей из Bacillus lentus DSM 5483, которые являются приемлемыми для применения в моющих или чистящих средствах, а также моющие и чистящие средства, содержащие протеазы такого типа. Кроме того, в международной заявке WO 2011/032988 описаны моющие и чистящие средства, которые также содержат варианты щелочной протеазы, происходящей из Bacillus lentus DSM 5483. Раскрытые в этих описаниях варианты протеаз наряду с другими положениями могут иметь замены в положениях 3, 4, 99 и 199 соответственно системе нумерации щелочной протеазы, происходящей из Bacillus lentus DSM 5483, и, например, в указанных положениях могут содержать аминокислоты 3T, 4I, 99D, 99E или 199I. Кроме того, описано, что моющее средство может содержать другие ферменты, в данном случае амилазу. Моющие средства могут быть твердыми или жидкими. Однако из этого описания непосредственно и однозначно не следует определение жидкого моющего средства, содержащего амилазу в комбинации с протеазой, которая характеризуется комбинациями этих изменений соответственно описанному далее.

Недостаток содержащих протеазу и амилазу жидких моющих и чистящих средств предшествующего уровня техники состоит в том, что они не являются достаточно стабильными при хранении и, следовательно, уже через короткое время в значительной мере утрачивают ферментативную, в частности амилолитическую и/или протеолитическую, активность. Присутствие протеазы часто ведет к потере амилолитической активности, так как протеаза инактивирует амилазу. Вследствие этого моющее или чистящее средство не показывает оптимальной эффективности очистки.

В основе настоящего изобретения лежит задача преодоления указанного недостатка и разработки, содержащих протеазу и амилазу жидких моющих или чистящих средств, которые являются в достаточной или повышенной степени стабильными при хранении, в частности, в отношении их ферментативной и предпочтительно их амилолитической и/или протеолитической активности.

Таким образом, объектом настоящего изобретения является жидкое моющее или чистящее средство, содержащее:

(a) протеазу, содержащую аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 70% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E или R99D в комбинации по меньшей мере с двумя другими заменами аминокислот, выбранных из группы, в которую входят S3T, V4I и V199I, и

(b) амилазу.

Неожиданно было обнаружено, что жидкое моющее или чистящее средство, содержащее комбинацию такой протеазы с амилазой, является в благоприятной степени стабильным при хранении. В частности, оно характеризуется улучшенной эффективностью очистки, в частности улучшенной амилолитической и/или протеолитической эффективностью очистки, после хранения по сравнению с моющим или чистящим средством, которое отличается от средства по настоящему изобретению только наличием в соответствующем средстве протеазы, причем в сравниваемых средствах протеаза на начало хранения содержится в равной концентрации в пересчете на активный фермент. Таким образом, протеаза, предусмотренная по настоящему изобретению, ведет к пониженной инактивации амилазы и характеризуется также уменьшенной потерей собственной эффективности. Однако уменьшение инактивации амилазы и/или протеазы благодаря протеазе, предусмотренной по настоящему изобретению, не связано с недостаточной эффективностью и/или активностью протеазы.

В связи с этим средство по настоящему изобретению предпочтительно характеризуется хорошей, особенно благоприятной эффективностью очистки от загрязнений, чувствительных к протеазе. Таким образом, такое средство обеспечивает удовлетворительное или улучшенное удаление по меньшей мере одного вида и предпочтительно нескольких видов чувствительных к протеазе загрязнений с текстильных изделий и/или с твердых поверхностей, например с посуды. В выбранных вариантах осуществления настоящего изобретения такая эффективность очистки в отношении по меньшей мере одного вида чувствительных к протеазе загрязнений проявляется, в частности, также при низкой температуре, например в интервале от 10 до 50ºC, от 10 до 40ºC или от 20 до 40ºC.

Таким образом, в связи с ранее указанными международными заявками WO 95/23221, WO 92/21760 и WO 2011/032988 в случае настоящего изобретения речь идет об особенно предпочтительном выборе, ведущем к получению жидкого моющего средства, которое является эффективным и стабильным при хранении, в частности, в отношении протеолитической и/или амилолитической эффективности очистки средства после хранения и/или в отношении протеолитической, и/или амилолитической активности средства после хранения.

Под эффективностью очистки в рамках настоящего изобретения понимают способность моющего или чистящего средства при его применении удалять имеющееся загрязнение частично или полностью. В случае загрязнений белья эта способность предпочтительно представляет собой отбеливающую способность в отношении одного или нескольких видов загрязнений текстильных изделий. Примерами загрязнений белья являются следы "кровь-молоко/тушь" на хлопке, следы "яичный желток с белком/пигмент" на хлопке, следы "шоколад-молоко/тушь" на хлопке, следы "арахисовое масло-пигмент/тушь" на ткани из смеси "полиэфирное волокно/хлопок", следы травы на хлопке или следы какао на хлопке. В случае средств для мытья посуды под эффективностью очистки понимают способность средства для мытья посуды удалять загрязнения, имеющиеся на твердой поверхности посуды. Примеры загрязнений посуды представляют собой молоко, мясной фарш, яичный желток, овсяные хлопья и крахмал. В рамках настоящего изобретения как моющее или чистящее средство, содержащее протеазу и амилазу, или моющий раствор, образованный этим средством, так и собственно протеаза или амилаза обладают соответствующей очищающей эффективностью. Таким образом, очищающая эффективность ферментов вносит свой вклад в очищающую эффективность средства или моющего раствора, образованного средством. Амилолитическая эффективность очистки означает эффективность очистки от загрязнений, чувствительных к амилазе. Протеолитическая эффективность очистки означает эффективность очистки от загрязнений, чувствительных к протеазе. Эффективность очистки определяют общепринятым в данной области техники способом, предпочтительно способом, указанным далее.

Под моющим раствором понимают рабочий раствор, который содержит моющее или чистящее средство, действует на текстильные изделия или ткани, или твердые поверхности и, таким образом, приходит в контакт с загрязнениями, имеющимися на текстильных изделиях или тканях, или твердых поверхностях. Как правило, моющий раствор образуется тогда, когда начинается процесс стирки или очистки и моющее или чистящее средство разбавляют водой, например, в посудомоечной машине, стиральной машине или в другом приемлемом сосуде.

Стабильность при хранении в смысле настоящего изобретения проявляется, в частности, в том, что моющее или чистящее средство по настоящему изобретению имеет после хранения более высокую эффективность очистки по сравнению с контрольной композицией, которая отличается от моющего или чистящего средства по настоящему изобретению только протеазой, содержащейся в контрольной композиции. При этом оба из сравниваемых средств на начало хранения характеризуются равными значениями количества или концентрации амилазы и/или исходной амилолитической активности. Кроме того, в обоих средствах на начало хранения протеаза содержится в равных концентрациях в пересчете на активный фермент и с обоими средствами обращаются одинаковым образом, в частности, в отношении условий хранения и определения ферментативной активности. Более предпочтительно хранение осуществляют в течение по меньшей мере 24 часов, 48 часов, 72 часов, 5 дней, 1 недели, 2 недель, 3 недель или 4 недель. При этом хранение предпочтительно осуществляют при температуре 20ºC, 30ºC или 40ºC и более предпочтительно при 40ºC.

В связи с этим определение ферментативной активности может быть осуществлено - в зависимости от соответствующего типа фермента - общепринятым в данной области техники способом. Способы определения активности известны специалистам в области технологии ферментов и применяются ими в установленном порядке. Способы определения активности протеазы описаны, например, в Tenside, Band 7 (1970), S. 125-132. Кроме того, протеолитическая активность может быть определена по высвобождению хромофора в виде пара-нитроанилина (pNA) из субстрата suc-L-Ala-L-Ala-L-Pro-L-Phe-п-нитроанилид (suc-AAPF-pNA). Протеаза расщепляет субстрат и высвобождает pNA. Высвобождение pNA вызывает повышение поглощения при 410 нм, изменение которого во времени представляет собой меру ферментативной активности (см. Del Mar et al., 1979). Измерение осуществляют при температуре 25ºC, при pH=8,6 и при длине волны 410 нм. Время измерения составляет 5 минут при интервале измерения от 20 до 60 с. Активность протеазы предпочтительно указывают в единицах PE (протеазные единицы).

Активность амилазы определяют общепринятым в данной области техники способом. Активность амилазы предпочтительно определяют соответственно указанному далее. Амилазы превращают крахмал в глюкозу. Исследуемую пробу, содержащую 0,67% крахмала (растворимого, предварительно обработанного по методу Зулковского (обработанного глицерином при 190ºC)), инкубируют в определенных условиях реакции (трис-малеинатный буферный раствор, pH=6,5, 50ºC, 15 мин). Динитросалициловая кислота после ее прибавления и нагревания при 100ºC в щелочных условиях восстанавливается глюкозой и другими восстанавливающими сахарами до оранжево-красного красителя, который после окончания реакции определяют фотометрически при 540 нм. При этом количество высвобожденных сахаров, соответствующее окрашиванию, представляет собой меру ферментативной активности (см. Sumner et al., J. Biol. Chem., 1921, 47 & 1924, 62).

Более предпочтительно выявляют наличие ферментной стабилизации в смысле настоящего изобретения соответственно указанному ранее при применении содержащего протеазу и амилазу жидкого моющего или чистящего средства, которое хранят в течение четырех недель при температуре 40ºC, причем протеолитическую активность определяют по высвобождению хромофора в виде пара-нитроанилина (pNA) из субстрата suc-AAPF-pNA, а амилолитическую активность определяют соответственно указанному ранее.

Протеаза, содержащаяся в моющем или чистящем средстве по настоящему изобретению, содержит аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 70% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E или R99D в комбинации по меньшей мере с двумя другими заменами аминокислот, выбранных из группы, в которую входят S3T, V4I и V199I.

В другом варианте осуществления настоящего изобретения протеаза содержит аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E в комбинации по меньшей мере с двумя другими заменами аминокислот, выбранных из группы, в которую входят S3T, V4I и V199I.

В другом варианте осуществления настоящего изобретения протеаза содержит аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99D в комбинации по меньшей мере с двумя другими заменами аминокислот, выбранных из группы, в которую входят S3T, V4I и V199I.

SEQ ID NO. 1 представляет собой последовательность зрелой (находящейся в состоянии зрелости) щелочной протеазы, происходящей из Bacillus lentus DSM 5483 и описанной в международной заявке WO 92/21760, на описание которой в настоящем тексте дается прямая ссылка.

Особенно предпочтительными по настоящему изобретению протеазами являются:

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E в комбинации с заменами аминокислот S3T и V4I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот S3T, V4I и R99E;

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E в комбинации с заменами аминокислот S3T и V199I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот S3T, R99E и V199I;

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E в комбинации с заменами аминокислот V4I и V199I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот V4I, R99E и V199I;

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99D в комбинации с заменами аминокислот S3T и V4I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот S3T, V4I и R99D;

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99D в комбинации с заменами аминокислот S3T и V199I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот S3T, R99D и V199I;

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98, 98,5 и 98,8% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99D в комбинации с заменами аминокислот V4I и V199I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот V4I, R99D и V199I.

Другие, особенно предпочтительные варианты протеаз по настоящему изобретению отличаются тем, что в них имеются замены аминокислоты R99E или R99D в комбинации с тремя другими заменами аминокислот S3T, V4I и V199I. В связи с этим наиболее предпочтительными являются следующие протеазы:

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98 и 98,5% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E в комбинации с заменами аминокислот S3T, V4I и V199I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот S3T, V4I, R99E и V199I. Протеаза такого типа указана в SEQ ID NO. 2;

протеаза, содержащая аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 90,5%, 91%, 91,5%, 92%, 92,5%, 93%, 93,5%, 94%, 94,5%, 95%, 95,5%, 96%, 96,5%, 97%, 97,5%, 98% и 98,5% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99D в комбинации с заменами аминокислот S3T, V4I и V199I, предпочтительно протеаза соответственно SEQ ID NO. 1 с заменами аминокислот S3T, V4I, R99D и V199I. Протеаза такого типа указана в SEQ ID NO. 3.

Другие, особенно предпочтительные протеазы представляют собой протеазы соответственно описанному ранее, которые, кроме того, в положении 211 в перечне последовательности соответственно SEQ ID NO. 1 содержат аминокислоту лейцин (L).

Положения аминокислот по настоящему изобретению определяют посредством выравнивания аминокислотной последовательности применяемой протеазы с аминокислотной последовательностью протеазы, происходящей из Bacillus lentus, соответственно указанному в SEQ ID NO. 1. Так как протеаза, происходящая из Bacillus lentus, на предшествующем уровне техники представляет собой важное сравнительное соединение для описания протеаз и замен аминокислот, то при идентификации положений аминокислот следует предпочтительно принимать во внимание перечень последовательности протеазы, происходящей из Bacillus lentus (SEQ ID NO. 1). В дальнейшем перечень последовательности выверяется по зрелому (находящемуся в состоянии зрелости) белку. Эту идентификацию следует применять, в частности, также тогда, когда в аминокислотную последовательность применяемой протеазы входит большее число аминокислотных остатков по сравнению с протеазой, происходящей из Bacillus lentus, соответственно SEQ ID NO. 1. Исходя из указанных положений в аминокислотной последовательности протеазы, происходящей из Bacillus lentus, положения аминокислот в протеазе, применяемой по настоящему изобретению, соответствуют положениям, которые соотнесены именно с этими положениями при выравнивании.

Наряду с положением 99 особенно предпочтительными положениями являются положения 3, 4, 199 и 211, идентифицируемые в выравнивании с SEQ ID NO. 1, и тем самым, в перечне последовательности соответственно SEQ ID NO. 1. В указанных положениях в молекуле протеазы естественного происхождения, происходящей из Bacillus lentus, находятся следующие аминокислотные остатки: S3, V4, V199 и L211. Таким образом, в зависимости от числа имеющихся случаев отклонения последовательности от SEQ ID NO. 1 различные максимальные степени идентичности, которыми может характеризоваться протеаза, применяемая по настоящему изобретению, по сравнению с SEQ ID NO. 1, достигаются собственно тогда, когда она по всем остальным аминокислотам должна совпадать с SEQ ID NO. 1. Это обстоятельство следует принимать во внимание в конкретном случае в отношении любой возможной комбинации изменений последовательности, предложенных по настоящему изобретению, и, кроме того, также в зависимости от длины аминокислотной последовательности протеазы. Например, максимальная идентичность при трех, четырех, пяти, шести, семи, восьми или девяти случаях изменения последовательности составляет 98,88, 98,51, 98,14, 97,77, 97,40, 97,03 или 96,65% в случае аминокислотной последовательности длиной в 269 аминокислот или 98,91, 98,55, 98,18, 97,82, 97,45, 97,09 или 96,73% в случае аминокислотной последовательности длиной в 275 аминокислот.

По настоящему изобретению оказалось, что благодаря добавке такой протеазы к жидкому моющему или чистящему средству, содержащему амилазу, получают жидкое моющее средство, являющееся особенно стабильным при хранении, в частности, в отношении его остаточной эффективности очистки после хранения, в частности, после хранения более предпочтительно в течение 24 часов, 48 часов, 72 часов, 5 дней, 1 недели, 2 недель, 3 недель или 4 недель.

Протеаза, содержащаяся в моющем или чистящем средстве по настоящему изобретению, обладает протеолитической активностью, т.е. она способна вызывать гидролиз пептидных связей полипептида или белка. Таким образом, она представляет собой фермент, который катализирует гидролиз пептидных связей и вследствие этого в состоянии расщеплять пептиды или белки. Она представляет собой предпочтительно субтилазу и более предпочтительно субтилизин.

Амилаза представляет собой фермент соответственно описанному ранее. В случае амилаз могут быть использованы синонимичные термины, например 1,4-альфа-D-глюканглюканогидролаза или гликогеназа. Приемлемые для расфасовки амилазы по настоящему изобретению предпочтительно представляют собой α-амилазы. Решающим для этого является то, чтобы фермент представлял собой α-амилазу в смысле настоящего изобретения, обладающую способностью вызывать гидролиз α-(1-4)-гликозидных связей в амилозе крахмала.

Приемлемые для расфасовки амилазы по настоящему изобретению представляют собой, например, α-амилазы, происходящие из Bacillus licheniformis, Bacillus amyloliquefaciens или Bacillus stearothermophilus, и предпочтительно амилазы, представляющие собой при применении в моющих или чистящих средствах улучшенные дальнейшие варианты. Фермент, происходящий из Bacillus licheniformis, производится предприятием Novozymes под названием Termamyl® и предприятием Danisco/Genencor под названием Purastar®ST. Другие варианты этой α-амилазы производятся предприятием Novozymes под коммерческим названием Duramyl® и Termamyl®Ultra, предприятием Danisco/Genencor под названием Purastar®OxAm и предприятием Daiwa Seiko Inc., Токио, Япония, в виде продукта Keistase®. α-Амилаза, происходящая из Bacillus amyloliquefaciens, производится предприятием Novozymes под названием BAN®, а производные варианты α-амилазы, происходящей из Bacillus stearothermophilus, под названиями BSG® и Novamyl® производятся также предприятием Novozymes. Приемлемой для этой цели следует отметить также α-амилазу, происходящую из Bacillus sp. A 7-7 (DSM 12368), и циклодекстринглюканотрансферазу (CGT-азу), происходящую из Bacillus agaradherens (DSM 9948). Приемлемыми для применения являются также продукты слияния всех указанных соединений. Кроме того, приемлемыми являются другие варианты α-амилазы, происходящие из Aspergillus niger и A. oryzae и реализуемые предприятием Novozymes под коммерческим названием Fungamyl®. Другие предпочтительно приемлемые для применения коммерческие продукты представляют собой, например, Amylase-LT® и Stainzyme® или Stainzyme ultra®, или Stainzyme plus®, причем последние производятся также предприятием Novozymes. По настоящему изобретению могут быть использованы также варианты этих ферментов, получаемые точечными мутациями. Особенно предпочтительные амилазы описаны в международных заявках WO 00/60060, WO 03/002711, WO 03/054177 и WO 07/079938, описание которых в связи с этим прямо рекомендуется и на содержание описания которых в связи с этим прямо приводятся ссылки в настоящей заявке.

Предпочтительно приемлемыми для применения в средствах по настоящему изобретению являются варианты α-амилазы, такие, как α-амилаза AA560 соответственно SEQ ID NO. 4. Следующие варианты являются особенно предпочтительными.

(a) Вариант α-амилазы, которая по сравнению с α-амилазой AA560 соответственно SEQ ID NO. 4 содержит два, три, четыре, пять или шесть следующих изменений последовательности в перечне последовательности α-амилазы AA560: R118K, D183* (делеция), G184* (делеция), N195F, R320K, R458K. Более предпочтительно вариант α-амилазы содержит все шесть указанных изменений последовательности.

(b) Вариант α-амилазы, которая по сравнению с α-амилазой AA560 соответственно SEQ ID NO. 4, содержит следующие изменения последовательности (в перечне последовательности α-амилазы AA560):

(1) M9L/M202I;

(2) M9L/M202I/M323T;

(3) M9L/M202I/M323T/M382Y;

(4) M9L/M202I/Y295F/A339S;

(5) M9L/M202I/Y295F;

(6) M9L/M202I/A339S;

(7) M9L/M202I/Y295F/A339S;

(8) M9L/M202I/Y295F/A339S/E345R;

(9) M9L/G149A/M202I/Y295F/A339S/E345R;

(10) M9L/M202L;

(11) M9L/M202L/M323T;

(12) M9L/M202L/M323T/M382Y;

(13) M9L/M202L/Y295F/A339S;

(14) M9L/M202L/Y295F;

(15) M9L/M202L/A339S;

(16) M9L/M202L/Y295F/A339S;

(17) M9L/M202L/Y295F/A339S, E345R;

(18) M9L/G149A/M202L/Y295F/A339S/E345R;

(19) M9L/M202T;

(20) M9L/M202T/M323T;

(21) M9L/M202T/M323T/M382Y;

(22) M9L/M202T/Y295F/A339S;

(23) M9L/M202T/Y295F;

(24) M9L/M202T/A339S;

(25) M9L/M202T/Y295F/A339S;

(26) M9L/M202T/Y295F/A339S/E345R;

(27) M9L/G149A/M202T/Y295F/A339S/E345R;

(28) M9L/G149A/M202I/V214T/Y295F/N299Y/M323T/A339S/E345R;

(29) M9L/G149A/M202L/V214I/Y295F/M323T/A339S/E345R/M382Y;

(30) M9L/G149A/G182T/G186A/M202I/V214I/Y295F/N299Y/M323T/A339S;

(31) M9L/G149A/G182T/G186A/M202L/T257I/Y295F/N299Y/M323T/A339S/E345R;

(32) M9L/G149A/M202L/V214T/Y295F/N299Y/M323T/A339S/E345R;

(33) M9L/G149A/M202I/V214I/Y295F/M323T/A339S/E345R/M382Y;

(34) M9L/G149A/G182T/G186A/M202L/V214I/Y295F/N299Y/M323T/A339S;

(35) M9L/G149A/G182T/G186A/M202I/T257I/Y295F/N299Y/M323T/A339S/E345R;

(36) M9L/G149A/M202I/V214T/Y295F/N299Y/M323T/A339S/E345R/N471E;

(37) M9L/G149A/M202L/V214I/Y295F/M323T/A339S/E345R/M382Y/N471E;

(38) M9L/G149A/G182T/G186A/M202I/V214I/Y295F/N299Y/M323T/A339S/N471E;

(39) M9L/G149A/G182T/G186A/M202L/T257I/Y295F/N299Y/M323T/A339S/E345R/N471E;

(40) M202L/M105F/M208F;

(41) G133E/M202L/Q361E;

(42) G133E/M202L/R444E;

(43) M202L/Y295F;

(44) M202L/A339S;

(45) M202L/M323T;

(46) M202L/M323T/M309L;

(47) M202L/M323T/M430I;

(48) M202L/V214T/R444Y;

(49) M202L/N283D/Q361E;

(50) M202L/M382Y/K383R;

(51) M202L/K446R/N484Q;

(52) M202I/Y295F;

(53) M202I/A339S;

(54) M202I/M105F/M208F;

(55) G133E/M202I/Q361E;

(56) G133E/M202I/R444E;

(57) M202I/M323T;

(58) M202I/M323T/M309L;

(59) M202I/M323T/M430I;

(60) M202I/V214T/R444Y;

(61) M202I/N283D/Q361E;

(62) M202I/M382Y/K383R;

(63) M202I/K446R/N484Q;

(64) M202V/M105F/M208F;

(65) G133E/M202V/Q361E;

(66) G133E/M202V/R444E;

(67) M202V/M323T;

(68) M202V/M323T/M309L;

(69) M202V/M323T/M430I;

(70) M202V/M323T/M9L;

(71) M202V/V214T/R444Y;

(72) M202V/N283D/Q361E;

(73) M202V/M382Y/K383R;

(74) M202V/K446R/N484Q;

(75) M202T/M105F/M208F;

(76) G133E/M202T/Q361E;

(77) G133E/M202T/R444E;

(78) M202T/Y295F;

(79) M202T/A339S;

(80) M202T/M323T;

(81) M202T/M323T/M309L;

(82) M202T/M323T/M430I;

(83) M202T/M323T/M9L;

(84) M202T/V214T/R444Y;

(85) M202T/N283D/Q361E;

(86) M202T/A339S;

(87) M202T/Y295F;

(88) M202T/N299F,Y;

(89) M202T/M382Y/K383R или

(90) M202T/K446R/N484Q.

В данном случае наиболее предпочтительными являются следующие варианты α-амилазы:

(10) M9L/M202L4;

(28) M9L/G149A/M202I/V214T/Y295F/N299Y/M323T/A339S/E345R;

(31) M9L/G149A/G182T/G186A/M202L/T257I/Y295F/N299Y/M323T/A339S/E345R;

(35) M9L/G149A/G182T/G186A/M202I/T257I/Y295F/N299Y/M323T/;

(38) M9L/G149A/G182T/G186A/M202I/V214I/Y295F/N299Y/M323T/;

(39) M9L/G149A/G182T/G186A/M202L/T257I/Y295F/N299Y/M323T/A339S/E345R/N471E;

(45) M202L/M323T;

(46) M202L/M323T/M309L;

(62) M202I/M382Y/K383R;

(68) M202V/M323T/M309L;

(73) M202V/M382Y/K383R;

(82) M202T/M323T/M430I или

(84) M202T/V214T/R444Y.

(c) Вариант α-амилазы соответственно пункта (b), который дополнительно содержит все шесть изменений последовательности, указанных в пункте (a), причем в данном случае наиболее предпочтительным является вариант 31 с шестью изменениями последовательности, указанными в пункте (a).

Наиболее предпочтительным по настоящему изобретению является указанный ранее в пункте (a) вариант α-амилазы, а также указанный в пункте (c) вариант α-амилазы 31 с шестью изменениями последовательности, указанными в пункте (a).

Определение идентичности последовательностей нуклеиновых кислот или аминокислотных последовательностей осуществляют посредством сравнения последовательностей. Такое сравнение осуществляют так, чтобы сопоставлять друг с другом похожие последовательности в нуклеотидных или аминокислотных последовательностях. Это сравнение последовательностей предпочтительно осуществляют в основе разработанного и традиционно используемого на предшествующем уровне техники алгоритма BLAST (см., например, Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J. (1990) "Basic local alignment search tool.", J. Mol. Biol. 215:403-410, и Altschul, Stephan F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Hheng Zhang, Webb Miller, and David J. Lipman (1997): "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs"; Nucleic Acids Res., 25, S. 3389-3402) и принципиально реализуют так, чтобы похожие последовательности нуклеотидов или аминокислот в последовательностях нуклеиновых кислот или аминокислотных последовательностях сопоставлять друг с другом. Представленное в виде таблицы сопоставление соответствующих положений называют выравниванием. Другой алгоритм, применяемый на предшествующем уровне техники, представляет собой алгоритм FASTA. Сравнения последовательностей (выравнивания), в частности множественные сравнения последовательностей, как правило, осуществляют, используя компьютерные программы. Например, часто используют программу серии Clustal (см., например, Chenna et al. (2003): Multiple sequence alignment with the Clustal series of programs. Nucleic Acid Research 31, 3497-3500), T-Coffee (см., например, Notredame et al. (2000): T-Coffee: A novel method for multiple sequence alignments. J. Mol. Biol. 302, 205-217) или программы, которые базируются на этих программах или алгоритмах. По настоящему изобретению сравнения и выравнивания последовательностей предпочтительно осуществляют, используя компьютерную программу Vector NTI® Suite 10.3 (Invitrogen Corporation, 1600 Фарадей авеню, Карлсбад, Калифорния, США) с заданными стандартными (типовыми) параметрами.

Такое сравнение позволяет сделать оценку идентичности сравненных последовательностей относительно друг друга. Она указывается, как правило, в процентах идентичности, т.е. в доле идентичных нуклеотидов или аминокислотных остатков в одних и тех же положениях или в положениях, соответствующих относительно друг друга в выравнивании. Принятый далее термин "гомология" относится в случае аминокислотных последовательностей к консервативным заменам аминокислот, т.е. одной или нескольких аминокислот с похожими свойствами, так как внутри белка они отвечают большей частью за похожую активность или функции. В связи с этим идентичность сравненных последовательностей также может быть указана как процентная доля гомологичности или процентная доля идентичности. Данные по идентичности и/или гомологичности могут относиться к полипептидам или генам в целом или только к отдельным зонам. В связи с этим гомологичные или идентичные зоны различных последовательностей нуклеиновых кислот или аминокислотных последовательностей определяют по совпадениям в последовательностях. Часто они имеют одинаковые или похожие функции. Они могут иметь малый размер и содержать только немногие нуклеотиды или аминокислоты. Часто такие малые зоны исполняют функции, являющиеся существенными для общей активности белка. В связи с этим может быть рациональным связывание совпадений последовательностей только с отдельными по возможности малыми зонами. Если не указано иное, данные по идентичности или гомологичности, приведенные в настоящем описании, относятся к общей длине соответствующей указанной последовательности нуклеиновой кислоты или аминокислотной последовательности.

В другом варианте осуществления настоящего изобретения моющее или чистящее средство по настоящему изобретению, кроме того, отличается тем, что его эффективность очистки соответствует по меньшей мере эффективности моющего или чистящего средства, содержащего протеазу, которая содержит аминокислотную последовательность, соответствующую аминокислотной последовательности, указанной в SEQ ID NO. 2 или SEQ ID NO. 3 и более предпочтительно в SEQ ID NO. 2. Эффективность очистки определяют в моющей системе, содержащей моющее средство, содержащее амилазу, с дозой в интервале от 4,0 до 11,0 г в литре моющего раствора и также протеазу, причем сравниваемые протеазы применяют с равной концентрацией (в пересчете на активный белок), а эффективность очистки от загрязнений мясным фаршем и/или яичным желтком на посуде оценивают посредством определения остатка соответствующего загрязнения после стадии мытья, причем стадию мытья осуществляют по меньшей мере в течение 30 минут, предпочтительно в течение 60 минут, при температуре 50ºC, а вода имеет жесткость в интервале от 15,5 до 16,5º dH (немецкие градусы жесткости).

В случае моющего средства для моющей системы предпочтительным является двухкомпонентное жидкое средство для машинного мытья посуды, имеющее приведенный далее состав (все данные указаны в процентах по массе).

(a) Ферментный компонент:

Основообразователь 15,0-20,0;
Cахарный спирт 8,0-12,0;
Неионогенное поверхностно-активное вещество (этоксилат жирного спирта C8-C10 с 22 звеньями EO) 3,0-5,0;
Щелочное соединение (основание) 3,0-4,0;
Борная кислота 2,5-3,5;
Фосфонат (HEDP) 1,5-2,5;
Амилаза 1,0-2,0;
Протеаза см. текст;
Соль Ca 0,8-1,2;
Соль Zn 0,15-0,25;
Загуститель 0,8-1,2;
Краситель, отдушка, консервант 0,25-0,5;
Вода до 100.

Амилаза предпочтительно представляет собой композицию варианта α-амилазы, которая по сравнению с α-амилазой AA560 соответственно SEQ ID NO. 4 содержит следующие изменения последовательности в перечне последовательности α-амилазы AA560: R118K, D183* (делеция), G184* (делеция), N195F, R320K, R458K (компания Novozymes).

(b) Щелочной компонент:

Основообразователь 7,5-12,5;
Карбонат натрия 7,5-12,5;
Сульфополимер 5,0-8,0;
Щелочное соединение (основание) 3,0-5,0;
Моноэтаноламин 2,0-4,0;
Фосфонат (HEDP) 2,0-5,0;
Загуститель 0,8-1,2;
Краситель, отдушка, консервант 0,25-0,5;
Вода до 100.

Протеаза содержится в средстве с концентрацией 0,01-1% масс. и предпочтительно от 0,1 до 0,5% масс. в пересчете на активный белок. Для осуществления процесса мытья в посудомоечной машине оба компонента дозируют в равных частях (соответственно по 20 г каждого компонента). Мытье осуществляют при значениях pH в интервале от pH=9 до pH=10 в традиционной посудомоечной машине, например в посудомоечной машине G698SC компании Miele. Как активность протеазы, так и активность амилазы в моющем растворе на начало мытья равна нулю.

Оценку эффективности очистки осуществляют визуально соответственно стандартному способу IKW по шкале от 1 до 10, причем значение 10 соответствует лучшей оценке (остаток не наблюдается).

Более предпочтительно определение эффективности очистки в посудомоечной машине осуществляют в отношении загрязнения посуды мясным фаршем и яичным желтком с применением двухкомпонентного жидкого средства для машинного мытья посуды соответственно описанному ранее.

В другом варианте осуществления настоящего изобретения моющее или чистящее средство по настоящему изобретению, кроме того, отличается тем, что его стабильность при хранении соответствует по меньшей мере стабильности при хранении моющего или чистящего средства, содержащего протеазу, которая содержит аминокислотную последовательность, соответствующую аминокислотной последовательности, указанной в SEQ ID NO. 2 или SEQ ID NO. 3 и более предпочтительно в SEQ ID NO. 2. Такая стабильность при хранении имеет место тогда, когда моющее или чистящее средство по настоящему изобретению после хранения в течение четырех недель при 50ºC имеет равную или более высокую эффективность очистки, чем используемое для сравнения моющее или чистящее средство, причем средство по настоящему изобретению отличается от используемого для сравнения моющего или чистящего средства только содержащейся протеазой.

Более предпочтительно используемое для сравнения средство представляет собой двухкомпонентное жидкое средство для машинного мытья посуды соответственно указанному ранее, причем эффективность очистки определяют соответственно указанному ранее.

На начало хранения оба сравниваемые средства имеют равную исходную амилолитическую активность, содержат протеазу в равной концентрации в пересчете на активный фермент и с обоими средствами обращаются одинаковым образом. Протеолитическую активность в средствах определяют по высвобождению хромофора в виде пара-нитроанилина (pNA) из субстрата suc-AAPF-pNA, а их амилолитическую активность определяют соответственно указанному ранее. Исходные активности протеазы и амилазы в соответствующем средстве не равны нулю.

Благодаря применению амилазы с равной активностью и применению протеазы с равной концентрацией в пересчете на активный белок надежно обеспечивается сравнение реально имеющихся ферментативных свойств даже при возможном резком расхождении соотношения активного вещества и общего белка (значение удельной активности).

Если не указано иное, по настоящему изобретению в расчет принимают массу жидкого моющего средства, т.е. данные приводят в расчете на его массу.

Многие протеазы и, в частности, субтилизины образуются в виде так называемых препротеинов, т.е. совместно с пропептидом и сигнальным пептидом, причем функция сигнального пептида, как правило, состоит в том, чтобы обеспечивать выведение протеазы из продуцирующих ее клеток в периплазму или в среду, окружающую клетки, а пропептид необходим, как правило, для корректного свертывания протеазы. Сигнальный пептид и пропептид находятся, как правило, в N-концевой части препротеина. Сигнальный пептид в естественных условиях отщепляется от остальной части протеазы благодаря сигнальной пептидазе. Затем происходит корректное конечное свертывание протеазы, поддерживаемое пропептидом. Далее протеаза находится в своей активной форме и отщепляет собственно пропептид. После отщепления пропептида зрелая (находящаяся в состоянии зрелости) протеаза, в частности субтилизин, проявляет свою каталитическую активность без первоначально имевшихся N-концевых аминокислот. Для технического применения, в общем случае и в частности в рамках настоящего изобретения, предпочтительными по сравнению с препротеинами являются зрелые (находящиеся в состоянии зрелости) протеазы, т.е. ферменты, обработанные после своего получения. Кроме того, протеазы могут быть модифицированы после получения полипептидной цепи из продуцирующих их клеток, например, путем присоединения молекул сахаров, формилирования, аминирования и т.д. Такие модификации представляют собой посттрансляционные модификации и могут, должны не оказывать влияния на функции протеазы.

Кроме того, зрелая протеаза также может быть укорочена в своих N-концевых и/или C-концевых частях, так что в моющем или чистящем средстве по настоящему изобретению может содержаться укороченная протеаза, т.е. фрагмент, по сравнению с SEQ ID NO. 1 или SEQ ID NO. 2, или SEQ ID NO. 3. В этом случае все данные по идентичности относятся к той зоне, в которой сопоставлен соответствующий фрагмент в выравнивании SEQ ID NO. 1. Однако соответствующий фрагмент в любом случае включает в себя те положения, которые сопоставлены с положениями 3, 4, 99 и/или 199 в выравнивании с SEQ ID NO. 1, и содержит здесь соответствующие изменения, предусмотренные настоящим изобретением. Кроме того, такой фрагмент является протеолитически активным. В связи с этим более предпочтительный фрагмент содержит аминокислотную последовательность, которая по длине относительно по меньшей мере 100 или по меньшей мере 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 265 или 266 взаимосвязанных положений аминокислот совпадает с SEQ ID NO. 1 или SEQ ID NO. 2, или SEQ ID NO. 3 с учетом указанных ранее аминокислот в положении 99 и, кроме того, в положениях 3 и/или 4, и/или 199, и/или 211. Более предпочтительно эффективность очистки и/или стабильность при хранении жидкого моющего или чистящего средства по настоящему изобретению с таким фрагментом соответствуют по меньшей мере свойствам моющего или чистящего средства, содержащего протеазу, которая содержит аминокислотную последовательность, соответствующую аминокислотной последовательности, указанной в SEQ ID NO. 2 или SEQ ID NO. 3, при их определении соответственно указанному ранее.

Средство по настоящему изобретению содержит протеазу более предпочтительно в количестве 1×10-8-5% масс., 0,0001-3% масс., 0,0005-1% масс., от 0,001 до 0,75% масс. и наиболее предпочтительно от 0,005 до 0,5% масс. в пересчете на активный белок. Средство по настоящему изобретению содержит амилазу более предпочтительно в количестве 1×10-8-5% масс., 0,0001-3% масс., 0,0005-1% масс., от 0,001 до 0,75% масс. и наиболее предпочтительно от 0,005 до 0,5% масс. в пересчете на активный белок. Концентрация белка может быть определена известным способом, например, по реакции с BCA (бицинхониновая кислота; 2,2'-бихинолил-4,4'-дикарбоновая кислота) или по биуретовой реакции (A.G. Gornall, C.S. Bardawill and M.M. David, J. Biol. Chem., 177 (1948), S. 751-766). В связи с этим определение концентрации активного белка осуществляют титрованием активных центров с применением приемлемого необратимого ингибитора (например, фенилметилсульфонилфторида (PMSF) в случае протеазы) и определением остаточной активности (см. M. Bender et al., J. Am. Chem. Soc. 88, 24 (1966), S. 5890-5913).

Кроме того, протеаза и/или амилаза может быть адсорбирована веществами-носителями и/или покрыта веществами, образующими оболочку, с целью защиты их от преждевременной инактивации. Затем в моющем растворе, т.е. в условиях применения, фермент высвобождается и может проявлять свое каталитическое действие.

В другом варианте осуществления настоящего изобретения моющее или чистящее средство отличается тем, что оно содержит дополнительно компонент, выбранный из:

i. анионного и/или полианионного вещества, и/или

ii. катионного и/или поликатионного вещества, и/или

iii. вещества, содержащего одну или несколько гидроксильных и/или полигидроксильных групп.

Было установлено, что добавка таких веществ улучшает очищающую эффективность моющих и чистящих средств, предпочтительно жидких моющих или чистящих средств, содержащих протеазы и амилазы, предпочтительно соответствующие описанному ранее, в частности, при сравнительно низких температурах предпочтительно в интервале от 10 до 50ºC, от 10 до 40ºC, от 10 до 30ºC и/или от 20 до 40ºC. В частности, в комбинации с протеазой, применяемой по настоящему изобретению, наблюдается синергическое действие, в первую очередь, в отношении удаления по меньшей мере одного вида чувствительных к протеазе загрязнений, предпочтительно загрязнений соответственно указанному ранее.

В случае веществ, указанных в пункте i, речь идет о анионных или полианионных веществах, т.е. о веществах, несущих по меньшей мере один и предпочтительно несколько отрицательных зарядов. Предпочтительно речь идет о полимере, образованном по меньшей мере из одного вида отрицательно заряженного мономера и предпочтительно из нескольких видов отрицательно заряженных мономеров. В связи с этим предпочтительный по настоящему изобретению полимер представляет собой отрицательно заряженный полимер. Предпочтительными являются, например, полимеры, образованные из органических кислот или их солей, в частности полиакрилаты и/или полисахарные кислоты, и/или полиакрилатные сополимеры и/или полисахаридные сополимеры. В связи с этим другими предпочтительными соединениями являются полиакрилсульфонаты или поликарбоксилаты и их соли, сополимеры или соли сополимеров.

Примеры более предпочтительно применяемых веществ представляют собой Acusol 587D (полиакрилсульфонат; предприятие Rohm & Haas/Dow Chemical), Acusol 445N (натриевая соль поликарбоксилата; предприятие Rohm & Haas/Dow Chemical), Acusol 590 (полиакрилатный сополимер; предприятие Rohm & Haas/Dow Chemical), Acusol 916 (натриевая соль полиакрилата; предприятие Rohm & Haas/Dow Chemical), Sokalan CP42 (модифицированная натриевая соль поликарбоксилата; предприятие BASF), Sokalan PA 30CL (натриевая соль поликарбоксилата; предприятие BASF), Dequest P 9000 (полималеиновая кислота; предприятие Thermphos), альгиновая кислота, поли-2-акриламидо-2-метил-1-пропансульфоновая кислота, натриевая соль сополимера 4-стиролсульфоновой кислоты и малеиновой кислоты, натриевая соль сополимера акриламида и акриловой кислоты, натриевая соль полиметакриловой кислоты, сополимер метилвинилового эфира и малеиновой кислоты или натриевая соль поливинилсульфоновой кислоты.

В случае веществ, указанных в пункте ii, речь идет о катионных или поликатионных веществах, т.е. о веществах, несущих по меньшей мере один и предпочтительно несколько положительных зарядов. Предпочтительно речь идет о полимере, образованном по меньшей мере из одного вида положительно заряженного мономера и предпочтительно из нескольких видов положительно заряженных мономеров. В связи с этим предпочтительный по настоящему изобретению полимер представляет собой положительно заряженный полимер. Примеры предпочтительных в связи с этим соединений представляют собой соли полиаминов, полиэтилениминов или их сополимеров, соли полиаллиламинов, соли соединений полидиаллилдиметиламмония или сополимер акриламида и соединений диаллилдиметиламмония.

В случае веществ, указанных в пункте iii, речь идет о веществах, которые содержат по меньшей мере одну гидроксильную и/или полигидроксильную группу и предпочтительно несколько гидроксильных и/или полигидроксильных групп. В связи с этим предпочтительными являются, например, поливиниловые спирты, например спирты, реализуемые под коммерческим названием Mowiol (предприятие Kremer Pigmente GmbH & Co. KG).

В данном месте следует особо указать на то, что конкретное вещество может относиться к одной или нескольким указанным ранее группам i-iii. Например, оно может представлять собой анионный полимер, который содержит одну или несколько гидроксильных групп и/или полигидроксильных групп. Такое вещество относится, таким образом, к группам i и iii. Оно может представлять собой также катионный полимер, который содержит одну или несколько гидроксильных групп и/или полигидроксильных групп и относится к группам ii и iii.

Приемлемыми для применения по настоящему изобретению являются также производные соединения веществ, отнесенных ранее к группам i, ii или iii. Под производным соединением в смысле настоящего описания понимают такое вещество, которое исходя из указанных ранее веществ, химически модифицируют, например, путем превращения боковой цепи или за счет ковалентного связывания другого соединения с веществом. Такое соединение могут представлять собой, например, низкомолекулярные соединения, такие, как липиды или моно-, олиго- или полисахариды или амины или аминосоединения. Кроме того, вещество может быть гликозилировано, гидролизовано, окислено, N-метилировано, N-формилировано, N-ацетилировано или может содержать метил, формил, этил, ацетил, трет-бутил, анизил, бензил, трифторацетил, N-гидроксисукцинимид, трет-бутилоксикарбонил, бензоил, 4-метилбензил, тиоанизил, тиокрезил, бензилоксиметил, 4-нитрофенил, бензилоксикарбонил, 2-нитробензоил, 2-нитрофенилсульфенил, 4-толуолсульфонил, пентафторфенил, дифенилметил, 2-хлорбензилоксикарбонил, 2,4,5-трихлорфенил, 2-бромбензилоксикарбонил, 9-флуоренилметилоксикарбонил, трифенилметил, 2,2,5,7,8-пентаметилхроман-6-сульфонил. Под производным соединением следует понимать также ковалентное или нековалентое связывание вещества с макромолекулярным носителем, также как и нековалентое включение в соответствующие макромолекулярные клеточные структуры. Также могут быть осуществлены сочетания с другими макромолекулярными соединениями, такими, как, например, полиэтиленгликоль. Другие предпочтительные химические модификации представляют собой превращения одной или нескольких химических групп -COOH, -OH, =NH, -NH2-SH в группы -COOR, -OR, -NHR, -NR2, -NHR, -NR, -SR; причем:

R представляет собой -CH=CH-R2, -C≡C-R2, -C(R2)=CH2, -C(R2)=C(R3), -CH=NR2, -C(R2)=N-R3, циклическую систему, содержащую 4-7 атомов C и необязательно имеющую заместители, азотсодержащий гетероцикл, содержащий 4-7 атомов и необязательно имеющий заместители, или цепь C2-C8, содержащую от 1 до 5 двойных или тройных связей и имеющую заместители, выбранные из R1, R2, или R3, причем:

-R1 представляет собой атом H, -R, -NO2, -CN, галоидный заместитель, -N3, -C1-8-алкил, -(CH2)nCO2R2, -C2-8-алкенил-CO2R2, -O(CH2)nCO2R2, -C(O)NR2R3, -P(O)(OR2)2, алкилзамещенный тетразол-5-ил, -(CH2)nO(CH2)n-арил, -NR2R3, -(CH2)nOR2, -(CH2)nSR2, -N(R2)C(O)R3, -S(O2)NR2R3, -N(R2)S(O2)R3, -(CHR2)nNR2R3, -C(O)R3, (CH2)nN(R3)C(O)R3, -N(R2)CR2R3, замещенный или не замещенный (CH2)n-циклоалкил, замещенный или не замещенный (CH2)n-фенил или -цикл; причем n представляет собой число, превышающее 1;

-R2 представляет собой атом H, галоидный заместитель, -алкил, -галогеналкил, -(CH2)n-фенил, -(CH2)1-3-бифенил, -(CH2)1-4-Ph-N(SO2-C1-2-алкил)2, -CO(CHR1)n-OR1, -(CHR1)n-гетероцикл, -(CHR1)n-NH-CO-R1, -(CHR1)n-NH-SO2R1, -(CHR1)n-Ph-N(SO2-C1-2-алкил)2, -(CHR1)n-C(O)(CHR1)-NHR1, -(CHR1)n-C(S)(CHR1)-NHR1, -(CH2)nO(CH2)NCH3, -CF3, -C2-5-ацил, -(CHR1)nOH, -(CHR1)nCO2R1, -(CHR1)n-O-алкил, -(CHR1)n-O-(CH2)n-O-алкил, -(CHR1)n-S-алкил, -(CHR1)n-S(O)-алкил, -(CHR1)n-S(O2)-алкил, -(CHR1)n-S(O2)-NHR3, -(CHR3)n-N3, -(CHR3)nNHR4, цепь C2-C8-алкена, содержащую от 1 до 5 двойных связей, цепь C2-C8-алкина, содержащую от 1 до 5 тройных связей, замещенный или незамещенный -(CHR3)n-гетероцикл, замещенный или незамещенный насыщенный или ненасыщенный -(CHR3)n-циклоалкил; причем n представляет собой число, превышающее 1, а R1 и R3 могут быть одинаковыми или разными;

-R3 представляет собой атом H, -OH, -CN, замещенный алкил, -C2-C8-алкенил, замещенный или незамещенный циклоалкил, -N(R1)R2, насыщенный или ненасыщенный C5-C7-гетероцикл или гетеробицикл, содержащий от 4 до 7 атомов C, -NR1, -NR2, группировку -NR1R2, состоящую из насыщенного или ненасыщенного гетероцикла или гетеробицикла, содержащего от 4 до 7 атомов C;

-R4 представляет собой атом H, -(CH2)nOH, -C(O)OR5, -C(O)SR5, -(CH2)nC(O)NR6R7, -O-C(O)-O-R6, аминокислоту или пептид; причем n представляет собой число в интервале от 0 до 4;

-R5 представляет собой атом H;

-R6 представляет собой -C(R7)-(CH2)n-O-C(O)-R8, -(CH2)n-C(R7)-O-C(O)R8, -(CH2)n-C(R7)-O-C(O)-O-R8 или -C(R7)-(CH2)n-O-C(O)-O-R8; причем n представляет собой число в интервале от 0 до 4;


-R7 и R8 представляют собой соответственно атом H, алкил, замещенный алкил, арил, замещенный арил, алкенил, замещенный алкенил, алкинил, замещенный алкинил, гетероцикл, замещенный гетероцикл, алкиларил, замещенный алкиларил, циклоалкил, замещенный циклоалкил или CH2CO2-алкил, причем R7 и R8 могут быть одинаковыми или разными.

Кроме того, по настоящему изобретению можно применять любые возможные комбинации веществ и/или их производных соединений, отнесенных ранее к группам i, ii или iii.

Жидкое моющее или чистящее средство по настоящему изобретению может быть использовано в исходном виде или после разбавления водой для очистки текстильных изделий и/или твердых поверхностей. Такое разбавление может быть легко осуществлено благодаря тому‚ что отмеренное количество средства разбавляют в принятом количестве воды в определенных массовых соотношениях "средство:вода" и разбавляемую смесь при необходимости встряхивают для обеспечения равномерного распределения средства в воде. Возможные массовые или объемные соотношения разбавления находятся в интервале от 1:0 до 1:10000 или 1:20000 смеси "средство:вода" и предпочтительно в интервале от 1:10 до 1:2000 смеси "средство:вода".

При этом жидкое моющее или чистящее средство может быть использовано в любой жидкой или текучей форме. При этом "текучим" в смысле настоящего описания является средство, которое может литься и вязкость которого может составлять до нескольких 10000 мПа·с. Вязкость может быть определена традиционными стандартными способами (например, вискозиметром Brookfield LVT-II при 20 об/мин и 20ºC с шпинделем 3) и предпочтительно находится в интервале от 5 до 30000 мПа·с. Предпочтительные средства имеют вязкость от 10 до 15000 мПа·с, причем значения в интервале от 120 до 8000 мПа·с являются более предпочтительными. В связи с этим жидкое моющее или чистящее средство по настоящему изобретению может быть также гелеобразным или пастообразным, оно может также представлять собой гомогенный раствор или суспензию, а также может быть расфасовано, например, в форме для разбрызгивания или в прочих традиционных формах применения. К моющим средствам относят любые возможные типы моющих средств, в частности моющие средства для текстильных изделий, ковров или натуральных волокон. Они могут быть предусмотрены для ручного и/или также машинного применения. Кроме того, к моющим средствам относят вспомогательные моющие средства, прибавляемые при ручной или машинной стирке текстильных изделий к собственно моющему средству с целью достижения другого эффекта. К чистящим средствам относят любые, в том числе любые указанные формы применения имеющихся средств для очистки и/или дезинфекции твердых поверхностей, средства для ручного и машинного мытья посуды, чистящие средства для ковров, чистящие средства с абразивным действием, стеклоочистители, ароматизированные чистящие средства для туалета и т.д. Наконец, к средствам для предварительной и дополнительной обработки текстильных изделий, с одной стороны, относят средства, с которыми стираемое изделие приводят в контакт перед собственно стиркой, например для первичного растворения устойчивых загрязнений, а с другой стороны, относят средства, которые на стадиях, следующих за собственно стиркой текстильных изделий, придают стираемым изделиям другие желательные свойства, такие, как приятный гриф, несминаемость или незначительное накопление статического заряда. К указанным средствам относят, в том числе, мягчители. Дезинфицирующие средства представляют собой, например, средства для дезинфекции рук, средства для дезинфекции поверхностностей и средства для дезинфекции инструментов, которые также могут быть использованы в указанных формах применения.

В другом предпочтительном варианте осуществления настоящего изобретения моющее или чистящее средство отличается тем, что оно содержит по меньшей мере один другой ингредиент, предпочтительно ингредиент, выбранный из группы, в которую входят фосфонат, поверхностно-активное вещество, основообразующее вещество (основообразователь), неводный растворитель, кислота, водорастворимая соль, загуститель, а также их комбинации.

Фосфонаты представляют собой соли и органические соединения фосфоновой кислоты, в частности сложные эфиры. Соли представляют собой первичные (M'H2PO3 или HP(O)(OH)(OM')) и вторичные (M'2HPO3 или HP(O)(OM')2) фосфонаты, причем M' означает одновалентный металл. Эти неорганические фосфонаты называют также первичными или вторичными фосфитами. Неорганические фосфонаты образуются, например, при взаимодействии фосфоновой кислоты HP(O)(OH)2, в частности стабильной таутомерной формы фосфористой кислоты, с одним (первичным) или двумя (вторичными) эквивалентами основания, например гидроксида щелочного металла. Предпочтительными по настоящему изобретению являются органические P-замещенные фосфонаты, содержащие связь "фосфор-углерод" (фосфорорганические соединения). Их общая структура соответствует формуле R1P(O)(OR2)2, где R1 и/или R2=алкил, арил или атом H, причем алкилы или арилы имеют другие заместители или могут быть связаны с другими химическими группами. Органические P-замещенные фосфонаты образуются, например, по реакции Михаэлиса-Арбузова. Многие из этих фосфонатов растворимы в воде. Некоторые технически важные фосфонаты содержат, кроме того, одну или несколько аминогрупп в виде NR-(CH2)x-PO(OH)2 (R=алкил, арил или атом H). Некоторые из этих аминофосфонатов имеют структурное сходство с комплексообразователями, такими, как EDTA, NTA или DTPA, и обладают похожими функциями. К более предпочтительным фосфонатам по настоящему изобретению относятся, в частности, органофосфонаты, такие, как, например, 1-гидроксиэтан-1,1-дифосфоновая кислота (HEDP), аминотриметиленфосфоновая кислота (ATMP, обозначаемая также как амино-трис-(метилен)фосфоновая кислота или нитрилотрис(метилен)фосфоновая кислота (NTMP)), диэтилентриаминпента(метилен)фосфоновая кислота (DTPMP или DETPMP или DTPNT), этилендиаминтетра(метилен)фосфоновая кислота (EDTMP, обозначаемая также как этилендиаминтетра(метилен)фосфоновая кислота), а также 2-фосфонобутан-1,2,4-трикарбоновая кислота (PBS-AM, обозначаемая также как 2-фосфонобутан-1,2,4-трикарбоновая кислота или 3-карбокси-3-фосфоноадипиновая кислота), которые применяют предпочтительно в форме их аммониевых солей или солей щелочных металлов. Более предпочтительной является натриевая соль диэтилентриаминпента(метилен)фосфоновой кислоты. Такой фосфонат реализуют, например, под коммерческим названием Dequest® 2066 (компания Thermphos).

Фосфонат предпочтительно содержится в моющем или чистящем средстве в количестве от 0,01 до 2,5% масс., более предпочтительно от 0,02 до 2% масс., от 0,03 до 1,5% масс. и наиболее предпочтительно от 0,05 до 1% масс.

В качестве одного или нескольких поверхностно-активных веществ могут быть использованы анионные, неионогенные, цвиттерионные и/или амфотерные поверхностно-активные вещества. Предпочтительными по технологическим условиям применения являются смеси анионных и неионогенных поверхностно-активных веществ. Общее содержание поверхностно-активных веществ в жидком моющем или чистящем средстве составляет предпочтительно меньше 60% масс. и более предпочтительно меньше 45% масс. в расчете на все жидкое моющее или чистящее средство.

К приемлемым неионогенным поверхностно-активным веществам относятся алкоксилированные жирные спирты, алкоксилированные алкиловые эфиры жирных кислот, амиды жирных кислот, алкоксилированные амиды жирных кислот, амиды жирных полигидроксикислот, простые эфиры алкилфенолполигликолей, аминооксиды, алкилполигликозиды и их смеси.

В качестве неионогенных поверхностно-активных веществ применяют предпочтительно алкоксилированные, преимущественно этоксилированные, в частности первичные спирты, которые содержат предпочтительно от 8 до 18 атомов C и в среднем от 1 до 12 моль этиленоксидных звеньев (EO) на моль спирта и в которых радикал спирта может представлять собой линейный или предпочтительно в 2 положениях связанный с метильными группами радикал или смесь линейных и связанных с метильными группами радикалов, так как они, как правило, существуют в виде радикалов оксоспиртов. При этом предпочтительными являются этоксилаты спиртов с линейными радикалами спиртов природного происхождения, которые содержат от 12 до 18 атомов C, например, из жирных спиртов кокосового, пальмового масла, животного жира или олеиловых спиртов, и в среднем от 2 до 8 звеньев EO на моль спирта. К предпочтительным этоксилированным спиртам относятся, например, спирты C12-14, содержащие 3, 4 или 7 звеньев EO, спирты C9-11, содержащие 7 звеньев EO, спирты C13-15, содержащие 3, 5, 7 или 8 звеньев EO, спирты C12-18, содержащие 3, 5 или 7 звеньев EO, и их смеси, такие, как смеси спиртов C12-14, содержащих 3 звена EO, и спиртов C12-18, содержащих 7 звеньев EO. Указанные степени этоксилирования представляют собой среднестатистические значения и в случае специального продукта могут представлять собой целые или дробные числа. Предпочтительные этоксилаты спиртов характеризуются суженным распределением гомологов (narrow range ethoxylates (узкая фракция этоксилатов), NRE). Дополнительно к этим неионогенным поверхностно-активным веществам могут быть использованы также жирные спирты, содержащие более 12 звеньев EO. Их примеры представляют собой жирные спирты животного жира, содержащие 14, 25, 30 или 40 звеньев EO. Неионогенные поверхностно-активные вещества, содержащие в молекуле совместно звенья EO и группы PO, также являются приемлемыми для применения по настоящему изобретению. Кроме того, приемлемыми являются также смеси из (более сильно) разветвленного этоксилированного жирного спирта и неразветвленного этоксилированного жирного спирта, такие, как например, смесь из жирного спирта C16-18, содержащего 7 звеньев EO, и 2-пропилгептанола, содержащего 7 звеньев EO. Более предпочтительно моющее, чистящее средство, средство для дополнительной обработки или вспомогательное моющее средство содержит в качестве неионогенного поверхностно-активного вещества жирный спирт C12-18, содержащий 7 звеньев EO, или оксоспирт C13-15, содержащий 7 звеньев EO.

Содержание неионогенных поверхностно-активных веществ в моющем или чистящем средстве составляет предпочтительно от 3 до 40% масс., более предпочтительно от 5 до 30% масс., и наиболее предпочтительно от 7 до 20% масс. соответственно в расчете на общую массу моющего или чистящего средства.

Наряду с неионогенными поверхностно-активными веществами моющее или чистящее средство может содержать также анионактивные поверхностно-активные вещества. В качестве анионактивного поверхностно-активного вещества предпочтительно применяют сульфонаты, сульфаты, мыла, алкилфосфаты, анионактивные кремнийорганические поверхностно-активные вещества и их смеси.

При этом в качестве поверхностно-активных веществ типа сульфонатов предпочтительно приемлемыми являются алкилбензолсульфонаты C9-13, олефинсульфонаты, т.е. смеси из алкен- и гидроксиалкансульфонатов, а также дисульфонаты, такие, как, например, получаемые из моноолефинов C12-18 с концевыми или внутренними двойными связями сульфонированием газообразным триоксидом серы с последующим щелочным или кислотным гидролизом продуктов сульфонирования. Приемлемыми являются также алкансульфонаты C12-18 и сложные эфиры жирных α-сульфокислот (сложные сульфоновые эфиры), например α-сульфонированный метиловый эфир жирных кислот гидрированного кокосового, пальмоядрового масла или животного жира.

В качестве алк(ен)илсульфатов предпочтительными являются соли щелочных металлов и предпочтительно натрия полуэфиров серной кислоты с жирным спиртом C12-C18, например с жирным спиртом кокосового масла, животного жира, лауриловым, миристиловым, цетиловым или стеариловым спиртом или оксоспиртом C10-C20 и соли полуэфиров вторичных спиртов с такой длиной цепи. Исходя из технологических моющих свойств предпочтительными являются алкилсульфаты C12-C16, алкилсульфаты C12-C15, а также алкилсульфаты C14-C15. 2,3-Алкилсульфаты также представляют собой приемлемые анионные поверхностно-активные вещества.

Приемлемыми являются также моноэфиры серной кислоты с линейными или разветвленными спиртами C7-21, этоксилированными этиленоксидными звеньями в числе от 1 до 6 моль, такими, как 2-метилразветвленные спирты C9-11, содержащие в среднем 3,5 моль этиленоксидных звеньев (EO), или жирные спирты C12-18, содержащие от 1 до 4 звеньев EO.

Предпочтительные анионные поверхностно-активные вещества представляют собой также мыла. Приемлемыми являются мыла из насыщенных и ненасыщенных жирных кислот, такие, как соли лауриновой, миристиновой, пальмитиновой, стеариновой, (гидрированной) эруковой и бегеновой кислот, а также, в частности, мыла из природных жирных кислот, например, смеси мыл, получаемые из жирных кислот кокосового, пальмоядрового, оливкового масла или животного жира.

Анионные поверхностно-активные вещества, включая мыла, могут существовать в форме натриевых, калиевых, магниевых или аммониевых солей. Анионные поверхностно-активные вещества предпочтительно находятся в форме натриевых солей. Другими предпочтительными противоионами для анионных поверхностно-активных веществ являются также протонированные формы холина, триэтиламина или метилэтиламина.

Содержание анионных поверхностно-активных веществ в моющем или чистящем средстве предпочтительно может составлять от 1 до 40% масс., более предпочтительно от 5 до 30% масс., и наиболее предпочтительно от 10 до 25% масс., соответственно в расчете на общую массу моющего или чистящего средства.

В качестве основообразующих веществ (основообразователей), которые могут содержаться в моющем или чистящем средстве, предпочтительно следует назвать силикаты, алюмосиликаты (в частности, цеолиты), карбонаты, соли органических ди- и поликарбоновых кислот, а также смеси этих веществ.

Органические основообразующие вещества, которые могут содержаться в моющем или чистящем средстве, находятся, например, в форме натриевых солей приемлемых для применения поликарбоновых кислот, причем под поликарбоновыми кислотами понимают карбоновые кислоты, которые содержат больше одной кислотной функциональной группы. Их примеры представляют собой лимонная, адипиновая, янтарная, глутаровая, яблочная, винная, малеиновая, фумаровая кислоты, сахарные кислоты, аминокарбоновые кислоты, нитрилотриуксусная кислота (NTA), метилглициндиуксусная кислота (MGDA) и их производные соединения, а также их смеси. Предпочтительные соли представляют собой соли поликарбоновых кислот, таких, как лимонная, адипиновая, янтарная, глутаровая, винная кислоты, сахарные кислоты и их смеси.

В качестве основообразующих веществ приемлемыми являются также полимерные поликарбоксилаты. Их примеры представляют собой соли щелочных металлов полиакриловой или полиметакриловой кислоты, например, с относительный молекулярной массой от 600 до 750000 г/моль.

Приемлемые полимеры предпочтительно представляют собой полиакрилаты, имеющие молекулярную массу предпочтительно от 1000 до 15000 г/моль. Вследствие своей превосходной растворимости предпочтительными из этой группы в свою очередь могут быть полиакрилаты с короткой цепью, имеющие молекулярную массу от 1 000 до 10000 г/моль и предпочтительно от 1 000 до 5000 г/моль.

Приемлемыми являются также сополимерные поликарбоксилаты, предпочтительно такие, как сополимеры акриловой кислоты с метакриловой кислотой и акриловой или метакриловой кислоты с малеиновой кислотой. Для улучшения растворимости в воде полимеры могут содержать также в качестве мономера аллилсульфоновые кислоты, такие, как аллилоксибензолсульфоновая кислота и металлилсульфоновая кислота.

Однако в жидких моющих или чистящих средствах предпочтительно применяют растворимые основообразующие вещества, такие, как, например, лимонная кислота, или акриловый полимер с молекулярной массой предпочтительно от 1 000 до 5000 г/моль.

В случае молекулярных масс, указанных для полимерных поликарбоксилатов, в настоящем описании речь идет о среднемассовых молекулярных массах Mw соответствующих кислотных форм, принципиально определенных способом гельпроникающей хроматографии (ГПХ) с применением УФ-детектора. При этом измерение осуществляют по сравнению с внешним стандартом полиакриловой кислоты, который на основании своего структурного сродства с исследуемыми полимерами дает реалистические значения молекулярной массы. Эти данные четко отличаются от данных по молекулярной массе, в случае которых в качестве стандарта используют полистиролсульфоновые кислоты. Значения молекулярных масс, измеренные по сравнению с полистиролсульфоновыми кислотами, как правило, четко больше значений молекулярных масс, указанных в настоящем описании.

Органические основообразующие вещества такого типа при необходимости могут содержаться в количестве до 40% масс., предпочтительно до 25% масс., и более предпочтительно от 1 до 8% масс. Количество, близкое к указанной верхней границе, предпочтительно относится к пастообразным или жидким средствам, предпочтительно содержащим воду.

Моющие или чистящие средства по настоящему изобретению являются жидкими и предпочтительно содержат воду в качестве основного растворителя. Наряду с этим в моющее или чистящее средство могут быть введены неводные растворители. Приемлемые неводные растворители представляют собой одноатомные или многоатомные спирты, алканоламины или гликолевые простые эфиры, если они могут смешиваться с водой в указанном интервале концентраций. Растворители предпочтительно выбирают из этанола, н-пропанола, изопропанола, бутанолов, гликоля, пропандиола, бутандиола, глицерина, дигликоля, пропилдигликоля, бутилдигликоля, гексиленгликоля, метилового эфира этиленгликоля, этилового эфира этиленгликоля, пропилового эфира этиленгликоля, моно-н-бутилового эфира этиленгликоля, метилового эфира диэтиленгликоля, этилового эфира диэтиленгликоля, метилового эфира пропиленгликоля, этилового эфира пропиленгликоля, пропилового эфира пропиленгликоля, монометилового эфира дипропиленгликоля, моноэтилового эфира дипропиленгликоля, монометилового эфира диизопропиленгликоля, моноэтилового эфира диизопропиленгликоля, метокситригликоля, этокситригликоля, бутокситригликоля, 1-бутоксиэтокси-2-пропанола, 3-метил-3-метоксибутанола, трет-бутилового эфира пропиленгликоля, ди-н-октилового эфира, а также смеси этих растворителей. При этом моющее или чистящее средство в качестве неводного растворителя предпочтительно содержит полиол. Полиол предпочтительно может представлять собой глицерин, 1,2-пропандиол, 1,3-пропандиол, этиленгликоль, диэтиленгликоль и/или дипропиленгликоль. Более предпочтительно моющее или чистящее средство содержит смесь из полиола и одновалентного спирта. Неводные растворители могут быть использованы в моющем или чистящем средстве в количестве от 0,5 до 15% масс. и предпочтительно меньше 12% масс.

Для установки требуемого значения pH, которое не является самопроизвольным итогом смешивания прочих компонентов, средства могут содержать кислоты, совместимые с системой и приемлемые экологически, предпочтительно лимонную, уксусную, винную, яблочную, молочную, гликолевую, янтарную, глутаровую и/или адипиновую кислоту, а также неорганические кислоты, предпочтительно серную кислоту, или основания, предпочтительно гидроксиды аммония или щелочных металлов. Регуляторы pH такого типа содержатся в средствах в количестве предпочтительно не больше 20% масс. и более предпочтительно в интервале от 1,2 до 17% масс.

Средство в смысле настоящего изобретения может содержать также одну или несколько водорастворимых солей, которые служат, например, для регулирования вязкости. При этом речь может идти о неорганических и/или органических солях. При этом приемлемые для применения неорганические соли предпочтительно выбирают из группы, в которую входят бесцветные водорастворимые галогениды, сульфаты, сульфиты, карбонаты, гидрокарбонаты, нитраты, нитриты, фосфаты и/или оксиды щелочных металлов, щелочно-земельных металлов, алюминия и/или переходных металлов; соли аммония также приемлемы для применения. При этом более предпочтительными являются галогениды и сульфаты щелочных металлов; в связи с этим предпочтительной является неорганическая соль, выбранная из группы, в которую входят хлорид натрия, хлорид калия, сульфат натрия, сульфат калия, а также их смеси. Приемлемые для применения органические соли представляют собой, например, бесцветные водорастворимые соли щелочных металлов, щелочно-земельных металлов, аммония, алюминия и/или переходных металлов с карбоновыми кислотами. Предпочтительными являются соли, выбранные из группы, в которую входят формиаты, ацетаты, пропионаты, цитраты, малаты, тартраты, сукцинаты, малонаты, оксалаты, лактаты, а также их смеси.

Средство по настоящему изобретению может содержать с целью загущения один или несколько загустителей. Предпочтительным является загуститель, выбранный из группы, в которую входят ксантановая камедь, гуаровая камедь, каррагинан, агар-агар, геллановая камедь, пектин, камедь плодов рожкового дерева и их смеси. Эти соединения являются эффективными загустителями даже в присутствии неорганических солей. В особенно предпочтительном варианте осуществления моющее или чистящее средство содержит в качестве загустителя ксантановую камедь, так как ксантановая камедь эффективно загущает даже в присутствии солей в высокой концентрации и предотвращает макроскопическое разделение сплошной фазы. Загуститель дополнительно стабилизирует сплошную фазу с низким содержанием поверхностно-активного вещества и предотвращает макроскопическое разделение фаз.

В качестве загустителя альтернативно или дополнительно могут быть использованы также (со)полимеры (мет)акриловой кислоты. Приемлемые акриловые и метакриловые (со)полимеры представляют собой, например, высокомолекулярные гомополимеры акриловой кислоты, сшитые с полиалкенилполиэфирами, предпочтительно с аллиловым эфиром сахарозы, пентаэритрита или пропилена (обозначение по номенклатуре INCI согласно "International Dictionary of Cosmetic Ingredients", изданного "The Cosmetic, Toiletry and Fragrance Association (CTFA)": карбомер), которые обозначаются также как карбоксивинилполимеры. Такие полиакриловые кислоты реализуются, в частности, под коммерческими названиями Polygel® и Carbopol®. Приемлемыми также являются, например, следующие сополимеры акриловой кислоты: (i) сополимеры двух или более мономеров из группы, в которую входят акриловая кислота, метакриловая кислота и их моноэфиры, образованные предпочтительно со спиртами C1-4, (сополимеры акрилатов по номенклатуре INCI), которые реализуются, например, под коммерческими названиями Aculyn®, Acusol® или Tego®; (ii) сшитые высокомолекулярные сополимеры акриловой кислоты, к которым относятся, например, сшитые с аллиловым эфиром сахарозы или пентаэритрита сополимеры алкилакрилатов C10-30, образованные с одним или несколькими мономерами из группы, в которую входят акриловая кислота, метакриловая кислота и их моноэфиры, предпочтительно образованные со спиртами C1-4, сложные эфиры (сетчатые полимеры "акрилаты/C10-30-алкилакрилаты" по номенклатуре INCI) и реализуются, например, под коммерческим названием Carbopol®. Другими приемлемыми полимерами являются (со)полимеры (мет)акриловой кислоты типа Sokalan®.

Моющее или чистящее средство по настоящему изобретению предпочтительно может содержать (со)полимер (мет)акриловой кислоты в комбинации с другим загустителем, предпочтительно с ксантановой камедью. Моющее или чистящее средство может содержать загуститель в количестве от 0,05 до 1,5% масс. и предпочтительно 0,1 до 1% масс. соответственно в расчете на общую массу моющего или чистящего средства. При этом количество применяемого загустителя зависит от типа загустителя и требуемой степени загущения.

Жидкие или пастообразные средства по настоящему изобретению в форме традиционных растворов, содержащих растворители, получают, как правило, простым смешиванием ингредиентов, которые могут быть прибавлены к веществу или раствору в автоматическом смесителе.

Моющие или чистящие средства по настоящему изобретению могут также содержать протеазу и амилазу соответственно описанному ранее. Альтернативно они могут также содержать другие гидролитические ферменты или другие ферменты в концентрации, являющейся целесообразной в отношении эффективности средств. Таким образом, в другом аспекте настоящее изобретение относится к средствам, которые, кроме того, содержат одно или несколько других ферментов, причем приемлемыми для применения принципиально являются любые ферменты, разработанные для этих целей на предшествующем уровне техники. В качестве других ферментов предпочтительно приемлемыми для применения являются любые ферменты, которые в средствах по настоящему изобретению могут проявлять каталитическую активность, в частности протеаза, амилаза, целлюлаза, гемицеллюлаза, маннаназа, танназа, ксиланаза, ксантаназа, ксилоглюканаза, β-глюкозидаза, пектиназа, каррагиназа, пергидролаза, оксидаза, оксидоредуктаза или липаза, а также их смеси. Другие ферменты содержатся в средстве предпочтительно в количестве от 1×10-8 до 5% масс. соответственно в пересчете на активный белок. Более предпочтительно каждый из других ферментов содержится в средствах по настоящему изобретению в количестве 1×10-7-3% масс., 0,00001-1,5% масс., 0,00005-1% масс., от 0,0001 до 0,75% масс., и наиболее предпочтительно от 0,0005 до 0,5% масс., в пересчете на активный белок. Более предпочтительно ферменты показывают синергическое действие при очистке в отношении определенных загрязнений или пятен, т.е. ферменты, содержащиеся в композиции средства, взаимно усиливают свое действие при очистке. Наиболее предпочтительно такой синергизм имеет место между протеазой, содержащейся по настоящему изобретению, и другим ферментом, содержащимся в средстве по настоящему изобретению, в том числе, в частности, между протеазой и амилазой, и/или липазой, и/или маннаназой, и/или целлюлазой, и/или пектиназой. Синергическое действие может проявляться не только между разными ферментами, но также и между одним или несколькими ферментами и другими веществами, содержащимися в средстве по настоящему изобретению.

В другом варианте осуществления настоящего изобретения моющее или чистящее средство отличается тем, что оно представляет собой средство для машинного мытья посуды. Под средствами для машинного мытья посуды, согласно настоящему описанию, понимают композиции, которые могут быть использованы для очистки загрязненной посуды в случае машинного мытья посуды. Вместе с тем средства для машинного мытья посуды по настоящему изобретению отличаются, например, от средств для машинного ополаскивания, которые всегда используют в комбинации с машинными средствами для мытья посуды и не оказывают собственного очищающего действия. К посуде, вымытой машинным способом, часто предъявляют более высокие требования, чем к посуде, вымытой вручную. Так, например, посуда после машинного мытья должна быть свободной не только от остатков пищи, но и, например, не иметь также беловатых, обусловленных жесткостью воды или другими минеральными солями пятен, которые вследствие недостатка смачивателя образуются из высохших капель воды. Современные средства для машинного мытья посуды удовлетворяют этим требованиям благодаря сочетанию очищающего вещества и/или вещества для ухода, и/или вещества, умягчающего воду, и/или вещества, активирующего ополаскивание, и известны потребителям, например, как средства для мытья посуды "2 в 1" или "3 в 1". Средства для машинного мытья посуды содержат основообразующие вещества в качестве ингредиента, существенного как для успешной очистки, так и для успешного ополаскивания. Эти основообразующие вещества повышают, во-первых, щелочность очищающего раствора, причем при возрастающей щелочности жиры и масла эмульгируются и омыляются, и уменьшают, во-вторых, благодаря связыванию в комплексы ионов кальция, содержащихся в водном рабочем растворе, жесткость очищающего раствора. В другом предпочтительном варианте осуществления средство для машинного мытья посуды заключено в водорастворимую пленку. Пленка предпочтительно содержит поливиниловый спирт (PVA) или состоит из поливинилового спирта (PVA).

В другом аспекте настоящее изобретение относится к применению моющего или чистящего средства по настоящему изобретению для удаления загрязнений, предпочтительно загрязнений, чувствительных к протеазе и/или к амилазе, с текстильных изделий или твердых поверхностей, т.е. для очистки текстильных изделий или твердых поверхностей. Средства по настоящему изобретению, в частности, благодаря наличию комбинации протеазы и амилазы, могут быть предпочтительно использованы для устранения с текстильных изделий или твердых поверхностей соответствующих загрязнений. Варианты осуществления этого аспекта настоящего изобретения представляют собой, например, стирку вручную, удаление вручную пятен с текстильных изделий или твердых поверхностей или применение в механизированном способе. Любые обстоятельства, аспекты и варианты осуществления, описанные в отношении моющего или чистящего средства по настоящему изобретению, применимы также в отношении этого аспекта настоящего изобретения. В связи с этим в данном месте особо акцентируется ссылка на описание сущности изобретения в соответствующем месте с указанием того, что это описание имеет силу также в отношении указанного ранее применения по настоящему изобретению.

В другом аспекте настоящее изобретение относится к способу очистки текстильных изделий или твердых поверхностей, причем моющее или чистящее средство по настоящему изобретению применяют по меньшей мере на одной технологической стадии.

В данном случае это относится как к ручным, так и к машинным способам, причем машинные способы вследствие возможности их точного регулирования в отношении, например, применяемого количества и времени действия являются предпочтительными. Способы очистки текстильных изделий в общем случае характеризуются тем, что на нескольких технологических стадиях различные активные очищающие вещества наносят на очищаемые изделия и после действия в течение некоторого времени смывают, или тем, что очищаемые изделия другим образом обрабатывают моющим средством или раствором или разбавленной массой этого средства. Соответствующие положения имеют силу в отношении способов очистки любых других материалов, отличающихся от текстильных изделий, предпочтительно твердых поверхностей. Любые возможные способы мытья или очистки могут включать в себя по меньшей мере на одной технологической стадии применение моющего или чистящего средства по настоящему изобретению и, таким образом, представляют собой варианты осуществления настоящего изобретения. Любые обстоятельства, аспекты и варианты осуществления, описанные в отношении моющего или чистящего средства по настоящему изобретению, применимы также в отношении этого аспекта настоящего изобретения. В связи с этим в данном месте особо акцентируется ссылка на описание сущности изобретения в соответствующем месте с указанием того, что это описание имеет силу также в отношении указанных ранее способов по настоящему изобретению.

В предпочтительном варианте осуществления способ отличается тем, что амилаза содержится в моющем растворе с концентрацией 1×10-10-0,2% масс., 0,000001-0,12% масс., 0,000005-0,04% масс., от 0,00001 до 0,03% масс., и более предпочтительно от 0,00005 до 0,02% масс. и/или протеаза содержится в моющем растворе с концентрацией 1×10-10-0,2% масс., 0,000001-0,12% масс., 0,000005-0,04% масс., от 0,00001 до 0,03% масс., и более предпочтительно от 0,00005 до 0,02% масс., причем данные приведены в пересчете на активный белок в моющем растворе. В другом предпочтительном варианте осуществления способ отличается тем, что его осуществляют при температуре в интервале от 10 до 60ºC, предпочтительно в интервале от 20 до 50ºC и более предпочтительно в интервале от 30 до 50ºC.

Протеазы, применяемые в средствах по настоящему изобретению, являются соответственно указанным ранее вариантам осуществления предпочтительно приемлемыми для применения в моющих и чистящих средствах по настоящему изобретению, а также в способах, в частности в способах мытья и очистки. Таким образом, они могут быть предпочтительно использованы для обеспечения протеолитической активности в соответствующих средствах.

В связи с этим другой аспект настоящего изобретения представляет собой применение протеазы, содержащей аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 70% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E или R99D в комбинации по меньшей мере с двумя другими заменами аминокислот, выбранных из группы, в которую входят S3T, V4I и V199I, для обеспечения протеолитической активности в жидком моющем или чистящем средстве, которое, кроме того, содержит амилазу.

Любые обстоятельства, аспекты и варианты осуществления, описанные в отношении моющего или чистящего средства по настоящему изобретению, применимы также в отношении указанных вариантов применения. В связи с этим в данном месте особо акцентируется ссылка на описание сущности изобретения в соответствующем месте с указанием того, что это описание имеет силу также в отношении указанных ранее вариантов применения по настоящему изобретению.

ПРИМЕР. Определение стабильности при хранении жидкого средства для машинного мытья посуды по настоящему изобретению

В качестве базовой композиции служило содержащее амилазу двухкомпонентное жидкое средство для машинного мытья посуды, имеющее приведенный далее состав (все данные указаны в процентах по массе).

(a) Ферментный компонент:

Основообразователь 18,0;
Сахарный спирт 12,0;
Неионогенное поверхностно-активное вещество (этоксилат жирного спирта C8-C10 с 22 звеньями EO) 5,0;
Щелочное соединение (основание) 3,5;
Борная кислота 3,0;
Фосфонат (HEDP) 1,5;
Амилаза 1,2;
Соль Ca 1,2;
Соль Zn 0,2;
Загуститель 1,0;
Краситель, отдушка, консервант 0,3;
Вода до 97.

В качестве амилазы содержался вариант α-амилазы, которая по сравнению с α-амилазой AA560 соответственно SEQ ID NO. 4 содержит следующие изменения последовательности в перечне последовательности α-амилазы AA560: R118K, D183* (делеция), G184* (делеция), N195F, R320K, R458K (компания Novozymes).

(b) Щелочной компонент:

Основообразователь 12,0;
Карбонат натрия 10,0;
Сульфополимер 7,0;
Щелочное соединение (основание) 4,0;
Моноэтаноламин 3,5;
Фосфонат (HEDP) 4,0;
Загуститель 1,0;
Краситель, отдушка, консервант 0,3;
Вода до 100.

Ферментный компонент базовой композиции прибавляли в различные экспериментальные смеси соответственно с 3% масс. композиций следующих протеаз (в итоге 0,5% масс. активного белка соответственно):

смесь 1: обладающий улучшенной эффективностью вариант протеазы, происходящей из Bacillus lentus, соответственно SEQ ID NO. 2 WO2011/032988 (сравнительный);

смесь 2: протеаза соответственно SEQ ID NO. 2 (SEQ ID NO. 1+S3T+V4I+R99E+V199I).

Для определения эффективности оба компонента дозировали в равных частях (соответственно по 20 г каждого компонента). Мытье осуществляли при значениях pH в интервале от pH=9 до pH=10 в посудомоечной машине G698SC компании Miele в объеме 4 л в течение 60 минут при температуре 50ºC.

Была использована посуда со следующими загрязнениями: молоко (A), мясной фарш (B), яичный желток (C), овсяные хлопья (D) и крахмал (E).

Оценку эффективности очистки осуществляли визуально соответственно стандартному способу IKW по шкале от 1 до 10, причем значение 10 соответствовало лучшей оценке (остаток не наблюдается).

Моющие средства соответственно смесям 1 и 2 проверяли в отношении их эффективности очистки до и после хранения в течение четырех недель при 40ºC. Результаты представлены в приведенной далее таблице 1.

Таблица 1
Загрязнение A B C D E
Смесь 1 перед хранением 5,6 10,0 5,2 7,7 9,6
Смесь 2 перед хранением 5,2 10,0 5,7 7,8 9,8
Смесь 1 после хранения 5,1 2,8 1,7 2,0 3,4
Смесь 2 после хранения 5,2 7,7 3,0 5,1 4,0

Ясно видно, что после хранения в течение четырех недель при 40ºC композиция по настоящему изобретению - благодаря содержащейся протеазе - обладает отчетливо лучшей эффективностью очистки, в частности, в отношении загрязнений B и C, чувствительных к протеазе (протеолитическая эффективность очистки). В частности, также улучшена эффективность очистки в отношении загрязнений D и E, чувствительных к амилазе (амилолитическая эффективность очистки).

1. Жидкое моющее или чистящее средство, содержащее:

(a) протеазу, содержащую аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 70% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E или R99D в комбинации с заменами аминокислот S3T, V4I и V199I, и

(b) амилазу,

отличающееся тем, что амилаза представляет собой вариант α-амилазы, представляющий собой α-амилазу АА560 соответственно SEQ ID NO. 4.

2. Моющее или чистящее средство по п. 1, отличающееся тем, что протеаза содержит аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98 и 98,5% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E в комбинации с заменами аминокислот S3T, V4I и V199I, предпочтительно протеаза содержит аминокислотную последовательность соответственно SEQ ID NO. 2.

3. Моющее или чистящее средство по п. 1, отличающееся тем, что протеаза содержит аминокислотную последовательность, которая

относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 90,5, 91, 91,5, 92, 92,5, 93, 93,5, 94, 94,5, 95, 95,5, 96, 96,5, 97, 97,5, 98 и 98,5% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99D в комбинации с заменами аминокислот S3T, V4I и V199I, предпочтительно протеаза содержит аминокислотную последовательность соответственно SEQ ID NO. 3.

4. Моющее или чистящее средство по любому из пп. 1-3, отличающееся тем, что амилаза представляет собой вариант α-амилазы, представляющий собой α-амилазу АА560 соответственно SEQ ID NO. 4, которая имеет одно, два, три, четыре, пять или шесть следующих изменений последовательности в перечне последовательности соответственно α-амилазе АА560: R118K, D183* (делеция), G184* (делеция), N195F, R320K, R458K.

5. Моющее или чистящее средство по любому из пп. 1-3, отличающееся тем, что амилаза содержится в количестве от 1×10-8 до 5 мас.% в пересчете на активный белок и/или протеаза содержится в количестве от 1×10-8 до 5 мас.% в пересчете на активный белок.

6. Моющее или чистящее средство по любому из пп. 1-3, отличающееся тем, что оно содержит дополнительно компонент, выбранный из:

i) анионного и/или полианионного соединения, и/или

ii) катионного и/или поликатионного соединения, и/или

iii) соединения, содержащего одну или несколько гидроксильных и/или полигидроксильных групп.

7. Моющее или чистящее средство по любому из пп. 1-3, отличающееся тем, что оно содержит по меньшей мере один другой ингредиент, предпочтительно ингредиент, выбранный из группы, в которую входят фосфонат, поверхностно-активное вещество, основообразующее вещество (основообразователь), неводный растворитель, кислота, водорастворимая соль, загуститель, а также их комбинации.

8. Моющее или чистящее средство по любому из пп. 1-3, отличающееся тем, что оно содержит по меньшей мере один дополнительный фермент, предпочтительно протеазу, амилазу, целлюлазу, гемицеллюлазу, маннаназу, танназу, ксиланазу, ксантаназу, ксилоглюканазу, β-глюкозидазу, пектиназу, каррагиназу, пергидролазу, оксидазу, оксидоредуктазу или липазу, а также их смеси.

9. Моющее или чистящее средство по любому из пп. 1-3, отличающееся тем, что оно представляет собой средство для машинного мытья посуды.

10. Применение моющего или чистящего средства по любому из пп. 1-9 для удаления загрязнений, чувствительных к протеазе, с текстильных изделий или твердых поверхностей.

11. Способ очистки текстильных изделий или твердых поверхностей, отличающийся тем, что по меньшей мере на одной технологической стадии применяют моющее или чистящее средство по любому из пп. 1-9.

12. Способ по п. 11, отличающийся тем, что амилаза содержится в моющем растворе с концентрацией 1×10-10-0,2 мас.% и/или

протеаза содержится в моющем растворе с концентрацией 1×10-10-0,2 мас.%.

13. Способ по п. 11 или 12, отличающийся тем, что его осуществляют при температуре в интервале от 10 до 60°С, предпочтительно в интервале от 20 до 50°С и более предпочтительно в интервале от 30 до 50°С.

14. Применение протеазы, содержащей аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 70% является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E или R99D в комбинации по меньшей мере с двумя другими заменами аминокислот, выбранных из группы, в которую входят S3T, V4I и V199I, для обеспечения протеолитической активности в жидком моющем или чистящем средстве, содержащем амилазу.


Похожие патенты:

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении целлюлазы в жидком моющем или чистящем средстве, включающем целлюлазу и протеазу.

Изобретение относится к биохимии. Конкретно к потребительским товарам, содержащим протеазы для холодной воды, и способам получения и применения таких товаров.

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении амилазы в жидком моющем или чистящем средстве, включающем амилазу и протеазу.

Изобретение относится к области микробиологии и касается применения штамма Bacillus cereus ГИСК №279 в качестве продуцента ингибитора цитокина ФНО-α. Штамм выделен из испражнений пациента с дисбактериозом кишечника и депонирован в Коллекции Государственного научно-исследовательского института стандартизации и контроля медицинских биологических препаратов им.

Изобретение относится к биотехнологии и представляет собой вариант субтилизина для применения в очистке, представляющий собой последовательность аминокислот, указанную в SEQ ID NO: 5.

Изобретение относится к биотехнологии и представляет собой выделенный вариант субтилизина Bacillus. Изобретение относится также к выделенной нуклеиновой кислоте, кодирующей вариант субтилизина, вектору экспрессии, содержащему нуклеиновую кислоту, клетке-хозяину, способной экспрессировать вариант субтилизина, а также к чистящей композиции, содержащей вариант субтилизина и способу очистки.

Настоящее изобретение относится к биохимии и представляет собой детергентную композицию, которая включает вариант субтилизина, имеющий аминокислотную последовательность, которая приведена в SEQ ID NO 1, и по меньшей мере один дополнительный ингредиент, выбранный из: i) средств для отбеливания, которые выбраны из перкарбонатов, персульфатов и органических надкислот, ii) аминокарбоксилатов, или iii) сульфированных полимеров, или iv) фосфорорганических кислот или их солей и их смесей.

Изобретение относится к биотехнологии и представляет собой варианты субтилизина, сохраняющие его активность. Изобретение относится также к чистящей композиции, содержащей вариант субтилизина, и к способу очистки поверхности и/или изделия, включающего ткань, с помощью указанной композиции.

Группа изобретений относится к биотехнологии. Предложен вариант термолизина, обладающий повышенной эффективностью по сравнению с термолизином дикого типа.

Изобретение относится к области биотехнологии и касается способа мытья посуды. Охарактеризованный способ заключается в обеспечении композиции для мытья посуды и посуды, нуждающейся в очистке, приведении указанной посуды в контакт с указанной композицией для мытья посуды при условиях, эффективно обеспечивающих очистку указанной посуды, где указанная композиция для мытья посуды содержит модифицированный субтилизин, где указанный модифицированный субтилизин, по меньшей мере, на 70% гомологичен последовательности AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR и содержит (i) замену G116V и, по меньшей мере, одну дополнительную мутацию или (ii) замену S126R.

Настоящее изобретение относится к области моющих средств для стирки или чистящих композиций. Описаны моющее средство для стирки или чистящая композиция, содержащие полимер с карбоксильной группой, содержащий: (i) структурное звено (а), являющееся производным мономера (А) на основе акриловой кислоты, в количестве от приблизительно 60% до приблизительно 70% по массе, исходя из 100% по массе всех структурных звеньев, являющихся производными всех мономеров в полимере с карбоксильной группой, причем структурное звено (а) представлено формулой (2): где R1 представляет собой атом водорода, атом металла, аммониевую группу или группу органического амина; и (ii) структурное звено (b), являющееся производным мономера (В), содержащего группу сульфоновой кислоты, в количестве от приблизительно 30% до приблизительно 40% по массе, исходя из 100% по массе всех структурных звеньев, являющихся производными всех мономеров в полимере с карбоксильной группой, причем структурное звено (b) представлено формулой (4): гдеR2 представляет собой атом водорода или метильную группу; R3 представляет собой СН2 группу, СН2СН2 группу или прямую связь; и R4 и R5 независимо представляют собой гидроксильную группу или -SO3Z; где Z представляет собой атом водорода, атом металла, аммониевую группу или группу органического амина; и где по меньшей мере один из R4 и R5 представляет собой -SO3Z, при этом полимер с карбоксильной группой имеет средневесовую молекулярную массу от приблизительно 23000 до приблизительно 50000.

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении целлюлазы в жидком моющем или чистящем средстве, включающем целлюлазу и протеазу.

Изобретение относится к композициям, содержащим липазные ферменты и отбеливающие агенты, а также к способам получения и использованию таких композиций. Описан способ очистки ткани, или твердой поверхности, или другой поверхности при уходе за тканями и бытовом уходе, включающий стадии, на которых: (a) вводят в контакт поверхность с водным раствором, содержащим (i) липазу; и (ii) отбеливающий компонент и (iii) необязательное моющее вспомогательное вещество; (b) промывают и высушивают ткань или твердую поверхность; при этом липаза включает вариант родительской липазы, причем родительская липаза содержит аминокислотную последовательность с, по меньшей мере, 60% идентичностью со зрелым полипептидом SEQ ID NO: 1 и причем вариант липазы имеет аминокислотную последовательность с, по меньшей мере, 60% идентичностью со зрелым полипептидом SEQ ID NO: 1, или его фрагмент, имеющий липазную активность, причем указанный вариант содержит следующие замены: (a) G91A+D96G+T231R+N233R; (b) T37R+N39R+G91A+D96G+T231R+N233R; (c) G91A+D96G+G225R+T231R+N233R; или (d) G91A+D96G+A150G+T231R+N233R, соответствующие указанным положениям в зрелом полипептиде SEQ ID NO: 1, причем вариант имеет липазную активность.

Изобретение относится к моющим составам, содержащим более чем один фермент, а также способам получения и применения таких моющих средств. Описана композиция моющего средства, содержащая: (a) полиферментную согранулу, содержащую по меньшей мере один протеазный фермент и от 10 до 98 мас.

Настоящее изобретение относится к применению (окисленных) простых тиоэфиров полиалкиленоксидов в моющих и чистящих средствах, особенно в посудомоечных средствах, и моющему и чистящему средству, особенно посудомоечному средству, содержащему (окисленный) простой тиоэфир полиалкиленоксидов.

Изобретение относится к композициям для стирки белья, содержащим тиофеназокарбоксилатные оттеночные красители для ткани, и способу обработки текстильных материалов, включающему такие композиции для стирки белья.

Изобретение относится к биохимии. Конкретно к потребительским товарам, содержащим протеазы для холодной воды, и способам получения и применения таких товаров.

Изобретение относится к области биохимии. Предложено устройство для размещения чипа биосенсора для осуществления способа восстановления чувствительной поверхности чипа биосенсора путем обработки его восстанавливающим раствором.

Настоящее изобретение относится к применению (окисленных) тиоэфиров алкоксилатов спиртов в моющих и чистящих средствах, особенно, в посудомоечных средствах, и к моющему и чистящему средству, особенно посудомоечному средству, содержащему (окисленный) тиоэфир алкоксилатов спирта.

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении амилазы в жидком моющем или чистящем средстве, включающем амилазу и протеазу.

Группа изобретений относится к области биотехнологии. Предложена чистящая композиция, содержащая: (а) вариант родительской альфа-амилазы, имеющий улучшенную моющую эффективность при температуре 15-20°С по сравнению с родительской альфа-амилазой, причем вариант содержит изменение в двух или более положениях, соответствующих положениям G304, W140, W189, D134, Е260, W284, W439, G476 и G477 зрелого полипептида SEQ ID NO: 1, при этом каждое изменение независимо представляет собой замещение, делецию или вставку, причем одно из изменений представляет собой замещение в положении, соответствующем положению Е260 зрелого полипептида SEQ ID NO: 1, и заместитель выбран из группы, состоящей из G, K, R, и Т; и (b) чистящую добавку. Предложен способ обработки поверхности, предпочтительно текстиля, с помощью водного моющего раствора, содержащего указанную композицию. Группа изобретений позволяет повысить эффективность удаления пятен, чувствительных к амилазе, в холодной воде. 2 н. и 19 з.п. ф-лы, 22 табл., 3 пр.

В случае жидкого моющего или чистящего средства, содержащего протеазу и амилазу, должна быть улучшена стабильность при хранении. Этого удается добиться благодаря применению протеазы, содержащей аминокислотную последовательность, которая относительно аминокислотной последовательности, указанной в SEQ ID NO. 1, в отношении ее общей длины по меньшей мере на 70 является идентичной и имеет в перечне последовательности соответственно SEQ ID NO. 1 замену аминокислоты R99E или R99D в комбинации с заменами аминокислот S3T, V4I и V199I. 4 н. и 10 з.п. ф-лы, 1 табл., 1 пр.
