Композиции glp-1 пептидов и их получение

Группа изобретений относится к области фармацевтики и медицины и касается фармацевтической композиции для лечения диабета или ожирения, содержащей первый тип гранул и второй тип гранул, в которых указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и не содержит пептид GLP-1, и в которых указанный второй тип гранул содержит пептид GLP-1 и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, а также относится к способам получения композиции и к их применению в медицине. Группа изобретений обеспечивает улучшение биодоступности пептида GLP-1. 4 н. и 29 з.п. ф-лы, 10 пр., 12 табл.

 

Настоящее изобретение направлено на композиции, содержащие фармакологически активные агенты, такие как GLP-1 (глюкагоноподобный пептид-1), и агент для доставки, а также на способы их получения и их применение в медицине.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Одной из главных проблем в пероральной доставке белков и пептидов является неспособность данных соединений легко транспортироваться через мембраны желудочно-кишечного тракта. Ранее было показано, что агент для доставки SNAC улучшает биодоступность пептидов, вводимых перорально. Настоящее изобретение относится к дальнейшему улучшению биодоступности посредством перорального введения композиций таких пептидов, в частности пептидов GLP-1.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

В одном воплощении изобретение относится к фармацевтической композиции, содержащей первый тип и второй тип гранул, в которой указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и не содержит пептид GLP-1, и в которой указанный второй тип гранул содержит пептид GLP-1 и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В некоторых воплощениях термин «гранула» относится к маленьким частицам, собранным в большую массу.

В одном воплощении изобретение относится к способу получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где способ включает следующие стадии: а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом; б) сухое гранулирование смеси со стадии а; в) смешивание гранул, полученных на стадии б, с композицией, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты; и г) возможно добавление дополнительной смазки, где смесь со стадии а не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

В одном воплощении изобретение относится к способу получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где способ включает следующие стадии: а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем; б) сухое гранулирование смеси со стадии а; в) смешивание гранул, полученных на стадии б, с композицией, содержащей пептид GLP-1; и г) возможно добавление дополнительной смазки, где смесь со стадии а не содержит пептид GLP-1.

В одном воплощении изобретение относится к способу получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где способ включает следующие стадии: а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом; б) сухое гранулирование смеси со стадии а; в) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, возможно смазки и/или наполнителя; г) сухое гранулирование смеси со стадии в; д) смешивание гранул, полученных на стадии б, с гранулами, полученными на стадии г); и е) возможно добавление дополнительной смазки, где смесь со стадии а не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, и где смесь со стадии в не содержит пептид GLP-1.

В одном воплощении изобретение относится к грануле, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, смазку, возможно наполнитель и не содержащей пептид GLP-1. В одном воплощении изобретение относится к способу получения гранулы, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, где способ включает следующие стадии: а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты (такой как SNAC) со смазкой и/или наполнителем и б) сухое гранулирование смеси со стадии а, где смесь со стадии а не содержит пептид GLP-1.

В одном воплощении изобретение относится к грануле, содержащей пептид GLP-1, наполнитель, связующее вещество и не содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В одном воплощении изобретение относится к способу получения гранулы, содержащей пептид GLP-1, где способ включает следующие стадии: а) смешивание пептида GLP-1, возможно наполнителя и/или связывающего вещества и б) вальцевание смеси со стадии а, где смесь со стадии а не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

В одном воплощении изобретение относится к фармацевтической композиции или грануле, полученной способом, как здесь определено.

В одном воплощении изобретение относится к композиции или грануле, как здесь определено, для применения в медицине, как, например, для лечения диабета или ожирения, где указанную композицию вводят перорально. В одном воплощении изобретение относится к способу лечения диабета или ожирения, включающему введение композиции, как здесь определено, пациенту, нуждающемуся в этом, при котором указанную композицию вводят перорально.

ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Авторы настоящего изобретения неожиданно обнаружили, что свойства растворения таблеток, изготовленных из той же самой композиции (т.е. того же самого типа и тех же самых количеств эксципиентов и агента для доставки), определялись структурой гранул, из которых были образованы таблетки.

Кроме того, авторы настоящего изобретения обнаружили, что характеристики растворения неожиданно имели заметный эффект на биодоступность пептида GLP-1 из композиции, такой как таблетка. Таким образом, авторы настоящего изобретения показали, что биодоступность твердых таблеток, изготовленных из гранул разной структуры, можно предсказывать из данных in vitro, т.е. данных по растворению. В одном воплощении данного изобретения предложены композиции, гранулы с улучшенной биодоступностью пептида GLP-1 и способы их получения.

В общем, термин «биодоступность» в том виде, как он здесь используется, относится к доле введенной дозы активного фармацевтического ингредиента (API) и/или активных группировок, как, например, пептида GLP-1, как здесь определено, которая достигает большого круга кровообращения в неизменной или в другой активной форме. По определению при внутривенном введении API и/или активных группировок его биодоступность составляет 100%. Однако при его введении другими путями (как, например, перорально) его биодоступность снижается (из-за неполного поглощения и/или пресистемного метаболизма). Знание биодоступности является важным при расчете дозировок для невнутривенных путей введения.

Абсолютную пероральную биодоступность рассчитывают как относительную экспозицию API и/или активных группировок в большом круге кровообращения после перорального введения (оцениваемую как площадь под кривой концентрации в плазме относительно времени) по сравнению с экспозицией API после внутривенного введения.

Фармацевтические композиции

В некоторых воплощениях изобретение относится к фармацевтической композиции, содержащей первый тип и второй тип гранул, в которой указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, и указанный второй тип гранул содержит пептид GLP-1. В некоторых воплощениях первый тип гранул, кроме того, содержит смазку, такую как стеарат магния. В некоторых воплощениях первый тип гранул, кроме того, содержит наполнитель, такой как микрокристаллическая целлюлоза. Соответственно, первый тип гранул может, кроме того, содержать смазку и, возможно, наполнитель. В некоторых воплощениях второй тип гранул, кроме того, содержит наполнитель, такой как микрокристаллическая целлюлоза. В некоторых воплощениях второй тип гранул, кроме того, содержит связующее вещество, такое как повидон. Соответственно, второй тип гранул может, кроме того, содержать наполнитель и, возможно, связующее вещество. В некоторых воплощениях композиция, кроме того, содержит внегранулярную смазку, такую как стеарат магния.

В некоторых воплощениях N-(8-(2-гидроксибензоил)амино)каприловая кислота называется «NAC».

В некоторых воплощениях первый тип гранул, содержащих соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, не содержит пептид GLP-1. В некоторых воплощениях второй тип гранул, содержащих пептид GLP-1, не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В некоторых воплощениях фармацевтическая композиция содержит первый тип и второй тип гранул, где указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и не содержит пептид GLP-1, и где указанный второй тип гранул содержит пептид GLP-1 и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

В некоторых воплощениях термин «гранула» относится к частицам, собранным в большие частицы.

В некоторых воплощениях изобретение относится к фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты является одновременным с или более быстрым, чем высвобождение указанного пептида GLP-1, при определении путем тестирования растворения с использованием анализа (I). В некоторых воплощениях изобретение относится к фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты является одновременным с или более быстрым, чем высвобождение указанного пептида GLP-1.

В некоторых воплощениях термин «высвобождение» при использовании в отношении N-(8-(2-гидроксибензоил)амино)каприловой кислоты и, возможно, по сравнению с высвобождением пептида GLP-1 определяется в пределах 30 минут, как, например, в пределах 25, 20, 15 минут, или как, например, в пределах 10 или 5 минут при определении путем тестирования растворения с использованием анализа (I). Соответственно, высвобождение может определяться в пределах 30 минут тестирования растворения с использованием анализа (I). В некоторых воплощениях высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, названное «более быстрым, чем» высвобождение указанного пептида GLP-1, определяют в пределах 30 минут, как, например, в пределах 25, 20, 15 минут, или как, например, в пределах 10 или 5 минут при определении путем тестирования растворения с использованием анализа (I). В некоторых воплощениях высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, названное «более быстрым, чем» высвобождение указанного пептида GLP-1, определяют в пределах 30 минут, как, например, в пределах 25, 20, 15 минут, или как, например, в пределах 10 или 5 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

В некоторых воплощениях высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, названное «одновременным с» высвобождением указанного пептида GLP-1, определяется в пределах 30 минут, как, например, в пределах 25, 20, 15 минут, или как, например, в пределах 10 или 5 минут при определении путем тестирования растворения с использованием анализа (I). В некоторых воплощениях высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, названное «одновременным с» высвобождением указанного пептида GLP-1, определяется в пределах 30 минут, как, например, в пределах 25, 20, 15 минут, или как, например, в пределах 10 или 5 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

В некоторых воплощениях изобретение относится к фармацевтической композиции по любому из предшествующих пп., где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах первых 60 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5. В некоторых воплощениях изобретение относится к фармацевтической композиции, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах первых 30 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5. В некоторых воплощениях количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 55 минут, как, например, в пределах 50, 45 или 40 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5. В некоторых воплощениях количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 39 или 38 минут, как, например, в пределах 37, 36 или 35 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5. В некоторых воплощениях количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 34 минут, как, например, в пределах 33, 32 или 31 минуты при определении путем тестирования растворения с использованием анализа (I) при pH 2,5. В некоторых воплощениях количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 31 минуты, как, например, в пределах 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55 или 60 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

В некоторых воплощениях композиция содержит гранулы, которые были изготовлены путем сухого гранулирования. В некоторых воплощениях композиция содержит гранулы, которые были изготовлены путем вальцевания. В некоторых воплощениях формовка, полученная в результате процесса вальцевания, измельчается на гранулы. Термин «композиция» в том виде, как он здесь используется, относится к фармацевтической композиции.

В некоторых воплощениях композиция находится в виде твердой лекарственной формы. В некоторых воплощениях композиция находится в форме таблетки. В некоторых воплощениях композиция находится в форме капсулы. В некоторых воплощениях композиция находится в форме пакетика.

В некоторых воплощениях композиция или гранула содержит по меньшей мере один фармацевтически приемлемый эксципиент. Термин «эксципиент» в том виде, как он здесь используется, в широком смысле относится к любому компоненту, отличному от активного терапевтического ингредиента(тов). Эксципиент может представлять собой инертное вещество, которое является инертным в том смысле, что оно само по себе по существу не имеет какого-либо терапевтического и/или профилактического эффекта. Эксципиент может служить для разных целей, например, в качестве агента для доставки, усилителя поглощения, носителя, наполнителя (также известного как разбавители), связующего вещества, смазки, скользящего вещества, разрыхлителя, замедлителей кристаллизации, подкисляющего агента, подщелачивающего агента, консерванта, антиоксиданта, буферизующего агента, хелатора, комплексообразующих агентов, поверхностно-активного вещества, эмульгаторов и/или солюбилизаторов, подсластителей, увлажнителей, стабилизатора, красителя, корригента, и/или для улучшения введения и/или поглощения активного вещества. Специалист в данной области может выбрать один или более чем один из вышеупомянутых эксципиентов с учетом конкретных желательных свойств твердой пероральной лекарственной формы путем традиционного экспериментирования и без каких-либо чрезмерных усилий. Количество каждого использованного эксципиента может варьировать в пределах традиционных в данной области интервалов. Методики и эксципиенты, которые могут быть использованы для приготовления пероральных лекарственных форм, описаны в Handbook of Pharmaceutical Excipients, 6th edition, Rowe et al., Eds., American Pharmaceuticals Association and the Pharmaceutical Press, publications department of the Royal Pharmaceutical Society of Great Britain (2009) и Remington: the Science and Practice of Pharmacy, 21th edition, Gennaro, Ed., Lippincott Williams & Wilkins (2005).

В некоторых воплощениях композиция или гранула содержит наполнитель, такой как лактоза (например, лактоза, высушенная распылением, α-лактоза, β-лактоза, Tabletose®, разные сорта Pharmatose®, Microtose® или Fast-FloC®), микрокристаллическая целлюлоза (разные сорта Avicel®, Elcema®, Vivacel®, Ming Tai® или Solka-Floc®), другие производные целлюлозы, сахароза, сорбит, маннит, декстрины, декстраны, мальтодекстрины, декстроза, фруктоза, каолин, маннит, сорбит, сахароза, сахар, крахмалы или модифицированные крахмалы (включающие картофельный крахмал, кукурузный крахмал и рисовый крахмал), фосфат кальция (например, основной фосфат кальция, гидрофосфат кальция, дикальция фосфат гидрат), сульфат кальция, карбонат кальция или альгинат натрия. В некоторых воплощениях наполнитель представляет собой микрокристаллическую целлюлозу, такую как Avicel РН 101.

В некоторых воплощениях композиция или гранула содержит связывающее вещество, такое как лактоза (например, лактоза, высушенная распылением, α-лактоза, β-лактоза, Tabletose®, разные сорта Pharmatose®, Microtose® или Fast-FloC®), микрокристаллическая целлюлоза (разные сорта Avicel®, Elcema®, Vivacel®, Ming Tai® или Solka-Floc®), гидроксипропилцеллюлоза, L-гидроксипропилцеллюлоза (с низкой степенью замещения), гипромеллоза (НРМС) (например, Methocel Е, F и K, Metolose SH от Shin-Etsu, Ltd, такие как, например, 4000 сП (сантипуаз) Methocel Е и Metolose 60 SH, и 4000 сП Methocel F и Metolose 65 SH, 4000, 15000 и 100000 сП Methocel K; и 4000, 15000, 39000 и 100000 сП Metolose 90 SH), метилцеллюлозные полимеры (такие как, например, Methocel А, Methocel А4С, Methocel А15С, Methocel А4М), гидроксиэтилцеллюлоза, этилцеллюлоза, натрий карбоксиметилцеллюлоза, другие производные целлюлозы, сахароза, декстрины, мальтодекстрины, крахмалы или модифицированные крахмалы (включающие картофельный крахмал, кукурузный крахмал и рисовый крахмал), лактат кальция, карбонат кальция, аравийская камедь, альгинат натрия, агар, каррагенан, желатин, гуаровая камедь, пектин, PEG (полиэтиленгликоль) или повидон. В некоторых воплощениях связующее вещество представляет собой повидон, такой как повидон K 90.

В некоторых воплощениях композиция или гранула содержит разрыхлитель, такой как альгиновая кислота, альгинаты, микрокристаллическая целлюлоза, гидроксипропилцеллюлоза, другие производные целлюлозы, натрий кроскармеллоза, кросповидон, калия полакриллин, натрия крахмала гликолят, крахмал, прежелатинизированный крахмал или карбоксиметилкрахмал (например, Primogel® и Explotab®).

В некоторых воплощениях композиция или гранула содержит смазку, такую как стеариновая кислота, стеарат магния, стеарат кальция или стеарат другого металла, тальк, воска, глицериды, легкое минеральное масло, глицерилбегенат, гидрогенизированные растительные масла, стеарилфумарат натрия, полиэтиленгликоли, алкилсульфаты или бензоат натрия. В некоторых воплощениях композиция или гранула содержит смазку, такую как силикат магния, тальк или коллоидный диоксид кремния. В некоторых воплощениях смазка представляет собой стеарат магния.

В некоторых воплощениях композиция или гранула содержит один или более чем один эксципиент, выбранный из следующих: замедлители кристаллизации, такие как повидон и т.д.; солюбилизирующие агенты (также известные как поверхностно-активные вещества), такие как анионные поверхностно-активные вещества (например, плюроник или повидон), катионные поверхностно-активные вещества, неионные поверхностно-активные вещества и/или цвиттерионные поверхностно-активные вещества; красители, включающие контрастные вещества и пигменты, такие как красный или желтый оксид железа, диоксид титана и/или тальк; и/или агенты, контролирующие pH, такие как лимонная кислота, винная кислота, фумаровая кислота, цитрат натрия, двухосновный фосфат кальция и/или двухосновный фосфат натрия.

В некоторых воплощениях композиция содержит по меньшей мере 60% (масс./масс.) агента для доставки меньше чем 10% (масс./масс.) связующего вещества, 5-40% (масс./масс.) наполнителя и меньше чем 10% (масс./масс.) смазки.

В некоторых воплощениях композиция содержит по меньшей мере 60% (масс./масс.), как, например, 65-75% (масс./масс.), 60-80% (масс./масс.) или 50-90% (масс./масс.) агента для доставки. В некоторых воплощениях композиция содержит по меньшей мере 70% (масс./масс.), как, например, 70-80% (масс./масс.) агента для доставки.

В некоторых воплощениях композиция содержит 0,1-10% (масс./масс.), как, например, 0,2-4% (масс./масс.) или 0,5-3% (масс./масс.) связующего вещества. В некоторых воплощениях композиция содержит 1,5-2,5% (масс./масс.), как, например, 1,7-2,3% (масс./масс.), 1,8-2,2% (масс./масс.) или 1,9-2,1% (масс./масс.) связующего вещества. В некоторых воплощениях композиция содержит 1% (масс./масс.) или 2% (масс./масс.) связующего вещества.

В некоторых воплощениях композиция содержит 5-40% (масс./масс.), как, например, 10-30% (масс./масс.) или 5-25% (масс./масс.) наполнителя. В некоторых воплощениях композиция содержит 10-25% (масс./масс.), как, например, 17-23% (масс./масс.), 18-22% (масс./масс.) или 19-21% (масс./масс.) наполнителя. В некоторых воплощениях композиция содержит 10,9% (масс./масс.) или 18% (масс./масс.) наполнителя, или содержит 19,5% (масс./масс.) или 20,5% (масс./масс.) наполнителя.

В некоторых воплощениях композиция содержит 0,1-10% (масс./масс.) или 0,5-5% (масс./масс.), как, например, 1-3,5% (масс./масс.) или 1% (масс./масс.) смазки. В некоторых воплощениях композиция содержит 1,5-3% (масс./масс.), как, например, 2,1-2,7% (масс./масс.), 2,2-2,6% (масс./масс.) или 2,3-2,5% (масс./масс.) смазки.

Кроме того, композиция или гранула по изобретению может быть приготовлена, как известно, в области пероральных композиций инсулинотропных соединений.

Композицию или гранулу можно вводить в нескольких лекарственных формах, например, в виде таблетки; капсулы, такой как твердые капсулы, пакетика или порошка. Композицию или гранулу, кроме того, можно составлять в носителе лекарственного средства или системе доставки лекарственного средства, например, для того, чтобы улучшать стабильность и/или растворимость или дополнительно улучшать биодоступность.

В некоторых воплощениях масса таблетки находится в интервале от 150 мг до 1000 мг, как, например, в интервале 300-600 мг или 350-450 мг.

В некоторых воплощениях изобретение относится к первой грануле, содержащей по меньшей мере 75% (масс./масс.) агента для доставки, меньше чем 10% (масс./масс.) смазки и, возможно, меньше чем 20% наполнителя, и не содержащей пептид GLP-1. В некоторых воплощениях изобретение относится к первой грануле, содержащей по меньшей мере 80% (масс./масс.) агента для доставки, меньше чем 10% (масс./масс.) смазки и, возможно, меньше чем 20% наполнителя, и не содержащей пептид GLP-1. В некоторых воплощениях первая гранула содержит 75-90% (масс./масс.), как, например, 78-88% (масс./масс.), 80-86% (масс./масс.) или 82-84% (масс./масс.) агента для доставки. В некоторых воплощениях первая гранула содержит меньше чем 10% (масс./масс.), как, например 1-3% (масс./масс.), 1,5-2,5% (масс./масс.) или 1,9-2,3% (масс./масс.) смазки. В некоторых воплощениях первая гранула содержит меньше, чем 20%, как, например, 10-20% (масс./масс.), 12-18% (масс./масс.) или 14-17% (масс./масс.) наполнителя. В некоторых воплощениях первая гранула не содержит пептид GLP-1. В некоторых воплощениях гранула содержит по меньшей мере 80% (масс./масс.) агента для доставки, меньше чем 10% (масс./масс.) смазки и, возможно, меньше чем 20% наполнителя.

В некоторых воплощениях изобретение относится ко второй грануле, содержащей пептид GLP-1, по меньшей мере 15% (масс./масс.) наполнителя и меньше чем 40% (масс./масс.) связующего вещества и не содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В некоторых воплощениях вторая гранула содержит по меньшей мере 1%, как, например, 1-70% (масс./масс.), 2-40% (масс./масс.) или 4-30% (масс./масс.) пептида GLP-1. В некоторых воплощениях вторая гранула содержит по меньшей мере 20%, как, например, 40-80% (масс./масс.) или 50-75% (масс./масс.) наполнителя. В некоторых воплощениях вторая гранула содержит меньше чем 30%, как, например, 5-30% (масс./масс.), 10-28% (масс./масс.) или 15-25% (масс./масс.) связующего вещества. В некоторых воплощениях вторая гранула не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В некоторых воплощениях гранула содержит пептид GLP-1, по меньшей мере 15% (масс./масс.) наполнителя и меньше чем 40% (масс./масс.) связующего вещества. В некоторых воплощениях гранула содержит пептид GLP-1, по меньшей мере 50% (масс./масс.) наполнителя и меньше чем 40% (масс./масс.) связующего вещества.

В некоторых воплощениях изобретение относится к композиции, содержащей первый и второй тип гранул, где первый тип гранулы содержит по меньшей мере 75% (масс./масс.) агента для доставки, меньше чем 10% (масс./масс.) смазки, возможно меньше чем 20% наполнителя и не содержит пептид GLP-1, и где второй тип гранулы содержит пептид GLP-1, по меньшей мере 15% (масс./масс.) наполнителя, меньше чем 40% (масс./масс.) связующего вещества и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В некоторых воплощениях изобретение относится к композиции, содержащей первый и второй тип гранул, где первый тип гранулы содержит по меньшей мере 75% (масс./масс.) агента для доставки, меньше чем 10% (масс./масс.) смазки, меньше, чем 20% наполнителя и не содержит пептид GLP-1, и где второй тип гранулы содержит пептид GLP-1, по меньшей мере 15% (масс./масс.) наполнителя, меньше чем 40% (масс./масс.) связующего вещества и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В некоторых воплощениях изобретение относится к композиции, содержащей первый и второй тип гранул, где первый тип гранулы содержит по меньшей мере 75% (масс./масс.) агента для доставки, меньше чем 10% (масс./масс.) смазки и не содержит пептид GLP-1, и где второй тип гранулы содержит пептид GLP-1, по меньшей мере 15% (масс./масс.) наполнителя, меньше чем 40% (масс./масс.) связующего вещества и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

Способы получения фармацевтических композиций

Композиции по изобретению можно получать, как известно, в данной области. В некоторых воплощениях композицию или гранулу можно получать, как описано в приведенных здесь примерах. В некоторых воплощениях композицию можно гранулировать до прессования в таблетки. В некоторых воплощениях гранулы по изобретению изготовляют путем сухого гранулирования, как, например, посредством вальцевания. В некоторых воплощениях формовки, полученные в результате процесса вальцевания, измельчают на гранулы. Композиция может содержать одну или более чем одну внутригранулярную часть и внегранулярную часть, где внутригранулярные части были гранулированы, и где внегранулярная часть была добавлена после гранулирования. Первая внутригранулярная часть может содержать пептид GLP-1 и один или более чем один эксципиент, и вторая внутригранулярная часть может содержать агент для доставки и, возможно, один или более чем один эксципиент. Первая внутригранулярная часть может содержать пептид GLP-1, наполнитель и/или связующее вещество, и вторая внутригранулярная часть может содержать агент для доставки, смазку и наполнитель. Первая внутригранулярная часть может содержать пептид GLP-1, наполнитель и/или связующее вещество, и вторая внутригранулярная часть может содержать агент для доставки, смазку и/или наполнитель. В некоторых воплощениях первая внутригранулярная часть содержит агонист GLP-1 (т.е. пептид GLP-1), микрокристаллическую целлюлозу и/или повидон, и вторая внутригранулярная часть содержит агент для доставки, стеарат магния и микрокристаллическую целлюлозу. В некоторых воплощениях первая внутригранулярная часть содержит агонист GLP-1 (т.е. пептид GLP-1), микрокристаллическую целлюлозу и/или повидон, и вторая внутригранулярная часть содержит агент для доставки, стеарат магния и/или микрокристаллическую целлюлозу. Внегранулярная часть может содержать смазку. В некоторых воплощениях внегранулярная часть содержит стеарат магния. В некоторых воплощениях термин «наполнитель и/или связующее вещество» относится к наполнителю и, возможно, связующему веществу. В некоторых воплощениях термин «смазка и наполнитель» или «смазка и/или наполнитель» относится к смазке и, возможно, к наполнителю.

Для получения сухой смеси вещества для таблетирования разные компоненты взвешивают, возможно избавляют от комков и затем объединяют. Смешивание компонентов можно проводить, пока не получается гомогенная смесь.

Если в веществе для таблетирования следует использовать гранулы, гранулы можно получать способом, известным специалисту в данной области, например, методиками сухого гранулирования, в которых фармацевтически активный агент и/или агенты для доставки прессуют с эксципиентами с образованием относительно больших формовок, например, кусков или полосок, которые измельчают путем растирания, и растертое вещество служит в качестве вещества для таблетирования, подлежащего последующему прессованию в таблетки. Подходящее оборудование для сухого гранулирования включает оборудование для вальцевания от Gerteis, как, например, Gerteis MINI-PACTOR, но не ограничивается им.

Для прессования вещества для таблетирования в твердую пероральную лекарственную форму, например таблетку, можно использовать таблетировочный пресс. В таблетировочном прессе веществом для таблетирования заполняют (например, посредством принудительной подачи или подачи самотеком) полость матрицы. Вещество для таблетирования затем прессуют под давлением посредством штампа. Затем образующаяся прессовка или таблетка выталкивается из таблетировочного пресса. Вышеупомянутый способ прессования затем именуется здесь «способ прессования». Подходящие таблетировочные прессы включают роторные таблетировочные прессы и эксцентриковые таблетировочные прессы, но не ограничиваются ими. Примеры таблетировочных прессов включают Fette 102i (Fette GmbH), роторный таблетировочный пресс Korsch XL100, Korsch РН 106 (Korsch AG, Германия), эксцентриковый таблетировочный пресс Korsch EK-O (Korsch AG, Germany) и Manesty F-Press (Manesty Machines Ltd., Великобритания), но не ограничиваются ими.

В некоторых воплощениях способ получения таблетки включает i) сухое гранулирование смеси, содержащей агонист GLP-1 (т.е. пептид GLP-1), наполнитель и связующее вещество; ii) сухое гранулирование смеси, содержащей агент для доставки, смазку и наполнитель; iii) смешивание гранул со смазкой и затем iv) прессование смеси в таблетки. В некоторых воплощениях способ получения таблетки включает i) сухое гранулирование смеси, содержащей агонист GLP-1 (т.е. пептид GLP-1), наполнитель и связующее вещество; ii) сухое гранулирование смеси, содержащей агент для доставки, смазку и/или наполнитель; iii) смешивание гранул со смазкой и затем iv) прессование смеси в таблетки.

В некоторых воплощениях изобретение относится к способу получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии: а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом; б) сухое гранулирование смеси со стадии а; в) смешивание гранул, полученных на стадии б, с композицией, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и г) возможно добавление дополнительной смазки. В некоторых воплощениях изобретение относится к способу получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии: а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем; б) сухое гранулирование смеси со стадии а; в) смешивание гранул, полученных на стадии б, с композицией, содержащей пептид GLP-1 и г) возможно добавление дополнительной смазки. В некоторых воплощениях изобретение относится к способу получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии: а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом; б) сухое гранулирование смеси со стадии а; в) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, возможно со смазкой и/или наполнителем; г) сухое гранулирование смеси со стадии в; д) смешивание гранул, полученных на стадии б, с гранулами, полученными на стадии г; и е) возможно добавление дополнительной смазки.

В одном воплощении изобретение относится к способу получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии: а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом; б) сухое гранулирование смеси со стадии а; в) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты возможно со смазкой и/или наполнителем; г) сухое гранулирование смеси со стадии в; д) смешивание гранул, полученных на стадии б, с гранулами, полученными на стадии г; и е) возможно добавление дополнительной смазки, где смесь со стадии а не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, и где смесь со стадии в не содержит пептид GLP-1.

В одном воплощении изобретение относится к грануле, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, смазку, возможно наполнитель и не содержащей пептид GLP-1. В одном воплощении изобретение относится к способу получения гранулы, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, где способ включает следующие стадии: а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты (такой как SNAC) со смазкой и/или наполнителем; и б) сухое гранулирование смеси со стадии а, где смесь со стадии а не содержит пептид GLP-1.

В одном воплощении изобретение относится к грануле, содержащей пептид GLP-1, наполнитель, связующее вещество и не содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В одном воплощении изобретение относится к способу получения гранулы, содержащей пептид GLP-1, где данный способ включает следующие стадии: а) смешивание пептида GLP-1, возможно наполнителя и/или связующего вещества и б) вальцевание смеси со стадии а, где смесь со стадии а не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

В некоторых воплощениях стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 20 минут. В некоторых воплощениях стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 30 минут или по меньшей мере 40 минут, как, например, 50 минут. В некоторых воплощениях стадия смешивания, включающая смешивание первого типа гранул, содержащих пептид GLP-1, со вторым типом гранул, содержащих соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, имеет продолжительность по меньшей мере 15 минут или по меньшей мере 20 минут, как, например, по меньшей мере 25 минут или по меньшей мере 30 минут.

В некоторых воплощениях изобретение относится к фармацевтической композиции, полученной способом, как здесь определено.

В некоторых воплощениях изобретение относится к грануле, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и смазку. В некоторых воплощениях гранула содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, смазку и наполнитель. В некоторых воплощениях изобретение относится к грануле, содержащей пептид GLP-1, наполнитель и связующее вещество. В некоторых воплощениях гранулу получают согласно способу, как здесь определено.

В некоторых воплощениях изобретение относится к способу получения гранулы, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, где данный способ включает следующие стадии: а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты (такой как SNAC) со смазкой и/или наполнителем и б) сухое гранулирование смеси со стадии а. В некоторых воплощениях стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 20 минут. В некоторых воплощениях стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 30 минут или по меньшей мере 40 минут, как, например, 50 минут.

В некоторых воплощениях изобретение относится к способу получения гранулы, содержащей пептид GLP-1, где данный способ включает следующие стадии: а) смешивание пептида GLP-1, возможно наполнителя и/или связующего вещества и б) вальцевание смеси со стадии а.

В некоторых воплощениях изобретение относится к грануле, полученной способом, как здесь определено.

В некоторых воплощениях смазкой является стеарат магния. В некоторых воплощениях наполнителем является микрокристаллическая целлюлоза. В некоторых воплощениях связующим веществом является повидон.

В некоторых воплощениях термин «устойчивость таблеток к дроблению» имеет значение, определенное в разделе 2.9.8 Европейской Фармакопеи 7.5, 7-е издание 2012 г.; устойчивость к дроблению можно измерять, среди прочих, в Ньютонах (Н) или килограмм-силах (кгс) с использованием скорости тисков 20 Н/с (1 кгс равен 9,807 Н).

В некоторых воплощениях термин «сила вальцевания» означает силу между вальцами роликового пресса при вальцевании веществ в непрерывную полоску прессованного вещества при определении датчиком давления, который преобразует гидравлическое давление в электрический сигнал; силу вальцевания можно измерять в килоньютонах (кН) или в килоньютонах на ширину вальца (кН/см).

Методы in vitro

Растворение композиций по изобретению можно определять, как здесь описано в Анализе (I). В некоторых воплощениях тестирование растворения с использованием Анализа (I) проводится при любом pH от 1,0 до 8,0. В некоторых воплощениях тестирование растворения с использованием Анализа (I) проводится при pH 1,0. В некоторых воплощениях тестирование растворения с использованием Анализа (I) проводится при pH 2,5. В некоторых воплощениях тестирование растворения с использованием Анализа (I) проводится при pH 6,8.

Пептиды GLP-1

В одном воплощении композиция по изобретению содержит пептид GLP-1. Термин «пептид GLP-1» в том виде, как он здесь используется, относится к соединению, которое полностью или частично активирует человеческий рецептор GLP-1. В некоторых воплощениях «пептид GLP-1» связывается с рецептором GLP-1, например с константой аффинности (KD), или активирует рецептор с эффективностью (ЕС50) меньше 1 мкМ, например, меньше 100 нМ при измерении способами, известными в данной области (см., например, WO 98/08871), и демонстрирует инсулинотропную активность, где инсулинотропную активность можно измерять анализами in vivo или in vitro, известными обычным специалистам в данной области. Например, пептид GLP-1 можно вводить животному с повышенным уровнем глюкозы в крови (например, полученным с использованием внутривенной пробы на толерантность к глюкозе (IVGTT), специалист в данной области сможет определить подходящую дозировку глюкозы и подходящую схему отбора проб крови для IVGTT, например, в зависимости от вида животного) и измерять во времени концентрацию инсулина в плазме. В некоторых воплощениях пептид GLP-1 называется агонистом GLP-1.

В некоторых воплощениях пептид GLP-1 представляет собой аналог GLP-1, возможно содержащий один заместитель. Термин «аналог» в том виде, как он здесь используется по отношению к пептиду GLP-1 (далее «пептид»), означает пептид, где по меньшей мере один аминокислотный остаток пептида был заменен другим аминокислотным остатком, и/или где по меньшей мере один аминокислотный остаток был удален из пептида, и/или где по меньшей мере один аминокислотный остаток был добавлен в пептид, и/или где по меньшей мере один аминокислотный остаток пептида был модифицирован. Такое добавление или удаление аминокислотных остатков может происходить на N-конце пептида и/или на С-конце пептида. В некоторых воплощениях для описания пептида GLP-1 используется простая номенклатура, например, [Aib8] GLP-1 (7-37) обозначает аналог GLP-1(7-37), в котором Ala в положении 8 был заменен Aib. В некоторых воплощениях пептид GLP-1 содержит максимум двенадцать, как, например, максимум 10, 8 или 6 аминокислот, которые были изменены, например, путем замены, делеции, вставки и/или модификации, по сравнению с, например, GLP-1(7-37). В некоторых воплощениях аналог содержит вплоть до 10 замен, делеций, присоединений и/или вставок, как, например, вплоть до 9 замен, делеций, присоединений и/или вставок, вплоть до 8 замен, делеций, присоединений и/или вставок, вплоть до 7 замен, делеций, присоединений и/или вставок, вплоть до 6 замен, делеций, присоединений и/или вставок, вплоть до 5 замен, делеций, присоединений и/или вставок, вплоть до 4 замен, делеций, присоединений и/или вставок или вплоть до 3 замен, делеций, присоединений и/или вставок по сравнению с, например, GLP-1(7-37). Если не утверждается иное, GLP-1 содержит только L-аминокислоты.

В некоторых воплощениях термин «аналог GLP-1» в том виде, как он здесь используется, относится к пептиду или соединению, которое представляет собой вариант человеческого глюкагон-подобного пептида-1 (GLP-1(7-37)). GLP-1 (7-37) имеет последовательность HAEGTFTSDV SSYLEGQAAKEFIAWLVKGRG (SEQ ID No: 1). В некоторых воплощениях термин «вариант» относится к соединению, которое содержит одну или более чем одну аминокислотную замену, делецию, присоединение и/или вставку.

В одном воплощении пептид GLP-1 демонстрирует по меньшей мере 60%, 65%, 70%, 80% или 90% идентичности последовательности с GLP-1(7-37) по всей длине GLP-1(7-37). В качестве примера способа определения идентичности последовательности между двумя аналогами выравнивают два пептида [Aib8]GLP-1(7-37) и GLP-1(7-37). Идентичность последовательности [Aib8]GLP-1(7-37) относительно GLP-1(7-37) задается числом выровненных идентичных остатков минус число отличных остатков, поделенным на общее число остатков GLP-1(7-37). Соответственно, в указанном примере идентичность последовательности составляет (31-1)/31.

В одном примере С-концом пептида GLP-1 является амид.

В некоторых воплощениях пептид GLP-1 представляет собой GLP-1(7-37) или GLP-1(7-36)амид. В некоторых воплощениях пептид GLP-1 представляет собой экстендин-4, последовательностью которого является HGEGTFITSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 2).

В некоторых воплощениях пептид GLP-1 содержит один заместитель, который ковалентно присоединен к пептиду. В некоторых воплощениях заместитель содержит жирную кислоту или жирную дикислоту. В некоторых воплощениях заместитель содержит С16, С18 или С20 жирную кислоту. В некоторых воплощениях заместитель содержит С16, С18 или С20 жирную дикислоту. В некоторых воплощениях заместитель имеет формулу (X)

где n равен по меньшей мере 13, как, например, n равен 13, 14, 15, 16, 17, 18 или 19. В некоторых воплощениях заместитель имеет формулу (X), где n находится в интервале от 13 до 19, как, например, в интервале от 13 до 17. В некоторых воплощениях заместитель имеет формулу (X), где n равен 13, 15 или 17. В некоторых воплощениях заместитель имеет формулу (X), где n равен 13. В некоторых воплощениях заместитель имеет формулу (X), где n равен 15. В некоторых воплощениях заместитель имеет формулу (X), где n равен 17. В некоторых воплощениях заместитель содержит одну или более чем одну 8-амино-3,6-диоксаоктановую кислоту (OEG), как, например, две OEG.

В некоторых воплощениях заместитель представляет собой [2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбоксигептадеканоиламино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил].

В некоторых воплощениях заместитель представляет собой [2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбоксинонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил].

В некоторых воплощениях пептид GLP-1 представляет собой семаглутид, также известный как N-эпсилон26-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбоксигептадеканоиламино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Arg34]CLP-1(7-37), который можно получать, как описано в WO 2006/097537, Пример 4.

В некоторых воплощениях композиция содержит пептид GLP-1 или его фармацевтически приемлемую соль, амид или сложный эфир. В некоторых воплощениях композиция содержит пептид GLP-1 и один или более чем один фармацевтически приемлемый противоион.

В некоторых воплощениях дозировка пептида GLP-1 находится в интервале от 0,01 мг до 100 мг. В некоторых воплощениях композиция или гранула содержит количество пептида GLP-1 в интервале по меньшей мере 1 мг, как, например, по меньшей мере 5 мг или по меньшей мере 10 мг. В некоторых воплощениях композиция или гранула содержит 10 мг пептида GLP-1.

В некоторых воплощениях композиция содержит количество пептида GLP-1 в интервале 0,05-25 мкмоль, как, например, в интервале 0,5-20 мкмоль.

В некоторых воплощениях пептид GLP-1 выбран из одного или более чем одного из пептидов GLP-1, упомянутых в WO 93/19175, WO 96/29342, WO 98/08871, WO 99/43707, WO 99/43706, WO 99/43341, WO 99/43708, WO 2005/027978, WO 2005/058954, WO 2005/058958, WO 2006/005667, WO 2006/037810, WO 2006/037811, WO 2006/097537, WO 2006/097538, WO 2008/023050, WO 2009/030738, WO 2009/030771 и WO 2009/030774.

В некоторых воплощениях пептид GLP-1 выбран из группы, состоящей из следующих: N-эпсилон37{2-[2-(2-{2-[2-((R)-3-карбокси-3-{[1-(19-карбоксинонадеканоил)пиперидин-4-карбонил]амино}пропиониламино)этокси]этокси}ацетиламино)этокси]этокси}ацетил[дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)амид; N-эпсилон26{2-[2-(2-{2-[2-((R)-3-карбокси-3-{[1-(19-карбоксинонадеканоил) пиперидин-4-карбонил]амино}пропиониламино)этокси]этокси}ацетиламино)этокси] этокси}ацетил [дезаминоHis7, Arg34] GLP-1-(7-37); N-эпсилон37{2-[2-(2-{2-[2-((S)-3-карбокси-3-{[1-(19-карбокси-нонадеканоил) пиперидин-4-карбонил]амино}пропиониламино)этокси]этокси}ацетиламино)этокси]этокси}ацетил[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-карбоксигептадеканоил)пиперидин-4-илкарбониламино]3-карбоксипропиониламино)этокси)этокси]ацетиламино)этокси]этокси)ацетил][дезаминоНiS7, Glu22 Arg26, Arg34, Phe(m-CF3)28]GLP-1-(7-37)амид; N-эпсилон26-[(S)-4-карбокси-4-({транс-4-[(19-карбоксинонадеканоиламино)метил]циклогексанкарбонил}амино)бутирил][Aib8,Arg34]CLP-1-(7-37); N-эпсилон26-{4-[(S)-4-карбокси-4-({транс-4-[(19-карбоксинонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]бутирил}[Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино) метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-37)амид; N-эпсилон-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Clu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][дезаминоНiS7,Glu22, Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({4-[(транс-19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][дезаминоHiS7,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][дезаминоHis7,Clu22,Arg26,Arg34,Lys37]GLP-1-(7-37); N-эпсилон26[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси) ацетиламино]этокси}этокси)ацетил[Aib8, Lys26]GLP-1 (7-37)амид; N-эпсилон26 [2-(2-[2-(2-[2-(2-((S)-2-[транс-4-((9-карбоксинонадеканоиламино]метил)циклогексилкарбониламино]-4-карбоксибутаноиламино)этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Lys26] GLP-1 (7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексан-карбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][дезаминоHis7,Arg26,Arg34,Lys37]GLP-1-(7-37); N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][дезаминоHis7,Glu22,Arg26,Glu30,Arg34JLys37]GLP-1-(7-37); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{4-[4-(16-(1Н-тетразол-5-ил)-гексадеканоилсульфамоил)бутириламино]-бутириламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоил-сульфамоил)бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{6-[4-(16-(1Н-тетразол-5-ил)гексадеканоил-сульфамоил)бутириламино]гексаноиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{4-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил)бутириламино]бутириламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-34); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил)бутириламино]-додеканоиламно}бутириламино) бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-34); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{6-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил) бутириламино]гексаноиламино}бутириламино) бутириламино]этокси}этокси)ацетил] [Aib8,Arg34]GLP-1-(7-34); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоил-сульфамоил)бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-35); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{6-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил)бутириламино]гексаноиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-35); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{6-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил) бутириламино]гексаноиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]CLP-1-(7-36)амид; N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{6-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил)бутириламино]гексаноиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]CLP-1-(7-35); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоил-сульфамоил)бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Lys33,Arg34]GLP-1-(7-34); N-эпсилон26-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил)бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1-(7-36)амид; N-эпсилон26-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил)бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетиламино]этокси}этокси)ацетиламино]этокси}этокси)ацетиламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Lys26,Arg34]GLP-1-(7-36)амид; N-эпсилон37-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил)бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетил][Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил) бутириламино]додеканоиламино}бутириламино)бутириламино] этокси}этокси)ацетил][дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37{2-[2-(2-{2-[2-((R)-3-карбокси-3-{[1-(19-карбокси-нонадеканоил) пиперидин-4-карбонил]амино}пропиониламино)этокси]этокси}ацетиламино)этокси]этокси}ацетил [дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)амид; N-эпсилон37{2-[2-(2-{2-[2-((S)-3-карбокси-3-{[1-(19-карбоксинонадеканоил) пиперидин-4-карбонил]амино}пропиониламино)этокси]этокси}ацетиламино)этокси]этокси}ацетил [Aib8,Glu22, Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-карбоксигепта-деканоил)пиперидин-4-илкарбониламино]3-карбокси-пропиониламино)этокси)этокси]ацетиламино)этокси]этокси)ацетил][дезаминоHis7,Glu22,Arg26,Arg34,Phe(m-CF3)28] GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил] [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексан-карбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил] [дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексанкарбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); Т-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбокси-нонадеканоиламино)метил]циклогексан-карбонил}амино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил] [дезаминоHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37); N-эпсилон37-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоил-сульфамоил) бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетил] [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[(S)-4-карбокси-4-((S)-4-карбокси-4-{12-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил) бутириламино]додеканоиламино}бутириламино)бутириламино]этокси}этокси)ацетил][дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-(3-((2-(2-(2-(2-(2-гексадецилоксиэтокси)этокси)этокси)этокси)этокси))пропионил)[дезаминоHis7,Clu22,Arg26,Arg34,Lys37]GLP-1(7-37)-амид; N-эпсилон37-{2-(2-(2-(2-[2-(2-(4-(гексадеканоиламино)-4-карбоксибутирил-амино)этокси)этокси]ацетил)этокси)этокси)ацетил)}-[дезаминоHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-{2-(2-(2-(2-[2-(2-(4-(гексадеканоиламино)-4-карбокси-бутириламино)этокси)этокси]ацетил)этокси)этокси)ацетил)}-дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)амид; N-эпсилон37-(2-(2-(2-(2-(2-(2-(2-(2-(2-(октадеканоил-амино)этокси)этокси)ацетиламино)этокси)этокси)ацетиламино)этокси)этокси)ацетил)[дезаминоHis7,Glu22,Arg26,Arg34,Lys37] GLP-1 (7-37)амид; N-эпсилон37-[4-(16-(1Н-тетразол-5-ил)гексадеканоилсульфамоил) бутирил] [дезаминоHis7,Glu22,Arg26) Arg34, Lys37]GLP-1-(7-37)амид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(19-карбоксинонадеканоиламино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил] [дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); N-эпсилон37-(2-{2-[2-((S)-4-карбокси-4-{(S)-4-карбокси-4-[(S)-4-карбокси-4-(19-карбокси-нонадеканоиламино)бутириламино]бутириламино}бутириламино)этокси]этокси}ацетил)[дезаминоHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); N-эпсилон37-{2-[2-(2-{(S)-4-[(S)-4-(12-{4-[16-(2-трет-бутил-2Н-тетразол-5-ил)-гексадеканоилсульфамоил] бутириламино}додеканоиламино)-4-карбоксибутириламино]-4-карбоксибутириламино}этокси)этокси]ацетил}[дезаминоHis7,Glu22,Arg26,Arg34,Lys37] GLP-1 (7-37); N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбокси-гептадеканоиламино)-бутириламино]-этокси}-этокси)-ацетиламино]-этокси}-этокси)-ацетил] [Aib8,Glu22, Arg26,Arg34,Lys37]GLP-1-(7-37); N-альфа37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбокси-гептадеканоиламино)-бутириламино]-этокси}-этокси)-ацетиламино]-этокси}-этокси)-ацетил] [Aib8,Glu22,Arg26,Arg34,эпсилон-Lys37]GLP-1-(7-37)пептид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбокси-гептадеканоиламино)-бутириламино]-этокси}-этокси)-ацетиламино]-этокси}-этокси)-ацетил] [дезаминоHis7,Glu22,Arg26,Arg34,Lys37] GLP-1-(7-37); N-эпсилон36-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(15-карбокси-пентадеканоиламино)-бутириламино]-этокси}-этокси)-ацетиламино]-этокси}-этокси)-ацетил] [дезаминоHis7, Glu22,Arg26,Glu30,Arg34,Lys36] GLP-1-(7-37)-Glu-Lys пептид; N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-({транс-4-[(19-карбоксинонадеканоиламино)метил]циклогексанкарбонил}амино)бутирил-амино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); N-эпсилон37-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбокси-гептадеканоиламино)-бутириламино]-этокси}-этокси)-ацетиламино]-этокси}-этокси)-ацетил]-[Aib8,Glu22,Arg26,Arg34,Aib35,Lys37]GLP-1-(7-37); N-эпсилон37-[(S)-4-карбокси-4-(2-{2-[2-(2-{2-[2-(17-карбоксигептадеканоиламино) этокси]этокси}ацетиламино)этокси]этокси}ацетиламино)бутирил][Aib8,Glu22,Arg26,34,Lys37] GLP-1 (7-37); N-эпсилон37-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-4(S)-карбоксибутириламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил] [lmPr7,Glu22,Arg26,34,Lys37], GLP-1-(7-37); N-эпсилон26-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбоксифенокси) деканоиламино]бутириламино}этокси)этокси]ацетиламино}этокси)этокси]ацетил}, N-эпсилон37-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбокси-фенокси) деканоиламино]бутириламино}этокси)этокси]ацетиламино}этокси)этокси]ацетил}-[Aib8,Arg34,Lys37]GLP-1(7-37)-ОН; N-эпсилон26 (17-карбоксигептадеканоил)-[Aib8,Arg34]GLP-1-(7-37)-пептид; N-эпсилон26-(19-карбоксинонадеканоил)-[Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-(4-{[N-(2-карбоксиэтил)-N-(15-карбоксипентадеканоил)амино]метил}бензоил[Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-4(S)-карбоксибутириламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(19-карбоксинонадеканоиламино)-4(S)-карбоксибутириламино]этокси)этокси] ацетиламино)этокси]этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-4(S)-карбоксибутириламино]этокси)этокси] ацетиламино)этокси]этокси)ацетил][3-(4-имидазолил)пропионил7,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-(карбоксиметил-амино)ацетиламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-3(S)-сульфопропиониламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-4(S)-карбоксибутириламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил][Cly8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-4(S)-карбоксибутириламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Arg34]GLP-1-(7-37)-амид; N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-4(S)-карбоксибутириламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил] [Aib8,Arg34,Pro37]GLP-1-(7-37)амид; Aib8,Lys26(N-эпсилон26-{2-(2-(2-(2-[2-(2-(4-(пентадеканоиламино)-4-карбоксибутириламино)этокси)этокси]ацетил)этокси)этокси)ацетил)}), Arg34)GLP-1Н(7-37)-ОН; N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-{[N-(2-карбоксиэтил)-N-(17-карбоксигептадеканоил)амино]метил}бензоил)амино]этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Arg34]GLP-1(7-37); N-альфа7-формил, N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоил-амино)-4(S)-карбокси-бутириламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил] [Arg34]GLP-1-(7-37); N-эпсилон2626-[2-(2-[2-(2-[2-(2-[4-(17-карбоксигептадеканоиламино)-4(S)-карбокси-бутириламино]этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Glu22,Arg34]GLP-1-(7-37); N-эпсилон26{3-[2-(2-{2-[2-(2-{2-[2-(2-[4-(15-(N-((S)-1,3-дикарбоксипропил)карбамоил)пентадеканоиламино)-(S)-4-карбоксибутириламино]этокси)этокси]этокси}этокси)этокси]этокси}этокси)этокси]пропионил} [Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-{[N-(2-карбоксиэтил)-N-(17-карбокси-гептадеканоил)амино]метил}бензоил)амино](4(S)-карбоксибутирил-амино)этокси) этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Arg34] GLP-1(7-37); N-эпсилон26-{(S)-4-карбокси-4-((S)-4-карбокси-4-((S)-4-карбокси-4-((S)-4-карбокси-4-(19-карбокси-нонадеканоиламино)бутириламино)бутириламино)бутириламино) бутириламино} [Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-4-(17-карбоксигептадеканоил-амино)-4(S)-карбоксибутирил-[Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-{3-[2-(2-{2-[2-(2-{2-[2-(2-[4-(17-карбоксигептаноиламино)-4(S)-карбоксибутириламино]этокси)этокси]этокси} этокси)этокси]этокси}этокси)этокси]пропионил}[Aib8,Arg34]GLP-1-(7-37); N-эпсилон26-{2-(2-(2-(2-[2-(2-(4-(17-карбоксигептадеканоиламино)-4-карбоксибутириламино) этокси)этокси]ацетил)этокси)этокси)ацетил)}-[Aib8,22,27130,35,Arg34,Pro37,Lys26]GLP-1 (7-37)амид; N-эпсилон26-[2-(2-[2-[4-(21-карбоксиунэйкозаноиламино)-4(S)-карбоксибутириламино]этокси]этокси)ацетил][Aib8,Arg34]GLP-1-(7-37); и N-эпсилон26-[2-(2-[2-(2-[2-(2-[4-(21-карбоксиунэйкозаноиламино)-4(S)-карбоксибутириламино] этокси)этокси]ацетиламино)этокси]этокси)ацетил][Aib8,Arg34]GLP-1-(7-37). В одном воплощении пептид GLP-1 представляет собой N-эпсилон26-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбоксифенокси) деканоиламино]бутириламино}этокси)этокси] ацетиламино}этокси) этокси]ацетил}, N-эпсилон37-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбокси-фенокси) деканоиламино] бутириламино}этокси)этокси]ацетиламино}этокси)этокси]ацетил}-[Aib8,Arg34,Lys37]GLP-1(7-37)-OH (Соединение А).

В одном воплощении пептид GLP-1 представляет собой N-эпсилон26-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбоксигептадеканоиламино)бутириламино]этокси}этокси)ацетиламино] этокси}этокси)ацетил][Aib8,Arg34]GLP-1(7-37), также известный как семаглутид.

В одном воплощении пептиды GLP-1 могут быть получены подходящей дериватизацией на подходящей пептидной основной цепи, которая была получена методикой генной инженерии или пептидным синтезом (например, твердофазный синтез по типу синтеза Merrifield), как известно в области пептидного синтеза и химии пептидов.

В одном воплощении получение пептидов, подобных GLP-1(7-37), и аналогов CLP-1 хорошо известно в данной области. Группировку GLP-1 пептида GLP-1 по изобретению (или ее фрагменты), например, можно получать классическим пептидным синтезом, например, твердофазным пептидным синтезом с использованием химии трет-Boc или Fmoc, или другими общепринятыми методиками, см., например, Greene and Wuts, "Protective Groups in Organic Synthesis", John Wiley & Sons, 1999, Florencio Zaragoza Dörwald, "Organic Synthesis on solid Phase", Wiley-VCH Verlag GmbH, 2000 и "Fmoc Solid Phase Peptide Synthesis", под редакцией W.C. Chan и P.D. White, Oxford University Press, 2000.

В одном воплощении пептиды GLP-1 можно получать методами генной инженерии, а именно: культивированием клетки-хозяина, содержащей последовательность ДНК, кодирующую пептид GLP-1, и способной экспрессировать пептид в подходящей питательной среде при условиях, обеспечивающих экспрессию пептида. Неограничивающими примерами клеток-хозяев, подходящих для экспрессии данных пептидов, являются Escherichia coli, Saccharomyces cerevisiae, а также линии клеток млекопитающих ВНК (почки новорожденного хомяка) или СНО (яичника китайского хомяка).

В одном воплощении пептиды GLP-1 по изобретению, которые включают не встречающиеся в природе аминокислоты и/или ковалентно присоединенный N-концевой моно- или дипептидный миметик, могут, например, быть получены, как описано в экспериментальном разделе. Или см., например, Hodgson et al.: "The synthesis of peptides and proteins containing non-natural amino acids", Chemical Society Reviews, vol. 33, no. 7 (2004), p. 422-430 и WO 2009/083549 A1, названную "Semi-recombinant preparation of GLP-1 analogues".

Соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты

Агент для доставки, используемый в настоящем изобретении, представляет собой соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты. В некоторых воплощениях агент для доставки представляет собой усилитель поглощения. Структурная формула N-(8-(2-гидроксибензоил)амино)каприлата показана в формуле (I).

В некоторых воплощениях соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты находится в форме каприловой кислоты и/или в форме каприлата. В некоторых воплощениях соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты содержит один одновалентный катион, два одновалентных катиона или один двухвалентный катион. В некоторых воплощениях соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты выбрана из группы, состоящей из натриевой соли, калиевой соли и кальциевой соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

Соли N-(8-(2-гидроксибензоил)амино)каприлата могут быть получены с использованием способа, описанного, например, в WO 96/030036, WO 00/046182, WO 01/092206 или WO 2008/028859.

Соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты может быть кристаллической и/или аморфной. В некоторых воплощениях агент для доставки содержит ангидрат, моногидрат, дигидрат, тригидрат, сольват или одну треть гидрата соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, а также их комбинации. В некоторых воплощениях агент для доставки представляет собой соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, как описано в WO 2007/121318. Соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты может быть любым ее полиморфом.

В некоторых воплощениях агент для доставки представляет собой N-(8-(2-гидроксибензоил)амино)каприлат натрия (именуемый здесь «SNAC»), также известный как 8-(салицилоиламино)октаноат.

В некоторых воплощениях количество соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты в композиции находится в интервале 0,6-3,5 ммоль. В некоторых воплощениях количество соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты в композиции составляет по меньшей мере 0,6 ммоль, как, например, выбрано из группы по меньшей мере 0,8 ммоль или по меньшей мере 0,9 ммоль. В некоторых воплощениях количество соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты в композиции составляет вплоть до 2,5 ммоль. В некоторых воплощениях количество соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты в композиции составляет 0,6-2,0 ммоль. В некоторых воплощениях количество соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты составляет 1 ммоль, как, например, 1,08 ммоль.

В некоторых воплощениях количество SNAC в композиции находится в интервале 100-1000 мг. В некоторых воплощениях количество SNAC в композиции составляет по меньшей мере 150 мг или по меньшей мере 250 мг. В некоторых воплощениях количество SNAC в композиции составляет вплоть до 800 мг, как, например, вплоть до 700 мг или вплоть до 600 мг. В некоторых воплощениях количество SNAG в композиции составляет 300 мг.

В некоторых воплощениях молярное отношение между агонистом GLP-1 (т.е. пептидом GLP-1) и агентом для доставки в композиции составляет меньше чем 10, как, например, меньше чем 5 или меньше чем 1. В некоторых воплощениях молярное отношение между агонистом GLP-1 (т.е. пептидом GLP-1) и агентом для доставки в композиции составляет меньше чем 1/10, как, например, меньше чем 1/100 или меньше чем 5/1000.

Фармацевтические индикаторы

Настоящее изобретение также относится к композиции или грануле по изобретению для применения в качестве лекарственного средства. В одном воплощении композицию или гранулу вводят перорально.

В конкретных воплощениях композицию или гранулу по изобретению можно использовать для следующих видов медицинского лечения, которые все предпочтительно так или иначе относятся к диабету:

(i) предупреждение и/или лечение всех форм диабета, таких как гипергликемия, диабет типа 2, нарушенная толерантность к глюкозе, диабет типа 1, неинсулинозависимый диабет, MODY (юношеский диабет взрослого типа), гестационный диабет и/или уменьшение HbA1C;

(ii) задержка или предупреждение прогрессирования диабетического заболевания, как, например, прогрессирования диабета типа 2, задержка прогрессирования нарушенной толерантности к глюкозе (IGT) до требующего инсулина диабета типа 2, и/или задержка прогрессирования не требующего инсулина диабета типа 2 до требующего инсулина диабета типа 2;

(iii) улучшение функции β-клеток, как, например, уменьшение апоптоза β-клеток, усиление функции β-клеток и/или увеличение массы β-клеток, и/или восстановление чувствительности к глюкозе β-клеток;

(iv) предупреждение и/или лечение когнитивных расстройств;

(v) предупреждение и/или лечение расстройств питания, таких как ожирение, например, путем уменьшения потребления пищи, уменьшения массы тела, подавления аппетита, индуцирования чувства сытости; лечение или предупреждение компульсивного переедания, нейрогенной булимии и/или ожирения, индуцированного введением антипсихотического средства или стероида; уменьшение перистальтики желудка; и/или задержки опорожнения желудка;

(vi) предупреждение и/или лечение диабетических осложнений, таких как нейропатия, включая периферическую нейропатию; нефропатия; или ретинопатия;

(vii) улучшение параметров липидного обмена, как, например, предупреждение и/или лечение дислипидемии, уменьшение общего содержания липидов в сыворотке; снижение уровня HDL (липопротеины высокой плотности); снижение уровня маленьких плотных LDL (липопротеины низкой плотности); снижение уровня VLDL (липопротеины очень низкой плотности); снижение уровня триглицеридов; снижение уровня холестерина; увеличение уровня HDL; снижение у человека плазматических уровней липопротеина а (Lp(a)); ингибирование генерации аполипопротеина а (apo(а)) in vitro и/или in vivo;

(viii) предупреждение и/или лечение сердечно-сосудистых заболеваний, таких как синдром X; атеросклероз; инфаркт миокарда; заболевание коронарных артерий; инсульт; ишемия мозга; ранее сердечное или ранее сердечно-сосудистое заболевание, такое как гипертрофия левого желудочка; заболевание коронарных артерий; первичная артериальная гипертензия; острый гипертонический криз; кардиомиопатия; сердечная недостаточность; недостаточная выносливость при физических нагрузках; хроническая сердечная недостаточность; аритмия; сердечная аритмия; обморок; атеросклероз; легкая хроническая сердечная недостаточность; стенокардия; реокклюзия сердечных шунтов; перемежающаяся хромота (облитерирующий атеросклероз); диастолическая дисфункция и/или систолическая дисфункция;

(ix) предупреждение и/или лечение желудочно-кишечных заболеваний, таких как синдром воспаленного кишечника; синдром тонкой кишки или болезнь Крона; диспепсия и/или язвы желудка;

(x) предупреждение и/или лечение критического заболевания, как, например, лечение критически больного пациента, пациента с критической полинефропатией (CIPNP) и/или пациента с потенциальной CIPNP; предупреждение критического заболевания или развития CIPNP; предупреждение, лечение и/или терапия у пациента синдрома системного воспалительного ответа (SIRS); и/или предупреждение или уменьшение вероятности страдания пациента от бактериемии, септицемии и/или септического шока во время госпитализации; и/или

(xi) предупреждение и/или лечение синдрома поликистоза яичника (PCOS).

В конкретном воплощении показание выбрано из группы, состоящей из (i)-(iii) и (v)-(viii), таких как показания (i), (ii) и/или (iii); или показание (v), показание (vi), показание (vii) и/или показание (viii).

В другом конкретном воплощении показание представляет собой показание (i). В другом конкретном воплощении показание представляет собой показание (v). В еще одном другом конкретном воплощении показание представляет собой показание (viii).

В одном воплощении изобретение относится к композиции или грануле по изобретению для лечения диабета или ожирения, где указанная гранула вводится перорально. В одном воплощении изобретение относится к способу лечения диабета или ожирения, включающему пероральное введение композиции, содержащей композицию или гранулу по изобретению, пациенту, нуждающемуся в этом.

Следующие показания являются особенно предпочтительными: диабет типа 2 и/или ожирение.

КОНКРЕТНЫЕ ВОПЛОЩЕНИЯ

Следующее представляет собой конкретные воплощения данного изобретения

1. Фармацевтическая композиция, содержащая первый тип и второй тип гранул, в которой указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, и в которой указанный второй тип гранул содержит пептид GLP-1.

2. Фармацевтическая композиция по воплощению 1, в которой указанный первый тип гранул не содержит пептид GLP-1.

3. Фармацевтическая композиция по любому из воплощений 1-2, в которой указанный второй тип гранул не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

4. Фармацевтическая композиция по любому из воплощений 1-3, в которой указанный первый тип гранул, кроме того, содержит смазку, такую как стеарат магния.

5. Фармацевтическая композиция по любому из воплощений 1-4, в которой указанный первый тип гранул, кроме того, содержит наполнитель, такой как микрокристаллическая целлюлоза.

6. Фармацевтическая композиция по любому из воплощений 1-5, в которой указанный второй тип гранул, кроме того, содержит наполнитель, такой как микрокристаллическая целлюлоза.

7. Фармацевтическая композиция по любому из воплощений 1-6, в которой указанный второй тип гранул, кроме того, содержит связующее вещество, такое как повидон.

8. Фармацевтическая композиция по любому из воплощений 1-7, в которой гранулы изготовляют сухим гранулированием, как, например, вальцеванием.

9. Фармацевтическая композиция по любому из воплощений 1-8, в которой высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты происходит одновременно или быстрее, чем высвобождение указанного пептида GLP-1.

10. Фармацевтическая композиция по любому из воплощений 1-9, где указанное высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты и/или указанного пептида GLP-1 определяется путем тестирования растворения с использованием анализа (I), и где указанное высвобождение возможно определяется в пределах 30 минут указанного тестирования растворения.

11. Фармацевтическая композиция, содержащая соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты является одновременным или более быстрым, чем высвобождение указанного пептида GLP-1 при определении путем тестирования растворения с использованием анализа (I).

12. Фармацевтическая композиция по любому из воплощений 1-11, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах первых 60 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

13. Фармацевтическая композиция по любому из воплощений 1-12, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 55 минут, как, например, в пределах 50, 45, 40, 39, 38, 37, 36, 35, 34, 33, 32 или 31 минуты при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

14. Фармацевтическая композиция по любому из воплощений 1-13, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах первых 30 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

15. Фармацевтическая композиция по любому из воплощений 1-14, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 31 минуты, как, например, в пределах 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55 или 60 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

16. Фармацевтическая композиция по любому из воплощений 1-15, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 30 минут, как, например, в пределах 25, 20, 15, 10 или 5 минут при определении путем тестирования растворения с использованием анализа (I) при pH 2,5.

17. Фармацевтическая композиция по любому из воплощений 1-16, где указанное тестирование растворения с использованием анализа (I) проводится при любом значении pH от 1,0 до 8,0.

18. Фармацевтическая композиция по любому из воплощений 1-17, где указанное тестирование растворения с использованием анализа (I) проводится при pH 1,0.

19. Фармацевтическая композиция по любому из воплощений 1-18, где указанное тестирование растворения с использованием анализа (I) проводится при pH 2,5.

20. Фармацевтическая композиция по любому из воплощений 1-19, где указанное тестирование растворения с использованием анализа (I) проводится при pH 6,8.

21. Фармацевтическая композиция по любому из воплощений 1-20, где соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

22. Фармацевтическая композиция по любому из воплощений 1-21, где пептид GLP-1 содержит группировку, связывающуюся с альбумином.

23. Фармацевтическая композиция по любому из воплощений 1-22, где пептид GLP-1 представляет собой N-эпсилон26-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбоксигептадеканоиламино) бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][aib8,Arg34]CLP-1(7-37).

24. Фармацевтическая композиция по любому из воплощений 1-23, где указанная композиция, кроме того, содержит один или более чем один фармацевтически приемлемый эксципиент.

25. Фармацевтическая композиция по любому из воплощений 1-24, где указанная композиция находится в виде твердой лекарственной формы.

26. Фармацевтическая композиция по любому из воплощений 1-25, где указанная композиция находится в форме таблетки.

27. Фармацевтическая композиция по любому из воплощений 1-26, где указанная композиция находится в форме капсулы.

28. Фармацевтическая композиция по любому из воплощений 1-27, где указанная композиция находится в форме пакетика.

29. Фармацевтическая композиция по любому из воплощений 1-28, кроме того, имеющая любую комбинацию характеристик согласно воплощениям 1-28.

30. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом;

б) сухое гранулирование смеси со стадии а;

в) смешивание гранул, полученных на стадии б, с композицией, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты; и

г) возможно добавление дополнительной смазки.

31. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем;

б) сухое гранулирование смеси со стадии а;

в) смешивание гранул, полученных на стадии б, с композицией, содержащей пептид GLP-1; и

г) возможно добавление дополнительной смазки.

32. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом;

б) сухое гранулирование смеси со стадии а;

в) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, возможно смазки и/или наполнителя;

г) сухое гранулирование смеси со стадии в;

д) смешивание гранул, полученных на стадии б, с гранулами, полученными на стадии г; и

е) возможно добавление другой смазки.

33. Способ по любому из воплощений 30-32, где указанное сухое гранулирование представляет собой вальцевание.

34. Способ по любому из воплощений 30-33, где указанная соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

35. Способ по любому из воплощений 30-34, где указанный пептид GLP-1 представляет собой семаглутид.

36. Способ по любому из воплощений 30-35, где указанная смазка и/или указанная дополнительная смазка представляет собой стеарат магния.

37. Способ по любому из воплощений 30-36, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

38. Способ по любому из воплощений 30-37, где указанное связующее вещество представляет собой повидон.

39. Способ по любому из воплощений 30-38, где указанная стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 20 минут, как, например, по меньшей мере 30 минут или по меньшей мере 40 минут, как, например, 50 минут.

40. Способ по любому из воплощений 30-39, где указанное смешивание, включающее смешивание первого типа гранул, содержащих пептид GLP-1, со вторым типом гранул, содержащих соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, имеет продолжительность по меньшей мере 15 минут или по меньшей мере 20 минут, как, например, 25 минут или по меньшей мере 30 минут.

41. Фармацевтическая композиция, полученная способом, как определено по любому из воплощений 30-40.

42. Фармацевтическая композиция, как определено по любому из воплощений 1-29 или 41, для применения в медицине.

43. Фармацевтическая композиция, как определено по любому из воплощений 1-29 или 41, для лечения диабета или ожирения.

44. Фармацевтическая композиция по воплощению 42 или 43, где указанная фармацевтическая композиция вводится перорально.

45. Способ лечения диабета или ожирения, включающий введение композиции, содержащей фармацевтическую композицию, как определено по любому из воплощений 1-29 или 41, пациенту, нуждающемуся в этом.

46. Способ по воплощению 45, где указанная композиция вводится перорально.

47. Гранула, содержащая соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, смазку и наполнитель.

48. Гранула, содержащая соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и смазку.

49. Гранула, содержащая пептид GLP-1, наполнитель и связующее вещество.

50. Гранула по любому из воплощений 47-49, где указанная смазка представляет собой стеарат магния.

51. Гранула по любому из воплощений 47-50, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

52. Гранула по любому из воплощений 47-51, где указанное связующее вещество представляет собой повидон.

53. Гранула по любому из воплощений 47-52, где указанную гранулу получают согласно способу, как определено в любом из воплощений 30-40.

54. Способ получения гранулы, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, где данный способ включает следующие стадии:

а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты (такой как SNAC) со смазкой и/или наполнителем; и

б) сухое гранулирование смеси со стадии а.

55. Способ по воплощению 54, где указанная соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

56. Способ по воплощению 54 или 55, где указанная смазка представляет собой стеарат магния.

57. Способ по любому из воплощений 54-56, где указанная стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 20 минут, как, например, по меньшей мере 30 минут или по меньшей мере 40 минут, как, например, 50 минут.

58. Способ получения гранулы, содержащей пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1, возможно, наполнителя и/или связующего вещества; и

б) вальцевание смеси со стадии а.

59. Способ по воплощению 58, где указанный пептид GLP-1 представляет собой семаглутид.

60. Способ по любому из воплощений 58-59, где указанное связующее вещество представляет собой повидон.

61. Способ по любому из воплощений 58-60, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

62. Способ по любому из воплощений 58-61, где указанное сухое гранулирование представляет собой вальцевание.

63. Гранула, полученная способом, как определено в любом из воплощений 58-62.

64. Способ увеличения пероральной биодоступности пептида GLP-1, включающий введение пациенту, нуждающемуся в этом, композиции, как определено в любом из воплощений 1-29 или 41.

65. Фармацевтическая композиция по любому из воплощений 1-64, где указанное одновременное или более быстрое высвобождение определяется в пределах 30 минут, как, например, в пределах 25, 20, 15 или 10 мин, при определении тестированием растворения с использованием анализа (I).

66. Фармацевтическая композиция по любому из воплощений 1-65, где указанное одновременное или более быстрое высвобождение определяется в пределах 30 минут, как, например, в пределах 25, 20, 15 или 10 мин, при определении тестированием растворения с использованием анализа (I) при pH 2,5.

ДРУГИЕ КОНКРЕТНЫЕ ВОПЛОЩЕНИЯ

Следующее представляет собой другие конкретные воплощения данного изобретения.

1. Фармацевтическая композиция, содержащая соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты является одновременным или более быстрым, чем высвобождение указанного пептида GLP-1 при определении тестированием растворения с использованием анализа (I).

2. Фармацевтическая композиция по воплощению 1, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах первых 30 минут при определении тестированием растворения с использованием анализа (I) при pH 2,5.

3. Фармацевтическая композиция по любому из воплощений 1-2, где количество растворенной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах 31 минуты, как, например, в пределах 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55 или 60 минут, при определении тестированием растворения с использованием анализа (I) при pH 2,5.

4. Фармацевтическая композиция по любому из воплощений 1-3, где указанное тестирование растворения с использованием анализа (I) проводится при любом pH от 1,0 до 8,0.

5. Фармацевтическая композиция по любому из воплощений 1-4, где указанное тестирование растворения с использованием анализа (I) проводится при pH 1,0.

6. Фармацевтическая композиция по любому из воплощений 1-5, где указанное тестирование растворения с использованием анализа (I) проводится при pH 2,5.

7. Фармацевтическая композиция по любому из воплощений 1-6, где указанное тестирование растворения с использованием анализа (I) проводится при pH 6,8.

8. Фармацевтическая композиция по любому из воплощений 1-7, где соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

9. Фармацевтическая композиция по любому из воплощений 1-8, где пептид GLP-1 содержит группировку, связывающуюся с альбумином.

10. Фармацевтическая композиция по любому из воплощений 1-9, где пептид GLP-1 представляет собой N-эпсилон26-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбоксигептадеканоиламино) бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1(7-37).

11. Фармацевтическая композиция, содержащая первый тип и второй тип гранул, где указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, и указанный второй тип гранул содержит пептид GLP-1.

12. Фармацевтическая композиция по воплощению 11, где указанный первый тип гранул, кроме того, содержит смазку, такую как стеарат магния.

13. Фармацевтическая композиция по воплощению 11 или 12, где указанный первый тип гранул, кроме того, содержит наполнитель, такой как микрокристаллическая целлюлоза.

14. Фармацевтическая композиция по любому из воплощений 11-13, где указанный второй тип гранул, кроме того, содержит наполнитель, такой как микрокристаллическая целлюлоза.

15. Фармацевтическая композиция по любому из воплощений 11-14, где указанный второй тип гранул, кроме того, содержит связующее вещество, такое как повидон.

16. Фармацевтическая композиция по любому из воплощений 11-15, где гранулы изготовляются путем сухого гранулирования, как, например, путем вальцевания.

17. Фармацевтическая композиция по любому из воплощений 11-16, кроме того, содержащая любую комбинацию характеристик по воплощениям 1-10.

18. Фармацевтическая композиция по любому из воплощений 1-17, где указанная композиция, кроме того, содержит один или более чем один фармацевтически приемлемый эксципиент.

19. Фармацевтическая композиция по любому из воплощений 1-18, где указанная композиция находится в виде твердой лекарственной формы.

20. Фармацевтическая композиция по любому из воплощений 1-19, где указанная композиция находится в форме таблетки.

21. Фармацевтическая композиция по любому из воплощений 1-20, где указанная композиция находится в форме капсулы.

22. Фармацевтическая композиция по любому из воплощений 1-21, где указанная композиция находится в форме пакетика.

23. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом;

б) сухое гранулирование смеси со стадии а;

в) смешивание гранул, полученных на стадии б, с композицией, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты; и

г) возможно добавление дополнительной смазки.

24. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем;

б) сухое гранулирование смеси со стадии а;

в) смешивание гранул, полученных на стадии б, с композицией, содержащей пептид GLP-1; и

г) возможно добавление дополнительной смазки.

25. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом;

б) сухое гранулирование смеси со стадии а;

в) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, возможно смазки и/или наполнителя;

г) сухое гранулирование смеси со стадии в;

д) смешивание гранул, полученных на стадии б, с гранулами, полученными на стадии г; и

е) возможно добавление дополнительной смазки.

26. Способ по любому из воплощений 23-25, где указанное сухое гранулирование представляет собой вальцевание.

27. Способ по любому из воплощений 23-26, где указанная соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

28. Способ по любому из воплощений 23-27, где указанный пептид GLP-1 представляет собой семаглутид.

29. Способ по любому из воплощений 23-28, где указанная смазка и/или указанная дополнительная смазка представляет собой стеарат магния.

30. Способ по любому из воплощений 23-29, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

31. Способ по любому из воплощений 23-30, где указанное связующее вещество представляет собой повидон.

32. Способ по любому из воплощений 23-31, где указанная стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 30 минут или по меньшей мере 40 минут, как, например, 50 минут.

33. Способ по любому из воплощений 23-32, где указанное смешивание, включающее смешивание первого типа гранул, содержащих пептид GLP-1, со вторым типом гранул, содержащих соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, имеет продолжительность по меньшей мере 15 минут или по меньшей мере 20 минут, как, например, 25 минут.

34. Фармацевтическая композиция, полученная способом, как определено в любом из воплощений 23-33.

35. Фармацевтическая композиция, как определено в любом из воплощений 1-22 или 34, для применения в медицине.

36. Фармацевтическая композиция, как определено в любом из воплощений 1-22 или 34, для лечения диабета или ожирения.

37. Фармацевтическая композиция по воплощению 35 или 36, где указанная фармацевтическая композиция вводится перорально.

38. Способ лечения диабета или ожирения, включающий введение композиции, содержащей фармацевтическую композицию, как определено в любом из воплощений 1-22 или 34, пациенту, нуждающемуся в этом.

39. Способ по воплощению 38, где указанная композиция вводится перорально.

40. Гранула, содержащая соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, смазку и наполнитель.

41. Гранула, содержащая соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и смазку.

42. Гранула, содержащая пептид GLP-1, наполнитель и связующее вещество.

43. Гранула по любому из воплощений 40-42, где указанная смазка представляет собой стеарат магния.

44. Гранула по любому из воплощений 40-43, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

45. Гранула по любому из воплощений 40-44, где указанное связующее вещество представляет собой повидон.

46. Гранула по любому из воплощений 40-45, где указанную гранулу получают согласно способу, как определено в любом из воплощений 23-34.

47. Способ получения гранулы, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, где данный способ включает следующие стадии:

а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты (такой как SNAC) со смазкой и/или наполнителем; и

б) сухое гранулирование смеси со стадии а.

48. Способ по воплощению 47, где указанная соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

49. Способ по воплощению 47 или 48, где указанная смазка представляет собой стеарат магния.

50. Способ по любому из воплощений 47-49, где указанная стадия смешивания, включающая смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем до сухого гранулирования, имеет продолжительность по меньшей мере 30 минут или по меньшей мере 40 минут, как, например, 50 минут.

51. Способ получения гранулы, содержащей пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1, возможно наполнителя и/или связующего вещества и

б) вальцевание смеси со стадии а.

52. Способ по воплощению 51, где указанный пептид GLP-1 представляет собой семаглутид.

53. Способ по любому из воплощений 51-52, где указанное связующее вещество представляет собой повидон.

54. Способ по любому из воплощений 47-53, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

55. Способ по любому из воплощений 47-54, где указанное сухое гранулирование представляет собой вальцевание.

56. Гранула, полученная способом, как определено в любом из воплощений 47-55.

57. Гранула, как определено в любом из воплощений 40-46 или 56, для применения в медицине.

58. Гранула, как определено в любом из воплощений 40-46 или 56, для лечения диабета или ожирения.

59. Гранула по воплощению 57 или 58, где указанная гранула вводится перорально в фармацевтической композиции.

60. Способ лечения диабета или ожирения, включающий пероральное введение фармацевтической композиции, содержащей гранулу, как определено в любом из воплощений 40-46 или 56, пациенту, нуждающемуся в этом.

61. Способ по воплощению 60, где указанная фармацевтическая композиция вводится перорально.

ПРИМЕРЫ

Материалы и методы

Общие способы получения

Сухое гранулирование

Сухое гранулирование проводили вальцеванием на MINI-PACTOR от Gerteis с использованием гладких вальцов и установок, перечисленных в Таблице 1.

Силу вальцевания, т.е. силу между вальцами роликового пресса при прессовании веществ в непрерывную полоску прессованного вещества, определяли датчиком давления, который преобразует гидравлическое давление в электрический сигнал; силу вальцевания можно измерять в килоньютонах (кН) или в килоньютонах на ширину вальца (кН/см).

После сухого гранулирования проводили измельчение формовок на гранулы.

Получение таблетки

Таблетки получали на Korsch РН106 или Fette 102i, на которых был смонтирован самотечный питатель и один набор штампов, что давало выгнутые овальные таблетки 13 мм × 7,5 мм, не имеющие линию разлома. Скорость пресса Korsch РН106 была установлена на уровне примерно 25 об/мин, и противодавление доводили до 40 кН. Скорость пресса Fette 102i была установлена на уровне примерно 20 об/мин. Объем заполнения доводили для получения таблеток, имеющих намеченную массу 407,7 мг. Силу прессования устанавливали для получения таблеток с сопротивлением дроблению около 180±20 Н для Korsch РН106 и около 128 Н для Fette 102i.

Устойчивость таблеток к дроблению

Устойчивость таблеток к дроблению определяли согласно разделу 2.9.8. в Европейской Фармакопее 7.5, 7-е издание 2012 г. и при скорости тисков 20 Н/с.

Общие способы детекции и характеризации

Анализ (I): тестирование растворения

Тест на растворение проводили с использованием установки 2 согласно Фармакопее Соединенных Штатов 35, используя скорость вращения лопатки 50 об/мин. Для тестирования при pH 1,0; 2,5 или 6,8 использовали 500 мл среды для растворения из 0,1 н. соляной кислоты (pH 1,0), 0,05 М фталатного буфера (pH 2,5) или 0,05 М фосфатного буфера (pH 6,8) соответственно при температуре 37°С. Все среды для растворения имели Tween80 в содержании 0,1%. Аликвоты образцов удаляли с подходящими интервалами времени, и образцы с кислой средой нейтрализовали трехосновным фосфатом натрия для предотвращения осаждения. Содержание в образцах определяли с использованием способа ВЭЖХ-ОФ (высокоэффективная жидкостная хроматография с обращенной фазой) для двойной детекции SNAC и GLP-1 (например, семаглутид). Способ ВЭЖХ был основан на градиентной элюции на колонке С8. Система растворителей представляла собой трифторуксусную кислоту и ацетонитрил с детекцией в УФ (ультрафиолетовая область спектра) при 210 и 335 нм. Содержание в образцах рассчитывали на основе площади пиков SNAC и GLP-1 (например, семаглутид) на хроматограмме, соответственно, относительно площади пиков стандартов SNAC и GLP-1 (например, семаглутид) соответственно. Высвобождаемые количества SNAC и GLP-1 (например, семаглутид) рассчитывали как процентные доли номинального содержания в таблетке, т.е. 300 мг/таблетку SNAC и 10 мг/таблетку GLP-1 (например, семаглутид), и затем возможно корректировали на реальное содержание в таблетках. Реальное содержание в таблетках определяли с использованием анализа (III).

Анализ (II): биодоступность у собак

Животные, дозировка и отбор крови: в исследование включали самцов и самок собак породы бигль, весящих на протяжении периода исследования приблизительно 6-22 кг. Дозирование собакам осуществляли натощак, и собак кормили приблизительно через 4 часа после дозирования. Композиции вводили собакам посредством перорального введения, типично в группах из 8 (как, например, 4 самца и 4 самки).

Исследования по биодоступности проводили либо в виде исследований с одной дозой (SD), либо исследований с многими дозами (MD). В исследованиях MD в каждом исследовании композицию вводили пятью последовательными дозированиями (дозирование один раз в сутки).

Образцы крови отбирали для получения фармакокинетического профиля. Примером схемы отбора крови при SD могли бы быть следующие моменты времени: до дозы, 0,25; 0,5; 0,75; 1; 1,5; 2; 2,5; 3; 4; 6; 8; 24; 48; 72; 96; 120; 144; 192 и 240 часов после дозирования. Примером схемы отбора крови при MD могли бы быть следующие моменты времени: до дозы; 0,5; 1,5 и 3 ч после дозирования после каждого события дозирования и схема отбора крови, эквивалентная схеме отбора крови при SD после последнего события дозирования.

Получение плазмы: все образцы крови отбирали в пробирки, содержащие EDTA (этилендиаминтетрауксусная кислота) для стабилизации, и выдерживали на льду до центрифугирования. Плазму отделяли от цельной крови центрифугированием, и плазму хранили при -20°С или при меньшей температуре до анализа.

Анализ образцов плазмы: плазму анализировали на семаглутид с использованием люминисцентного иммуноанализа с канализированием кислорода (LOCI). В анализе LOCI используются донорные шарики, покрытые стрептавидином, и акцепторные шарики, конъюгированные с моноклональным антителом, связывающимся со средней областью молекулы GLP-1 (например, семаглутида). Другое моноклональное антитело, специфичное в отношении N-концевого эпитопа, было биотинилированным. В данном анализе три реагента объединялись с GLP-1 (например, семаглутидом), что приводило к образованию иммунокомплекса с двумя сайтами. Освещение комплекса высвобождает из донорных шариков атомы синглетного кислорода, которые канализируются на акцепторные шарики и запускают хемилюминесценцию, которую измеряли на планшет-ридере EnVision. Количество света было пропорциональным концентрации семаглутида, и нижняя граница количественного измерения (LLOQ) в плазме составляла 100 пМ.

Фармакокинетические расчеты: данные по концентрации в плазме GLP-1 (например, семаглутида) подвергали некомпартментному фармакокинетическому анализу с использованием программного обеспечения на основе ПК (персональный компьютер) WinNonlin, версия 5.2 или более поздняя (Pharsight, Mountain View, СА. 94041, США). Для каждой индивидуальной собаки оценивали следующие фармакокинетические параметры: площадь под кривой (AUC), и AUC, нормированная к дозе (AUC/D). Биодоступность (F) рассчитывали как долю поглощенного (в %) на основе AUC, нормированной к дозе (AUCбеск./D), после перорального и внутривенного введения. Обобщающая статистика фармакокинетических результатов была представлена в виде среднего арифметического.

Анализ (III): анализ количества GLP-1 и SNAC

Для испытательного анализа таблетки растворяли с использованием 0,05 М Na2HPO4 с 0,01% Tween 20 в качестве экстракционного буфера. Содержание в образце определяли с использованием способа ВЭЖХ-ОФ для двойного детектирования SNAC и GLP-1 (например, семаглутида). Способ ВЭЖХ был основан на градиентной элюции на колонке С8. Система растворителей представляла собой трифторуксусную кислоту и ацетонитрил с УФ детекцией при 210 и 335 нм. Содержание в образцах рассчитывали на основе площади пиков SNAC и GLP-1 (например, семаглутид) на хроматограмме относительно площадей пиков стандартов SNAC и GLP-1 (например, семаглутид) соответственно. Содержание приводили как среднее значение для 10 таблеток.

Пример 1: получение композиций таблеток, содержащих GLP-1 и SNAC

Композиции таблеток, содержащие GLP-1 и SNAC, получали с использованием компонентов, показанных в Таблице 2. Соединение А представляет собой N-эпсилон26-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбоксифенокси) деканоиламино]бутириламино}этокси)этокси] ацетиламино}этокси)этокси]ацетил}, N-эпсилон37-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбокси-фенокси)деканоиламино] бутириламино}этокси)этокси]ацетиламино}этокси)этокси]ацетил}-[Aib8,Arg34,Lys37]GLP-1(7-37)-OH.

Композиции таблеток получали путем смешивания компонентов, перечисленных в Таблице 2, разными способами. Композиции таблеток состояли из первого типа гранул, в некоторых случаях - второго типа гранул, а также внегранулярных ингредиентов, смешанных с первым типом гранул и, при их наличии, со вторым типом гранул. Получение гранул вальцеванием и получение таблеток из композиций таблеток осуществляли, как описано в разделе Общие способы получения. Состав композиций таблеток показан в Таблице 3.

Дополнительные подробности получения композиций таблеток приведены ниже.

Композиция таблетки В

Стеарат магния для фракции первой гранулы пропускали через 355 мкм сито. Стеарат магния смешивали вручную со SNAC в чашке из нержавеющей стали в соответствующих объемах. Применяли два цикла геометрического разведения путем смешивания в течение приблизительно 60 с до тех пор, пока смесь не становилась визуально гомогенной. Остающееся количество SNAC переносили в блендер и предварительно перемешивали в течение 2 мин при 25 об/мин. Добавляли в блендер предварительно приготовленную смесь SNAC и стеарата магния, и поводили перемешивание в течение 20 мин при 25 об/мин. Смесь вальцевали. Гранулы просеивали через 180 мкм сито.

Семаглутид, микрокристаллическую целлюлозу и повидон для фракции второй гранулы взвешивали непосредственно в чашке из нержавеющей стали в порядке уменьшающихся количеств и смешивали вручную в течение по меньшей мере 3 мин, пока смесь не становилась визуально гомогенной, перед переносом предварительно приготовленной смеси в 1000 мл бутыль Дюма. Бутыль Дюма закрывали крышкой и перемешивали переворачиванием вручную движениями, напоминающими работу миксера Turbula, в течение 1 мин. Смесь вальцевали.

В контейнер для смешивания добавляли два типа гранул в порядке уменьшающегося содержания и перемешивали в течение 5 минут при 32 об/мин. Внегранулярный стеарат магния смешивали со смесью гранул путем перемешивания вручную с использованием удвоения объема, с последующим 30 с перемешиванием в миксере Turbula при 32 об/мин. Из этой композиции получали таблетки.

Композиция таблетки С

Стеарат магния для фракции гранулы пропускали через 355 мкм сито. Стеарат магния смешивали со SNAC вручную в чашке из нержавеющей стали в соответствующих объемах. Применяли два цикла геометрического разведения путем смешивания в течение приблизительно 60 с до тех пор, пока смесь не становилась визуально гомогенной. Остающееся количество SNAC переносили в блендер и предварительно перемешивали в течение 2 мин при 25 об/мин. Добавляли в блендер предварительно приготовленную смесь SNAC и стеарата магния, и проводили перемешивание в течение 20 мин при 25 об/мин. Семаглутид геометрически разводили с использованием смешанных SNAC и стеарата магния из блендера путем перемешивания вручную в течение по меньшей мере 60 с до тех пор, пока смесь не становилась визуально гомогенной. К смешанным SNAC и стеарату магния затем добавляли предварительно приготовленную смесь. Стадию перемешивания завершали путем перемешивания в блендере в течение 10 мин при 25 об/мин. Смесь вальцевали.

Гранулы и все другие компоненты, за исключением внегранулярного стеарата магния, добавляли в контейнер для смешивания в порядке уменьшения содержания и перемешивали в течение 5 минут при 32 об/мин. Внегранулярный стеарат магния смешивали со смесью гранул путем перемешивания вручную, используя удвоение объема, с последующим 30 с перемешиванием в миксере Turbula при 32 об/мин. Из данной композиции получали таблетки.

Композиция таблетки D

Стеарат магния для фракции гранул пропускали через 355 мкм сито. Стеарат магния смешивали со SNAC вручную в чашке из нержавеющей стали в соответствующих объемах. Применяли два цикла геометрического разведения путем смешивания в течение приблизительно 60 с до тех пор, пока смесь не становилась визуально гомогенной. Остающееся количество SNAC переносили в блендер и предварительно перемешивали в течение 2 мин при 25 об/мин. Добавляли в блендер предварительно приготовленную смесь SNAC и стеарата магния, и проводили перемешивание в течение 20 мин при 25 об/мин. Семаглутид и повидон взвешивали в чашке из нержавеющей стали в порядке уменьшающихся количеств, и компоненты перемешивали вручную до тех пор, пока смесь не становилась визуально гомогенной. Затем проводили геометрическое разведение с использованием смешанных SNAC и стеарата магния из блендера путем перемешивания вручную в течение по меньшей мере 60 с до тех пор, пока смесь не становилась визуально гомогенной. К смешанным SNAC и стеарату магния затем добавляли предварительно приготовленную смесь. Стадию смешивания завершали путем смешивания в блендере в течение 10 мин при 25 об/мин. Смесь вальцевали.

Гранулы и микрокристаллическую целлюлозу добавляли в контейнер для смешивания в порядке уменьшения содержания и перемешивали в течение 5 минут при 32 об/мин. Внегранулярный стеарат магния перемешивали со смесью гранул путем перемешивания вручную, используя удвоение объема, с последующим 30 с перемешиванием в миксере Turbula при 32 об/мин. Таблетки получали из данной композиции.

Композиция таблетки Е

Стеарат магния для фракции гранул пропускали через 355 мкм сито. Стеарат магния смешивали со SNAC вручную в чашке из нержавеющей стали в соответствующих объемах. Применяли два цикла геометрического разведения путем смешивания в течение приблизительно 60 с до тех пор, пока смесь не становилась визуально гомогенной. Остающееся количество SNAC переносили в блендер и предварительно перемешивали в течение 2 мин при 25 об/мин. Добавляли в блендер предварительно приготовленную смесь SNAC и стеарата магния, и проводили перемешивание в течение 20 мин при 25 об/мин. Семаглутид, микрокристаллическую целлюлозу и повидон взвешивали в чашке из нержавеющей стали в порядке уменьшающихся количеств, и компоненты смешивали вручную до тех пор, пока смесь не становилась визуально гомогенной. Затем проводили геометрическое разведение с использованием смешанных SNAC и стеарата магния из блендера путем смешивания вручную в течение по меньшей мере 60 с до тех пор, пока смесь не становилась визуально гомогенной. К смешанным SNAC и стеарату магния затем добавляли предварительно приготовленную смесь. Стадию смешивания завершали в блендере путем перемешивания в течение 10 мин при 25 об/мин. Смесь вальцевали.

Внегранулярный стеарат магния смешивали с гранулами путем смешивания вручную, используя удвоение объема, с последующим 30 с перемешиванием в миксере Turbula при 32 об/мин. Из данной композиции получали таблетки.

Композиция таблетки F

Стеарат магния для фракции гранулы один пропускали через 355 мкм сито. Стеарат магния смешивали со SNAC вручную в чашке из нержавеющей стали в соответствующих объемах. Применяли два цикла геометрического разведения путем смешивания в течение приблизительно 60 с до тех пор, пока смесь не становилась визуально гомогенной. Остающееся количество SNAC переносили в блендер и предварительно перемешивали в течение 2 мин при 25 об/мин. Добавляли в блендер предварительно приготовленную смесь SNAC и стеарата магния, и проводили перемешивание в течение 20 мин при 25 об./мин. Микрокристаллическую целлюлозу геометрически разводили с использованием смешанных SNAC и стеарата магния из блендера путем перемешивания вручную в течение по меньшей мере 60 с до тех пор, пока смесь не становилась визуально гомогенной. К смешанным SNAC и стеарату магния затем добавляли предварительно приготовленную смесь. Стадию смешивания завершали путем перемешивания в блендере в течение 10 мин при 25 об/мин. Смесь вальцевали.

Семаглутид, микрокристаллическую целлюлозу (Avicel РН 101, FMC Biopolymer) и повидон (Kollidon 90F, BASF) для фракции гранулы два взвешивали непосредственно в чашке из нержавеющей стали в порядке уменьшающихся количеств и смешивали вручную в течение по меньшей мере 3 мин, пока смесь не становилась визуально гомогенной, перед переносом предварительно приготовленной смеси в 500 мл бутыль Дюма. Бутыль Дюма закрывали крышкой и перемешивали переворачиванием вручную движениями, напоминающими работу миксера Turbula, в течение 1 мин. Смесь вальцевали.

В контейнер для смешивания добавляли два типа гранул в порядке уменьшения содержания и смешивали в течение 5 минут при 32 об/мин. Внегранулярный стеарат магния смешивали со смесью гранул путем перемешивания вручную с использованием удвоения объема, с последующим 30 с перемешиванием в миксере Turbula при 32 об/мин. Из этой композиции получали таблетки.

Композиция таблетки G

Стеарат магния для фракции первой гранулы пропускали через 355 мкм сито. Стеарат магния смешивали со SNAC вручную в полиэтиленовом мешке в соответствующих объемах. Применяли два цикла геометрического разведения путем смешивания в течение приблизительно 60 с. Добавляли в блендер предварительно приготовленную смесь SNAC и стеарата магния, с последующим добавлением остающегося SNAC, и проводили смешивание в течение 50 мин при 25 об/мин. Смесь вальцевали. Гранулы просеивали через 1000 и 90 мкм сито.

Соединение А, микрокристаллическую целлюлозу и повидон для фракции второй гранулы взвешивали непосредственно в чашке из нержавеющей стали в порядке уменьшающихся количеств и смешивали вручную в течение по меньшей мере 3 мин, пока смесь не становилась визуально гомогенной, перед переносом предварительно приготовленной смеси в 500 мл бутыль Дюма. Бутыль Дюма закрывали крышкой и перемешивали переворачиванием вручную движениями, напоминающими работу миксера Turbula, в течение 3 мин. Смесь вальцевали.

В контейнер для смешивания добавляли два типа гранул и смешивали в течение 20 минут при 25 об/мин. Внегранулярный стеарат магния пропускали через 355 мкм сито и смешивали со смесью гранул путем перемешивания вручную с использованием удвоения объема, с последующим 2 мин перемешиванием в миксере Turbula при 25 об/мин. Из этой композиции получали таблетки.

Композиция таблетки Н

Стеарат магния для фракции гранул один пропускали через 355 мкм сито. Стеарат магния смешивали со SNAC вручную в полиэтиленовом мешке в соответствующих объемах. Применяли два цикла геометрического разведения путем смешивания в течение приблизительно 60 с. Добавляли в блендер предварительно приготовленную смесь SNAC и стеарата магния, с последующим добавлением остающегося SNAC, и проводили смешивание в течение 50 мин при 25 об/мин. К смешанным SNAC и стеарату магния затем добавляли микрокристаллическую целлюлозу, и стадию смешивания завершали путем перемешивания в блендере в течение 20 мин при 25 об/мин. Смесь вальцевали.

Соединение А, микрокристаллическую целлюлозу (Avicel РН 101, FMC Biopolymer) и повидон (Kollidon 90F, BASF) для фракции гранулы два взвешивали непосредственно в чашке из нержавеющей стали в порядке уменьшающихся количеств и смешивали вручную в течение по меньшей мере 3 мин, пока смесь не становилась визуально гомогенной, перед переносом предварительно приготовленной смеси в 500 мл бутыль Дюма. Бутыль Дюма закрывали крышкой и перемешивали переворачиванием вручную движениями, напоминающими работу миксера Turbula, в течение по меньшей мере 3 мин. Смесь вальцевали.

В контейнер для смешивания добавляли два типа гранул и смешивали в течение 20 минут при 25 об/мин. Внегранулярный стеарат магния пропускали через 355 мкм сито и смешивали со смесью гранул путем перемешивания вручную с использованием удвоения объема, с последующим 2 мин перемешиванием в миксере Turbula при 25 об/мин. Из этой композиции получали таблетки.

Пример 2: растворение GLP-1 и SNAC из композиции таблетки В

Растворение семаглутида и SNAC из композиции таблетки В определяли с использованием описанного здесь анализа (I). Результаты показаны в Таблице 4. Исправленные результаты откорректированы на содержание семаглутида или SNAC, определенное с использованием описанного здесь анализа (III). Исправленные результаты показывают то, что SNAC высвобождается быстрее, чем семаглутид на протяжении исходных 20 мин растворения. Кроме того, они показывают, что различие между более быстрым высвобождением SNAC по сравнению с семаглутидом является наибольшим в среде для растворения со значением pH 2,5. Наконец, данные показывают, что в средах для растворения со значениями pH 1,0 и 2,5 количество растворенного SNAC достигает пика в пределах исходных 45 и 30 мин соответственно.

Пример 3: растворение GLP-1 и SNAC из композиции таблетки С

Растворение семаглутида и SNAC из композиции таблетки С определяли с использованием описанного здесь анализа (I). Результаты показаны в Таблице 5. Результаты показывают, что SNAC высвобождается медленнее, чем семаглутид после исходных 5 мин растворения в средах для растворения с низкими значениями pH 1,0 и 2,5. Исправленные результаты откорректированы на содержание семаглутида или SNAC, определенное с использованием описанного здесь анализа (III). На протяжении исходных 5 мин исправленного растворения в среде для растворения со значением pH 2,5 SNAC высвобождается так же быстро, как и семаглутид. Кроме того, исправленные значения растворения показывают, что SNAC высвобождается быстрее, чем семаглутид в среде для растворения со значением pH 6,8.

Пример 4: растворение GLP-1 и SNAC из композиции таблетки D

Растворение семаглутида и SNAC из композиции таблетки D определяли с использованием описанного здесь анализа (I). Результаты показаны в Таблице 6. Результаты показывают, что SNAC высвобождается медленнее, чем семаглутид после исходных 5 мин растворения в средах для растворения с низкими значениями pH 1,0 и 2,5. Исправленные результаты откорректированы на содержание семаглутида или SNAC, определенное с использованием описанного здесь анализа (III). На протяжении исходных 5 мин исправленного растворения в среде для растворения со значением pH 2,5 SNAC высвобождается так же быстро, как и семаглутид. Кроме того, исправленные значения растворения показывают, что SNAC высвобождается быстрее, чем семаглутид в среде для растворения со значением pH 6,8.

Пример 5: растворение GLP-1 и SNAC из композиции таблетки Е

Растворение семаглутида и SNAC из композиции таблетки Е определяли с использованием описанного здесь анализа (I). Результаты показаны в Таблице 7. Исправленные результаты откорректированы на содержание семаглутида или SNAC, определенное с использованием описанного здесь анализа (III). Результаты показывают, что SNAC высвобождается медленнее, чем семаглутид на протяжении всего времени растворения в среде для растворения со значением pH 1,0. В средах для растворения со значением pH 2,5 результаты показывают то, что SNAC первоначально высвобождается быстрее, чем семаглутид на протяжении исходных 10-15 мин растворения до того, как оно становится более медленным. Кроме того, данные показывают, что в среде для растворения со значением pH 2,5 количество растворенного SNAC достигает пика в пределах исходных 20 мин. Наконец, исправленные значения растворения показывают, что SNAC высвобождается быстрее, чем семаглутид, в среде для растворения со значением pH 6,8.

Пример 6: растворение GLP-1 и SNAC из композиции таблетки F

Растворение семаглутида и SNAC из композиции таблетки F определяли с использованием описанного здесь анализа (I). Результаты показаны в Таблице 8. Исправленные результаты откорректированы на содержание семаглутида или SNAC, определенное с использованием описанного здесь анализа (III). Исправленные результаты показывают то, что SNAC высвобождается быстрее, чем семаглутид на протяжении исходных 20-30 мин растворения. Кроме того, они показывают, что различие между более быстрым высвобождением SNAC по сравнению с семаглутидом является наибольшим в среде для растворения со значением pH 2,5. Наконец, данные показывают, что в среде для растворения со значением pH 2,5 количество растворенного SNAC достигает пика в пределах исходных 30 мин.

Пример 7: биодоступность GLP-1 из композиций таблеток B-F у собак

Биодоступность GLP-1 из композиций таблеток B-F определяли у собак согласно описанному здесь анализу (II). Результаты показаны в Таблице 9.

Результаты показывают, что композиция таблетки F обеспечивала биодоступность 1,0%. Результаты показывают, что композиция таблетки В обеспечивала биодоступность 0,7%. Результаты показывают, что композиция таблетки С обеспечивала биодоступность 0,5%. Результаты показывают, что композиция таблетки Е обеспечивала биодоступность 0,4%. Результаты показывают, что композиция таблетки D обеспечивала биодоступность 0,3%.

Пример 8: растворение GLP-1 и SNAC из композиции таблетки G

Растворение Соединения А и SNAC из композиции таблетки G определяли с использованием описанного здесь анализа (I). Результаты показаны в Таблице 10. Результаты показывают, что SNAC высвобождается быстрее, чем Соединение А на протяжении исходных 20 мин растворения. Кроме того, они показывают, что различие между более быстрым высвобождением SNAC по сравнению с Соединением А является наибольшим в среде для растворения со значением pH 2,5. Наконец, данные показывают, что в средах для растворения со значением pH 2,5 количество растворенного SNAC достигает пика в пределах исходных 45 мин соответственно.

Пример 9: растворение GLP-1 и SNAC из композиции таблетки Н

Растворение Соединения А и SNAC из композиции таблетки Н определяли с использованием описанного здесь анализа (I). Результаты показаны в Таблице 11. Результаты показывают, что SNAC высвобождается быстрее, чем Соединение А на протяжении исходных 20 мин растворения. Кроме того, они показывают, что различие между более быстрым высвобождением SNAC по сравнению с Соединением А является наибольшим в среде для растворения со значением pH 2,5. Наконец, данные показывают, что в среде для растворения со значением pH 2,5 количество растворенного SNAC достигает пика в пределах исходных 30 мин.

Пример 10: биодоступность GLP-1 из композиций таблеток G-H у собак

Биодоступность GLP-1 из композиций таблеток G-H определяли у собак согласно описанному здесь анализу (II). Результаты показаны в Таблице 12.

Результаты показывают, что композиция таблетки G обеспечивала биодоступность 2,1%. Результаты показывают, что композиция таблетки Н обеспечивала биодоступность 2,5%.

В то время как здесь были проиллюстрированы и описаны определенные характеристики изобретения, обычным специалистам в данной области теперь будут очевидны многие модификации, замены, изменения и эквиваленты. Поэтому следует понимать, что приложенная формула изобретения предназначена для того, чтобы покрывать все такие модификации и изменения в том виде, в котором они попадают в пределы истинной сущности изобретения.

1. Фармацевтическая композиция для лечения диабета или ожирения, содержащая первый тип гранул и второй тип гранул, где указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и не содержит пептид GLP-1, и где указанный второй тип гранул содержит пептид GLP-1 и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

2. Фармацевтическая композиция по п. 1, где указанная композиция, кроме того, содержит один или более чем один фармацевтически приемлемый эксципиент.

3. Фармацевтическая композиция по п. 1, где указанный первый тип гранул, кроме того, содержит смазку.

4. Фармацевтическая композиция по п. 3, где указанная смазка представляет собой стеарат магния.

5. Фармацевтическая композиция по п. 1, в которой указанный первый тип гранул, кроме того, содержит наполнитель.

6. Фармацевтическая композиция по п. 1, в которой указанный второй тип гранул, кроме того, содержит наполнитель.

7. Фармацевтическая композиция по п. 5 или 6, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

8. Фармацевтическая композиция по п. 1, в которой указанный второй тип гранул, кроме того, содержит связующее вещество.

9. Фармацевтическая композиция по п. 8, где указанное связующее вещество представляет собой повидон.

10. Фармацевтическая композиция по п. 1, которая содержит по меньшей мере 60% (масс./масс.) агента для доставки, менее чем 10% (масс./масс.) связующего вещества, 5-40% (масс./масс.) наполнителя и менее чем 10% (масс./масс.) смазки.

11. Фармацевтическая композиция по п. 1, где высвобождение указанной соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты является одновременным или более быстрым, чем высвобождение указанного пептида GLP-1 при определении тестированием растворения с использованием анализа (I), и где указанное высвобождение возможно определяется в пределах 30 минут указанного тестирования растворения.

12. Фармацевтическая композиция по п. 1, где растворенное количество соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты достигает пика в пределах первых 60 минут, как, например, в пределах 55, 50, 45, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31 или 30 минут при определении тестированием растворения с использованием анализа (I) при pH 2,5.

13. Фармацевтическая композиция по п. 1, где указанное тестирование растворения с использованием анализа (I) проводится при любом pH 1,0-8,0, как, например, pH 1,0; 2,5 или 6,8.

14. Фармацевтическая композиция по п. 1, где указанный первый тип гранул и указанный второй тип гранул содержит по меньшей мере 50% (масс./масс.) указанной композиции.

15. Фармацевтическая композиция по п. 1, где соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

16. Фармацевтическая композиция по п. 1, где пептид GLP-1 содержит группировку, связывающуюся с альбумином.

17. Фармацевтическая композиция по п. 1, где пептид GLP-1 представляет собой N-эпсилон26-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбоксигептадеканоиламино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1(7-37) или N-эпсилон26-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбоксифенокси)деканоиламино]бутириламино}этокси)этокси] ацетиламино}этокси) этокси]ацетил}, N-эпсилон37-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбокси-фенокси)деканоиламино] бутириламино}этокси)этокси]ацетиламино}этокси)этокси]ацетил}-[Aib8,Arg34,Lys37]GLP-1(7-37)-OH.

18. Композиция по п. 1 в виде таблетки, где масса указанной таблетки находится в интервале от 150 мг до 1000 мг.

19. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом;

б) сухое гранулирование смеси со стадии а;

в) смешивание гранул, полученных на стадии б, с композицией, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты,

где смесь со стадии а не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты.

20. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем;

б) сухое гранулирование смеси со стадии а;

в) смешивание гранул, полученных на стадии б, с композицией, содержащей пептид GLP-1,

где смесь со стадии а не содержит пептид GLP-1.

21. Способ получения фармацевтической композиции, содержащей соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и пептид GLP-1, где данный способ включает следующие стадии:

а) смешивание пептида GLP-1 с наполнителем и/или связующим веществом;

б) сухое гранулирование смеси со стадии а;

в) смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты, возможно смазки и/или наполнителя;

г) сухое гранулирование смеси со стадии в;

д) смешивание гранул, полученных на стадии б, с гранулами, полученными на стадии г,

где смесь со стадии а не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, и где смесь со стадии в не содержит пептид GLP-1.

22. Способ по любому из пп. 19-21, который дополнительно содержит заключительную стадию добавления дополнительной смазки.

23. Способ по любому из пп. 19-21, в котором гранулы получают вальцеванием.

24. Способ по любому из пп. 19-21, где указанная стадия смешивания а) содержит смешивание соли N-(8-(2-гидроксибензоил)амино)каприловой кислоты со смазкой и/или наполнителем; перед сухим гранулированием и где указанное смешивание на стадии а) или с) имеет продолжительность по меньшей мере 20 минут.

25. Способ по п. 21, где указанное смешивание, включающее смешивание первого типа гранул, содержащих пептид GLP-1, со вторым типом гранул, содержащих соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, имеет продолжительность по меньшей мере 15 минут.

26. Способ по любому из пп. 19-21, где указанная соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты представляет собой SNAC.

27. Способ по любому из пп. 19-21, где указанный пептид GLP-1 представляет собой N-эпсилон26-[2-(2-{2-[2-(2-{2-[(S)-4-карбокси-4-(17-карбоксигептадеканоиламино)бутириламино]этокси}этокси)ацетиламино]этокси}этокси)ацетил][Aib8,Arg34]GLP-1(7-37) или N-эпсилон26-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбоксифенокси)деканоиламино]бутириламино}этокси)этокси] ацетиламино}этокси) этокси]ацетил}, N-эпсилон37-{2-[2-(2-{2-[2-(2-{(S)-4-карбокси-4-[10-(4-карбокси-фенокси)деканоиламино] бутириламино}этокси)этокси]ацетиламино}этокси)этокси]ацетил}-[Aib8,Arg34,Lys37]GLP-1(7-37)-OH.

28. Способ по любому из пп. 19-21, где указанная смазка представляет собой стеарат магния.

29. Способ по любому из пп. 19-21, где указанный наполнитель представляет собой микрокристаллическую целлюлозу.

30. Способ по любому из пп. 19-21, где указанное связующее вещество представляет собой повидон.

31. Фармацевтическая композиция по любому из пп. 1-19 для применения в медицине, где указанная композиция вводится перорально.

32. Фармацевтическая композиция по любому из пп. 1-19 для применения в лечении диабета или ожирения, где указанная композиция вводится перорально.

33. Фармацевтическая композиция по п. 32, где указанный диабет представляет собой диабет 2 типа.



 

Похожие патенты:

Изобретение относится к производному пиридина формулы (I), его пролекарству, где А представляет собой простую связь или атом кислорода; R1 представляет собой атом азота или CH; один из X1-Х5 представляет собой атом азота, и остальные четыре представляют собой CR2; R2 каждый независимо представляют собой атом водорода, алкильную группу, содержащую 1-6 атомов углерода, алкенильную группу, содержащую 2-6 атомов углерода, алкинильную группу, содержащую 2-6 атомов углерода, атом галогена, трифторметильную группу, дифторметильную группу, циано-группу, алкилкарбонильную группу, содержащую 2-7 атомов углерода, алкилсульфонильную группу, содержащую 1-6 атомов углерода, нитро-группу, амино-группу, диалкиламино-группу, содержащую 1-6 атомов углерода, которые опционально могут формировать цикл, формильную группу, гидроксильную группу, алкокси-группу, содержащую 1-6 атомов углерода (которая опционально может иметь один или больше заместителей, выбранных из гидроксильной группы, фенильной группы, циклогексильной группы и атома галогена), алкилтио-группу, содержащую 1-6 атомов углерода, фенильную группу (которая опционально может иметь один или больше заместителей, выбранных из алкильной группы, содержащей 1-6 атомов углерода, алкокси-группы, содержащей 1-6 атомов углерода, и атома галогена), или фенокси-группу (которая опционально может иметь один или больше заместителей, выбранных из алкильной группы, содержащей 1-6 атомов углерода, алкокси-группы, содержащей 1-6 атомов углерода, и атома галогена), при условии, что когда два CR2 расположены рядом, два заместителя R2 опционально могут объединяться с образованием цикла; R3 представляет собой атом водорода, алкильную группу, содержащую 1-6 атомов углерода (которая опционально может иметь один или больше заместителей, выбранных из гидроксильной группы, амино-группы, диалкиламино-группы, содержащей 1-6 атомов углерода, которые опционально могут формировать цикл, имидазольный цикл, пиразольный цикл, пирролидиновый цикл, пиперидиновый цикл, морфолиновый цикл и пиперазиновый цикл (который опционально может иметь один или больше заместителей, выбранных из алкильной группы, содержащей 1-6 атомов углерода, и алкилсульфонильной группы, содержащей 1-6 атомов углерода), алкенильную группу, содержащую 2-6 атомов углерода, алкинильную группу, содержащую 2-6 атомов углерода, алкокси-группу, содержащую 1-6 атомов углерода (которая опционально может иметь один или больше заместителей, выбранных из гидроксильной группы и атома галогена), алкилкарбонильную группу, содержащую 2-7 атомов углерода, алкилтио-группу, содержащую 1-6 атомов углерода, алкилсульфинильную группу, содержащую 1-6 атомов углерода, атом галогена, трифторметильную группу, дифторметильную группу, циано-группу, фенильную группу (которая опционально может иметь один или больше заместителей, выбранных из алкильной группы, содержащей 1-6 атомов углерода, алкокси-группы, содержащей 1-6 атомов углерода, и атома галогена), пиридильную группу (которая опционально может иметь один или больше заместителей, выбранных из алкильной группы, содержащей 1-6 атомов углерода, алкокси-группы, содержащей 1-6 атомов углерода, и атома галогена), фенокси-группу (которая опционально может иметь один или больше заместителей, выбранных из алкильной группы, содержащей 1-6 атомов углерода, алкокси-группы, содержащей 1-6 атомов углерода, и атома галогена), карбоксильную группу, или -CO2R5; R4 представляет собой карбоксильную группу, тетразолильную группу, -CONHSO2R5, -CO2R5 или любой из представленных далее заместителей: при условии, что когда R3 представляет собой алкильную группу, содержащую 1-6 атомов углерода, замещенную гидроксильной группой, и когда R4 представляет собой карбоксильную группу, то R3 и R4 опционально могут быть соединены с образованием лактонового цикла; R5 в R3 и R4 каждый независимо представляют собой алкильную группу, содержащую 1-6 атомов углерода; Z представляет собой любой из следующих заместителей, обозначенных Z1-Z7 (их значения представлены в п.1 формулы), которые могут применяться для лечения или профилактики заболеваний, связанных с URAT1, таких как подагра, гиперурикемия, гипертензия, заболевания почек, такие как интерстициальный нефрит, диабет, артериосклероз и синдром Леша-Найхана.

Настоящее изобретение относится к энантиомеру [-] формулы: [-]NaOOC-HOCH-(CH2)6-(CH=CH-CH2)1-(CH2)6-CH3, а также к фармацевтической композиции для лечения патологии, вызванной аномально низким уровнем сфингомиелина, и/или аномально низким уровнем глиофибриллярного кислого белка (ГФКБ), и/или аномально высоким уровнем дигидрофолатредуктазы (ДГФР), содержащей терапевтически эффективное количество энантиомера следующей формулы: [-]HOOC-HOCH-(CH2)6-(CH=CH-CH2)1-(CH2)6-CH3 и/или по меньшей мере одной из его фармацевтически приемлемых солей и, необязательно, фармацевтически приемлемый носитель.

Изобретение относится к соединению формулы I: где группа А независимо представляет собой моноциклический или бициклический арил или гетероарил, возможно замещенный одной или более А'; каждая группа А' независимо представляет собой C1-6 алкил, галоген, циано или гетероарил; группа R1 представляет собой тетрагидропиранил, замещенный аминогруппой; или его фармацевтически приемлемым солям, которые представляют собой ингибиторы SYK и используются при лечении аутоиммунных и воспалительных заболеваний.

Группа изобретений относится к медицине, в частности к применению активного компонента для получения лекарственного средства для регуляции уровня содержания глюкозы в крови, при этом активный компонент выбирают из соединения формулы (1): или его фармацевтически приемлемой соли, а так же к лечению сахарного диабета I типа, где активный компонент выбирают из соединения (2): или его фармацевтически приемлемой соли.

Настоящее изобретение относится к биохимии и медицине, в частности к средству для стимуляции дифференцировки панкреатических предшественников бета-клеток в продуцирующие и секретирующие инсулин бета-клетки при инсулинзависимом сахарном диабете.

Изобретение относится к области органической химии, а именно к гетероциклическому соединению формулы (I) или к его фармацевтически приемлемой соли, где группа, представленная формулой: является группой, представленной формулой: ; R1, в каждом случае независимо, представляет собой галоген, незамещенный алкил, замещенный алкенил, замещенный алкинил, замещенный или незамещенный арил, замещенный или незамещенный гетероарил, замещенный или незамещенный циклоалкенил, замещенный или незамещенный гетероциклил, или замещенный амино; где указанные значения радикала раскрыты в формуле изобретения; m равно целому числу от 2 или 3; R2 представляет собой водород; X представляет собой -О-; и Y представляет собой замещенный или незамещенный арил, или замещенный или незамещенный гетероарил; где указанные значения радикала раскрыты в формуле изобретения.

Изобретение относится к соединениям, представленным общей формулой I, или их фармацевтически приемлемым солям, которые могут найти применение при лечении заболеваний, связанных с дипептидилпептидазой IV.

Изобретение относится к новым соединениям формулы I-R или I-S, его фармацевтически приемлемому изомеру, энантиомеру, рацемату или фармацевтически приемлемой соли. Соединения обладают активностью в отношении глюкагонподобного пептида 1 (GLP-1R) и могут найти применение для лечения заболеваний, для которых показано модулирование или потенцирование GLP-1R, в частности для лечения диабета.

Изобретение относится к фармацевтической промышленности, а именно к ректальным суппозиториям антидиабетического действия. В одном суппозитории содержится, г: густой экстракт листьев гимнемы лесной - 0,45; густой экстракт корня солодки голой - 0,25; полиэтиленгликоль 6000 - 2,0; кремофор RH-40 - 0,30; метилпарабен - 0,003; пропилпарабен - 0,0005.

Изобретение относится к соединению формулы (III) или его фармацевтически приемлемой соли, где W представляет собой S; Y представляет собой N; X представляет собой N; R1 выбран из (а) C1-С6 алкила, необязательно содержащего в качестве заместителя амино, метиламино, диметиламино, C1-С6 алкокси или изоиндолил; (b) -NR8R7, -CH2NR7R8, где R7 и R8 соединены с образованием необязательно замещенного С3-С7 неароматического кольца, которое представляет собой пирролидин, морфолин, пиперазин, пиперидин, 1,4-диазепан, азепан, азетидин, 2-азабицикло[2.2.1]гептан, или 2,5-диазабицикло[2.2.1]гептан, и необязательно замещен одним или более C1-С6 алкилами, C1-С6 алкокси, метоксиэтилом, 1-метоксипропаном, изопропилоксиметилом, изопропилоксиэтилом, -С(O(СН2)-O-метилом, -С(O)(СН2)-O-изопропилом, C1-С6 галогеналкилом, -S(O)2-метилом, -S(O)2-изопропилом, оксо, -С(O)(С1-С2)алкил-N(метил)2, -С(O)(С2)алкил-(пирролидином), трет-бутил-С(О)- или фенилом; или (c) -O-(тетрагидро-2Н-пирана); каждый из R2, R3 и R5 представляют собой водород; R4 выбран из С3-С6 циклоалкила, C1-С6 алкила, С2-С6 алкенила, С2-С6 алкинила и необязательно замещенного гетероарила, выбранного из пиридина, пиразола, пиридазина, пиримидина, причем указанный гетероарил необязательно замещен 1-2 заместителями, выбранными из C1-С6 алкила и CN.

Изобретение относится к области нанотехнологии, пищевой промышленности. Описан способ получения нанокапсул сухого экстракта топинамбура в оболочке из пектина.

Изобретение относится в области нанотехнологии, пищевой промышленности и ветеринарной медицины. Описан способ получения нанокапсул бетулина в оболочке из ксантановой камеди.

Изобретение относится к cпособe получения супрамолекулярных гидрогелей, включающему смешение водного раствора L-цистеина с водным раствором ацетата серебра так, чтобы концентрация L-цистеина в смеси составляла от 1,0 до 6,0 мМ, а отношение молярных концентраций ацетата серебра к L-цистеину в смеси находилось в диапазоне от 1,23 до 1,33, где далее смесь оставляют в защищенном от света месте при комнатной температуре на 4 часа для формирования L-цистеин-серебряного раствора, затем смешивают созревший L-цистеин-серебряный раствор с водным раствором сульфата с катионом из ряда Na+, K+, Cu2+, Fe2+, Mg2+, Zn2+, Al3+, Ni2+, Co2+, Mn2+, при концентрации сульфата в смеси в пределах 0,075-0,750 ммоль, через определенное время, зависящее от концентрации сульфата и типа катиона, после чего жидкая система превращается в гель.

Группа изобретений относится к области фармацевтики, а именно к пероральной пленкообразующей основе, включающей пищевой полимер, растворимый и в воде, и в органическом растворителе, имеющем параметр растворимости, равный от 9,7 до 20 (кал/см3)1/2, пенообразующее средство, выбранное из гидрокарбонатов натрия, или аммония, или карбонатов натрия, магния, аммония, калия или кальция, и вспомогательное пенообразующее средство, вспенивающееся в присутствии воды и выбранное из L-аскорбиновой кислоты, L-битартрата калия, дигидропирофосфата кальция, дигидропирофосфата динатрия, галактуроновой кислоты, глюкуроновой кислоты, фумарата мононатрия, сульфата алюминия-калия, DL-малата натрия, дигидрофосфата натрия, гидрофосфата дикалия, дигидрофосфата натрия и гидрофосфата динатрия, причем и пенообразующее средство, и вспомогательное пенообразующее средство нерастворимо в указанном органическом растворителе и включено в виде частиц со средним размером от 0,1 до 60 мкм, а также к препарату, включающему лекарственное средство в указанной основе, и к способам их получения.

Изобретение относится к биотехнологии, ветеринарии, медицине и представляет собой способ получения полиэлектролитных микрокапсул с пептидами из эмбриональных тканей птиц, характеризующийся тем, что готовят и первоначально смешивают в соотношении 1:5:1 растворы поликатиона каррагинана с концетрацией 8,0-12,0 мг/мл в буферном растворе с рН 4.7-4.8, пептидов с концетрацией 3,5-4,5 мг/мл и полианиона хитозана с концетрацией 8,0-12,0 мг/мл в буферном растворе с рН 4.7-4.8 с последующим поочередным добавлением растворов полиэлектролитов в соотношении 1:1 до достижения прочного полиэлектролитного комплекса, который перемешивают 30 минут, центрифугируют при 400-500 об/мин 10-15 мин с последующим удалением супернатанта, промывают осадок 0,5 М раствором хлорида натрия и хранят полученные микрокапсулы в виде суспензии или в лиофильно высушенном состоянии при плюс 2-4°C.

Группа изобретений относится к медицине. Описаны биоразлагаемые устройства, такие как имплантаты для контролируемой доставки терапевтических агентов, в частности больших молекул, таких как белки и антитела.
Изобретение относится к области косметологии и дерматологии и представляет собой способ получения композиции для использования в качестве дерматологического наполнителя в косметических и медицинских применениях в форме геля, включающей сшитый первый полимер, необязательно второй полимер, который может быть сшитым или несшитым, и воду, причем первый и второй полимеры выбирают из полисахарида, а способ включает по меньшей мере стадии (i), (ii) и (iv) и необязательно стадию (iii), где стадия (i) заключается в сшивание смеси, включающей в себя первый полимер и воду, стадия (ii) в завершение сшивания после сшивания на стадии (i), стадия (iii) необязательное смешивание продукта, полученного на стадии (ii), со вторым полимером, стадия (iv) заключается в диализе продукта, полученного на стадии (ii) или на стадии (iii), где стадия диализа (iv) включает стадии (iv.1)-(iv.3)(iv.1) экструдирование продукта, полученного на стадии (ii) или (iii), через первое сито и последующее экструдирование экструдированного через первое сито продукта через второе сито, в котором размер отверстий второго сита меньше, чем размер отверстий первого сита; или экструдирование продукта, полученного на стадии (ii) или (iii), через первое сито и последующее экструдирование экструдированного через первое сито продукта через второе сито, и последующее экструдирование экструдированного через второе сито продукта через третье сито, в котором размер отверстий второго сита меньше, чем размер отверстий первого сита, а размер отверстий третьего сита меньше, чем размер отверстий второго сита, где стадия (iv.2) представляет собой заполнение мембраны диализа продуктом, полученным на стадии (iv.1), стадия (iv.3) - обработку заполненной мембраны, полученной на стадии (iv.2), раствором для диализа.

Изобретение относится к области офтальмологии и представляет собой офтальмологическую композицию, предназначенную для введения в силиконовую гидрогелевую контактную линзу, для лечения, предотвращения или смягчения синдрома сухого глаза, где композиция содержит сложный эфир противовоспалительного липоидного медиатора в количестве от приблизительно 0,01% до 5,0% по весу в расчете на общую массу композиции, где противовоспалительный липоидный медиатор представляет собой этиловый эфир альфа-линолевой кислоты и пропиленгликоль, где противовоспалительный липоидный медиатор присутствует в форме сложного эфира.

Изобретение относится к фармацевтической промышленности и представляет собой ранозаживляющую композицию для местного применения, по существу состоящая из: тетрадекагидрата сульфата алюминия, присутствующего в количестве от приблизительно 40,0 мас.

Изобретение относится в области нанотехнологии, пищевой промышленности и сельского хозяйства. Способ получения нанокапсул бетулина характеризуется тем, что в качестве оболочки нанокапсул используют яблочный или цитрусовый пектин, а в качестве ядра – бетулин.

Группа изобретений относится к фармацевтической промышленности, а именно к мгновенно флотирующей гастроретентивной готовой форме, представленной в виде таблетки, мини-таблетки, гранулы, капсулы или пеллеты и содержащей фармацевтически активный ингредиент, рецептурную добавку и функционализированный натуральный и/или синтетический карбонат кальция, который имеет БЭТ специфическую площадь поверхности 5-200 м2/г и является продуктом реакции натурального или синтетического карбоната кальция с фармацевтически приемлемой кислотой и диоксидом углерода, образующимся посредством кислотной обработки и/или подающимся из внешнего источника, где источник натурального карбоната кальция выбирается из мрамора, кальцита, мела, известняка, доломита и/или их смесей, а синтетическим карбонатом кальция является осажденный карбонат кальция, содержащий арагонитовую, ватеритовую или кальцитовую минералогические кристаллические формы; а также к способу ее изготовления и к применению функционализированного натурального и/или синтетического карбоната кальция для ее получения.

Группа изобретений относится к области фармацевтики и медицины и касается фармацевтической композиции для лечения диабета или ожирения, содержащей первый тип гранул и второй тип гранул, в которых указанный первый тип гранул содержит соль N-амино)каприловой кислоты и не содержит пептид GLP-1, и в которых указанный второй тип гранул содержит пептид GLP-1 и не содержит соль N-амино)каприловой кислоты, а также относится к способам получения композиции и к их применению в медицине. Группа изобретений обеспечивает улучшение биодоступности пептида GLP-1. 4 н. и 29 з.п. ф-лы, 10 пр., 12 табл.

Наверх