Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии



Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
Анализы определения антител, специфичных к терапевтическим антителам против ige, и их применение при анафилаксии
G01N2800/24 - Исследование или анализ материалов путем определения их химических или физических свойств (разделение материалов вообще B01D,B01J,B03,B07; аппараты, полностью охватываемые каким-либо подклассом, см. в соответствующем подклассе, например B01L; измерение или испытание с помощью ферментов или микроорганизмов C12M,C12Q; исследование грунта основания на стройплощадке E02D 1/00;мониторинговые или диагностические устройства для оборудования для обработки выхлопных газов F01N 11/00; определение изменений влажности при компенсационных измерениях других переменных величин или для коррекции показаний приборов при изменении влажности, см. G01D или соответствующий подкласс, относящийся к измеряемой величине; испытание

Владельцы патента RU 2642295:

ДЖЕНЕНТЕК, ИНК. (US)

Изобретение относится к биохимии. Предложены способы обнаружения человеческого антитела изотипа IgE против омализумаба. Также рассмотрены наборы, способы идентификации пациента, имеющего риск анафилактической реакции на омализумаб, и способ лечения пациента, имеющего IgE-опосредованное нарушение. Данное изобретение позволяет своевременно обнаруживать аллергические реакции на омализумаб и может найти применение в терапии и предупреждении развития анафилаксии. 9 н. и 43 з.п. ф-лы, 27 ил., 7 табл., 7 пр.

 

ПЕРЕКРЕСТНАЯ ССЫЛКА НА РОДСТВЕННЫЕ ЗАЯВКИ

По данной заявке испрашивается приоритет по предварительной заявке США № 61/255052, поданной 26 октября 2009 года, включенной в настоящий документ в полном объеме путем ссылки.

ОБЛАСТЬ ТЕХНИКИ

Настоящее изобретение, главным образом, относится к области способов и реагентов для определения антител изотипа IgE против лекарственного средства к терапевтическим антителам против IgE, и способов оценки риска анафилаксии.

УРОВЕНЬ ТЕХНИКИ

IgE является членом семейства иммуноглобулинов, опосредующим аллергические ответы, такие как астма, пищевые аллергии, гиперчувствительность 1 типа и хорошо известный синусит, возникающие под влиянием множества факторов. B-клетки, или B-лимфоциты, секретируют и экспрессируют IgE на своей поверхности. IgE связывается с B-клетками (а также моноцитами, эозинофилами и тромбоцитами) через их Fc-область с низкоаффинным рецептором IgE, известным как FcεRII. После воздействия аллергена на млекопитающее, B-клетки, несущие поверхностное антитело IgE, специфичное к антигену, "активируются" и развиваются в IgE-секретирующие плазматические клетки. Затем получаемые специфичные к аллергену IgE циркулируют в кровотоке и связываются с поверхностью тучных клеток в тканях и базофилов в крови посредством высокоаффинного рецептора, также известного как FcεRI. Таким образом, тучные клетки и базофилы покрываются к аллергену. Последующее воздействие аллергена вызывает перекрестное сшивание FcεRI базофила и тучной клетки, приводящее к дегрануляции данных клеток и высвобождению гистамина, лейкотриенов и факторов активации тромбоцитов, хемотактических факторов эозинофилов и нейтрофилов и цитокинов IL-3, IL-4, IL-5 и GM-CSF, ответственных за клиническую гиперчувствительность и анафилаксию.

Антагонисты, блокирующие образование IgE-рецепторного комплекса, применимы в качестве терапевтических средств для предотвращения аллергического ответа. Разработано несколько терапевтических средств антител против IgE. Данные антитела против IgE блокируют связывание IgE с высокоаффинным рецептором FcεRI, обнаруженном на базофилах и тучных клетках, и, таким образом, предотвращают высвобождение гистамина и других анафилактических факторов, приводящее к патологическому состоянию.

Сообщают, что анафилаксия возникает у пациентов после получения антител против IgE, таких как омализумаб (например, Xolair®). Анафилаксия является острой системной (мультисистемной) и очень тяжелой аллергической реакцией гиперчувствительности 1 типа. Она вызвана дегрануляцией тучных клеток и базофилов и опосредована IgE. В течение 2006 года у 124 из 57269 (приблизительно 0,2%) пациентов с астмой возникала анафилаксия после введения омализумаба. В то время как не сообщали о смертельных случаях анафилаксии в результате введения омализумаба, некоторые случаи являлись тяжелыми и потенциально опасными для жизни. По этой причине FDA рекомендует наблюдать пациентов, получающих омализумаб, в кабинете врача в течение периода времени после введения омализумаба, и медицинские работники, вводящие омализумаб, должны быть готовы к оказанию помощи при анафилаксии, которая может являться опасной для жизни. Шестьдесят процентов приведенных случаев (124) имели место после первых двух доз омализумаба. Таким образом, возможно, что реакцию у пациентов вызывают уже существующие антитела, распознающие эпитоп на омализумабе, в отличие от реакции против лекарственного средства, развивающейся после введения лекарственного средства. Т.к. анафилаксия связана с антителом изотипа IgE, существует необходимость разработки анализа для определения и количественного определения у пациента IgE, специфичного к терапевтическому антителу против IgE, для оценки риска анафилаксии, предпочтительно, до лечения таким антителом против IgE и идентификации пациентов с высоким риском.

Все цитируемые в данном документе ссылки, включая патентные заявки и публикации, в полном объеме включены путем ссылки.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

В одном из аспектов изобретение относится к способам определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, включающим этапы: a) приведения образца, который может содержать антитело против лекарственного средства, в контакт с мутантным терапевтическим антителом, содержащим по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE (такого как IgE человека) составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE; и b) определения связывания антитела против лекарственного средства с мутантным терапевтическим антителом.

В некоторых вариантах осуществления относительная аффинность связывания мутантного терапевтического антитела составляет приблизительно 7,5% или менее, приблизительно 5% или менее, приблизительно 2,5% или менее, приблизительно 2,0% или менее, приблизительно 1,5% или менее, приблизительно 1% или менее, приблизительно 0,9% или менее, приблизительно 0,8% или менее, приблизительно 0,7% или менее, приблизительно 0,5% или менее, приблизительно 0,25% или менее, приблизительно 0,1% или менее от относительной аффинности связывания терапевтического антитела против IgE.

В другом аспекте изобретение относится к способам определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце, включающим этапы: a) приведения образца, который может содержать антитела против лекарственного средства, в контакт с мутантным терапевтическим антителом, обладающим по меньшей мере одной мутацией аминокислоты терапевтического антитела против IgE, где активность мутантного терапевтического антитела по отношению к IgE (такого как IgE человека) составляет приблизительно 10% или менее от активности терапевтического антитела против IgE по отношению к IgE; и b) определения связывания антител против лекарственного средства с мутантным терапевтическим антителом.

В некоторых вариантах осуществления активность мутантного терапевтического антитела составляет приблизительно 7,5% или менее, приблизительно 5% или менее, приблизительно 2,5% или менее, приблизительно 2,0% или менее, приблизительно 1,5% или менее, приблизительно 1% или менее, приблизительно 0,9% или менее, приблизительно 0,8% или менее, приблизительно 0,7% или менее, приблизительно 0,5% или менее, приблизительно 0,25% или менее, приблизительно 0,1% или менее от активности терапевтического антитела против IgE.

Можно применять любые мутантные терапевтические антитела, предоставляемые в настоящем документе. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит одну, две, три, четыре, пять или шесть мутаций аминокислот в последовательностях CDR тяжелой и/или легкой цепи терапевтического антитела против IgE. В некоторых вариантах осуществления терапевтическое антитело против IgE является омализумабом, и мутантное терапевтическое антитело содержит одну, две или три мутации аминокислот в первой CDR легкой цепи омализумаба. В некоторых вариантах осуществления терапевтическое антитело против IgE является омализумабом, и мутантное терапевтическое антитело содержит замену аминокислоты в положении 34 (Asp) легкой цепи (SEQ ID NO:1) омализумаба. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит аминокислотную последовательность тяжелой цепи SEQ ID NO:2 и аминокислотную последовательность легкой цепи SEQ ID NO:1, где заменяют аминокислоты в положениях 30 (Asp) и 34 (Asp) или положениях 32 (Asp) и 34 (Asp) легкой цепи. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит аминокислотную последовательность тяжелой цепи SEQ ID NO:2 и аминокислотную последовательность легкой цепи SEQ ID NO:1, где в легкой цепи заменяют аминокислоту D (Asp) в положениях 30, 32 и 34. В некоторых вариантах осуществления аминокислоту Asp заменяют на Ala. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит аминокислотную последовательность тяжелой цепи SEQ ID NO:2 и аминокислотную последовательность легкой цепи SEQ ID NO:1 с заменами аминокислот Asp на Ala в положениях 30, 32 и 34 легкой цепи. В некоторых вариантах осуществления терапевтическое антитело против IgE является омализумабом, и мутантное терапевтическое антитело содержит одну, две или три мутации аминокислот в третьей CDR тяжелой цепи омализумаба. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит аминокислотную последовательность тяжелой цепи SEQ ID NO:2 и аминокислотную последовательность легкой цепи SEQ ID NO:1, где заменяют аминокислоты в положениях 101 (His), 105 (His) и 107 (His) тяжелой цепи (SEQ ID NO:2). В некоторых вариантах осуществления аминокислоту His заменяют на Ala. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит аминокислотную последовательность тяжелой цепи SEQ ID NO:2 с заменами аминокислот His на Ala в положениях 101, 105 и 107 тяжелой цепи и аминокислотную последовательность легкой цепи SEQ ID NO:1.

В некоторых вариантах осуществления мутантное терапевтическое антитело иммобилизируют или фиксируют на поверхности. В некоторых вариантах осуществления мутантное терапевтическое антитело напрямую иммобилизируют на поверхности. В некоторых вариантах осуществления мутантное терапевтическое антитело конъюгируют с меткой и иммобилизируют или фиксируют на поверхности средством фиксации, специфически связывающимся с меткой, где средство фиксации иммобилизируют на поверхности. В некоторых вариантах осуществления метка является биотином, и средство фиксации является стрептавидином. В некоторых вариантах осуществления метка является дигоксигенином, и средство фиксации является антителом против дигоксигенина.

В некоторых вариантах осуществления образец приводят в контакт с мутантным терапевтическим антителом, которое иммобилизируют или фиксируют на поверхности. В некоторых вариантах осуществления образец приводят в контакт с мутантным терапевтическим антителом до фиксации мутантного терапевтического антитела на поверхности. В некоторых вариантах осуществления мутантное терапевтическое антитело фиксируют на поверхности после приведения образца в контакт с мутантным терапевтическим антителом и до определения связывания антитела против лекарственного средства с мутантным терапевтическим антителом.

В некоторых вариантах осуществления связывание антитела против лекарственного средства с мутантным терапевтическим антителом определяют средством детекции. В некоторых вариантах осуществления средство детекции является полипептидом FcεRIα, связывающимся с Fc-областью IgE. Можно применять любые полипептиды FcεRIα, предоставляемые в настоящем документе. В некоторых вариантах осуществления полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα. В некоторых вариантах осуществления полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα, слитый с константной областью IgG. В некоторых вариантах осуществления метят полипептид FcεRIα. В некоторых вариантах осуществления метка выбрана из группы, состоящей из биотина, дигоксигенина, рутения, радиоактивной метки, фотолюминесцентной метки, хемилюминесцентной метки, флуоресцентной метки, электрохемилюминесцентной метки и ферментной метки. В некоторых вариантах осуществления полипептид FcεRIα метят биотином, и связывание антитела против лекарственного средства с мутантным терапевтическим антителом определяют посредством стрептавидина-HRP. В некоторых вариантах осуществления полипептид FcεRIα метят дигоксигенином, и связывание антитела против лекарственного средства с мутантным терапевтическим антителом определяют посредством конъюгированного с HRP антитела против дигоксигенина. В некоторых вариантах осуществления полипептид FcεRIα метят рутением, и связывание антитела против лекарственного средства с мутантным терапевтическим антителом определяют анализом электрохемилюминесценции.

В некоторых вариантах осуществления образец содержит сыворотку или плазму человека. В некоторых вариантах осуществления образец содержит терапевтическое антитело против IgE. В некоторых вариантах осуществления образец не содержит терапевтическое антитело против IgE. В некоторых вариантах осуществления сыворотка или плазма содержит омализумаб. В других вариантах осуществления сыворотка или плазма не содержит омализумаб.

В некоторых вариантах осуществления способы дополнительно включают этап сравнения связывания антител против лекарственного средства с мутантным терапевтическим антителом с референсным значением. В некоторых вариантах осуществления референсное значение представляет собой определяемое связывание между мутантным терапевтическим антителом и контрольным антителом. В некоторых вариантах осуществления контрольное антитело является антителом положительного контроля, связывающимся и с терапевтическим антителом против IgE, и с мутантным терапевтическим антителом со схожей аффинностью. В некоторых вариантах осуществления антитело положительного контроля содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:7, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:8. В некоторых вариантах осуществления антитело положительного контроля дополнительно содержит константные области тяжелой цепи и легкой цепи IgE человека.

В другом аспекте изобретение также относится к наборам для определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, содержащим (a) мутантное терапевтическое антитело, содержащее по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE (такого как IgE человека) составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE; и b) средство детекции, связывающееся с Fc-областью IgE. Можно применять любые мутантные терапевтические антитела, предоставляемые в настоящем документе. В некоторых вариантах осуществления средство детекции является полипептидом FcεRIα. В набор можно включать любые полипептиды FcεRIα, предоставляемые в настоящем документе. В некоторых вариантах осуществления полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα. В некоторых вариантах осуществления полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα, слитый с константной областью IgG. В некоторых вариантах осуществления метят полипептид FcεRIα (например, метят биотином, дигоксигенином, рутением и т.д.). В некоторых вариантах осуществления набор дополнительно содержит стрептавидин-HRP или Amdex SA-HRP. В некоторых вариантах осуществления набор дополнительно содержит конъюгированное с HRP антитело против дигоксигенина для определения меченного дигоксигенином полипептида FcεRIα. В некоторых вариантах осуществления набор дополнительно содержит антитело положительного контроля, связывающееся и с терапевтическим антителом против IgE, и с мутантным терапевтическим антителом со схожей аффинностью. В некоторых вариантах осуществления антитело положительного контроля содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:7, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:8. В некоторых вариантах осуществления антитело положительного контроля дополнительно содержит константные области тяжелой цепи и легкой цепи IgE человека.

В другом аспекте изобретение также относится к наборам для определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, содержащим a) мутантное терапевтическое антитело, обладающее по меньшей мере одной мутацией аминокислоты терапевтического антитела против IgE, где активность мутантного терапевтического антитела по отношению к IgE (такого как IgE человека) составляет приблизительно 10% или менее от активности терапевтического антитела против IgE по отношению к IgE; и b) средство детекции, связывающееся с Fc-областью IgE. Можно применять любые мутантные терапевтические антитела, предоставляемые в настоящем документе. В некоторых вариантах осуществления средство детекции является полипептидом FcεRIα. В набор можно включать любые полипептиды FcεRIα, предоставляемые в настоящем документе. В некоторых вариантах осуществления полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα. В некоторых вариантах осуществления полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα, слитый с константной областью IgG. В некоторых вариантах осуществления метят полипептид FcεRIα (например, метят биотином, дигоксигенином, рутением и т.д.). В некоторых вариантах осуществления набор дополнительно содержит стрептавидин-HRP или Amdex SA-HRP. В некоторых вариантах осуществления набор дополнительно содержит конъюгированное с HRP антитело против дигоксигенина для определения меченного дигоксигенином полипептида FcεRIα. В некоторых вариантах осуществления набор дополнительно содержит антитело положительного контроля, связывающееся и с терапевтическим антителом против IgE, и с мутантным терапевтическим антителом со схожей аффинностью. В некоторых вариантах осуществления антитело положительного контроля содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:7, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:8. В некоторых вариантах осуществления антитело положительного контроля дополнительно содержит константные области тяжелой цепи и легкой цепи IgE человека.

В другом аспекте изобретение также относится к способам определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, включающим этапы: (a) приведения образца, который может содержать антитело против лекарственного средства, в контакт с (i) мутантным терапевтическим антителом и (ii) полипептидом FcεRIα, связывающимся с Fc-областью IgE человека, где мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека; (b) фиксацию мутантного терапевтического антитела на поверхности; и (c) определение связывания антитела против лекарственного средства с мутантным терапевтическим антителом.

В некоторых вариантах осуществления избыточное количество полипептида FcεRIα приводят в контакт с образцом на этапе (a). В некоторых вариантах осуществления по меньшей мере приблизительно 2-кратный, по меньшей мере приблизительно 3-кратный, по меньшей мере приблизительно 4-кратный, по меньшей мере приблизительно 5-кратный, по меньшей мере приблизительно 6-кратный, по меньшей мере приблизительно 7-кратный, по меньшей мере приблизительно 8-кратный, по меньшей мере приблизительно 9-кратный или по меньшей мере приблизительно 10-кратный избыток полипептида FcεRIα приводят в контакт с образцом на этапе (a). Можно применять любые полипептиды FcεRIα, предоставляемые в настоящем документе. В некоторых вариантах осуществления полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα. Полипептид FcεRIα можно метить или не метить.

Можно применять любые мутантные терапевтические антитела, предоставляемые в настоящем документе. В некоторых вариантах осуществления мутантное терапевтическое антитело метят и фиксируют на поверхности средством фиксации, специфически связывающимся с меткой. В некоторых вариантах осуществления метка является биотином, и поверхность покрывают стрептавидином. В некоторых вариантах осуществления связывание антитела против лекарственного средства с мутантным терапевтическим антителом определяют посредством меченого антитела против IgE человека. В некоторых вариантах осуществления метят полипептид FcεRIα и определяют связывание антитела против лекарственного средства с мутантным терапевтическим антителом средством детекции, специфически связывающимся с меткой на полипептиде FcεRIα. В некоторых вариантах осуществления полипептид FcεRIα метят дигоксигенином, и связывание антитела против лекарственного средства с мутантным терапевтическим антителом определяют конъюгированным с HRP антителом против дигоксигенина. В некоторых вариантах осуществления полипептид FcεRIα метят рутением, и связывание антитела против лекарственного средства с мутантным терапевтическим антителом определяют анализом электрохемилюминесценции.

В другом аспекте изобретение также относится к наборам для определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, содержащим: (a) мутантное терапевтическое антитело, содержащее по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE человека; и (b) полипептид FcεRIα, связывающийся с Fc-областью IgE человека. Можно применять любые мутантные терапевтические антитела, предоставляемые в настоящем документе. Можно применять любой полипептид FcεRIα, описываемый в настоящем документе. В некоторых вариантах осуществления в наборе предоставляют избыточное количество полипептида FcεRIα. В некоторых вариантах осуществления метят полипептид FcεRIα. В некоторых вариантах осуществления набор дополнительно содержит средство детекции, специфически связывающееся с меткой на полипептиде FcεRIα. В некоторых вариантах осуществления набор дополнительно содержит антитело против IgE человека. В некоторых вариантах осуществления метят антитело против IgE человека.

В другом аспекте изобретение также относится к способам определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, включающим этапы: (a) преинкубации образца, который может содержать антитело против лекарственного средства, с избыточным количеством полипептида FcεRIα, связывающегося с Fc-областью IgE человека; (b) инкубации преинкубированного на этапе (a) образца с терапевтическим антителом против IgE или мутантным терапевтическим антителом, содержащим по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека снижена по сравнению с относительной аффинностью связывания терапевтического антитела против IgE с указанным IgE человека; и (c) определения связывания антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным терапевтическим антителом.

Можно применять любые мутантные терапевтические антитела, предоставляемые в настоящем документе. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека.

В некоторых вариантах осуществления по меньшей мере приблизительно 2-кратный, по меньшей мере приблизительно 3-кратный, по меньшей мере приблизительно 4-кратный, по меньшей мере приблизительно 5-кратный, по меньшей мере приблизительно 6-кратный, по меньшей мере приблизительно 7-кратный, по меньшей мере приблизительно 8-кратный, по меньшей мере приблизительно 9-кратный или по меньшей мере приблизительно 10-кратный избыток полипептида FcεRIα преинкубируют с образцом на этапе (a). Можно применять любые полипептиды FcεRIα, предоставляемые в настоящем документе.

В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное терапевтическое антитело фиксируют на поверхности до или после инкубации с образцом на этапе (b). В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное терапевтическое антитело напрямую иммобилизируют на поверхности до инкубации с образцом на этапе (b).

В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное терапевтическое антитело метят и фиксируют на поверхности иммобилизированным средством фиксации, специфически связывающимся с меткой. В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное терапевтическое антитело метят биотином и фиксируют на покрытой стрептавидином поверхности.

В некоторых вариантах осуществления связывание антитела против лекарственного средства с терапевтическим антителом или мутантным терапевтическим антителом определяют посредством конъюгированного с HRP антитела против IgE человека. В некоторых вариантах осуществления метят полипептид FcεRIα и определяют связывание антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным терапевтическим антителом посредством определения метки. В некоторых вариантах осуществления полипептид FcεRIα метят дигоксигенином и определяют связывание антитела против лекарственного средства с терапевтическим антителом или мутантным терапевтическим антителом посредством конъюгированного с HRP антитела против дигоксигенина. В некоторых вариантах осуществления полипептид FcεRIα метят рутением и определяют связывание антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным терапевтическим антителом анализом электрохемилюминесценции.

В другом аспекте изобретение также относится к наборам для определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, содержащим: (a) терапевтическое антитело против IgE или его мутантное терапевтическое антитело, где мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE человека снижена по сравнению с относительной аффинностью связывания терапевтического антитела против IgE с IgE человека; и (b) полипептид FcεRIα, связывающийся с Fc-областью IgE человека. Можно применять любые мутантные терапевтические антитела, предоставляемые в настоящем документе. В некоторых вариантах осуществления набор дополнительно содержит антитело против IgE человека. В некоторых вариантах осуществления метят антитело против IgE человека. Можно применять любой полипептид FcεRIα, предоставляемый в настоящем документе. В некоторых вариантах осуществления метят полипептид FcεRIα. В некоторых вариантах осуществления набор дополнительно содержит средство детекции, специфически связывающееся с меткой на полипептиде FcεRIα.

В другом аспекте изобретение относится к способам идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, включающим этапы: (a) приведения образца от пациента в контакт с мутантным терапевтическим антителом, содержащим по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека; и (b) определения связывания антитела изотипа IgE против лекарственного средства с мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение относится к способам идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, включающим этапы: (a) приведения образца от пациента в контакт с мутантным терапевтическим антителом, содержащим по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где активность мутантного терапевтического антитела по отношению к IgE человека составляет приблизительно 10% или менее от активности терапевтического антитела против IgE по отношению к указанному IgE человека; и (b) определения связывания антитела изотипа IgE против лекарственного средства с мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение относится к способам идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, включающим этапы: (a) приведения образца от пациента в контакт с (i) мутантным терапевтическим антителом и (ii) полипептидом FcεRIα, связывающимся с Fc-областью IgE человека, где мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека; (b) фиксации мутантного терапевтического антитела на поверхности; и (c) определения связывания антитела изотипа IgE против лекарственного средства с мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение относится к способам идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, включающим этапы: (a) преинкубации образца от пациента с избыточным количеством полипептида FcεRIα, связывающегося с Fc-областью IgE человека; (b) инкубации преинкубированного на этапе (a) образца с терапевтическим антителом против IgE или мутантным терапевтическим антителом, содержащим по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека снижена по сравнению с относительной аффинностью связывания терапевтического антитела против IgE с указанным IgE человека; и (c) определения связывания антитела изотипа IgE против лекарственного средства с терапевтическим антителом против IgE или мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение относится к способам лечения пациента, обладающего IgE-опосредованным нарушением, включающим этапы: (a) определения уровня антитела изотипа IgE против лекарственного средства к терапевтическому антителу против IgE в образце от пациента; (b) введения эффективного количества терапевтического антитела против IgE пациенту, если уровень антитела против лекарственного средства в образце не свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE. Уровень антитела против лекарственного средства можно определять любыми способами, предоставляемыми в настоящем документе.

В другом аспекте изобретение относится к применению мутантного терапевтического антитела, содержащего по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE в получении набора для определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE в образце, где определение включает этапы: (a) приведения образца, который может содержать антитело против лекарственного средства, в контакт с мутантным терапевтическим антителом, где относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека; и (b) определения связывания антитела против лекарственного средства с мутантным терапевтическим антителом.

В другом аспекте изобретение относится к применению мутантного терапевтического антитела, содержащего по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, в получении набора для определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце, где определение включает этапы: (a) приведения образца который может содержать антитело против лекарственного средства, в контакт с мутантным терапевтическим антителом, где активность мутантного терапевтического антитела по отношению к IgE человека составляет приблизительно 10% или менее от активности терапевтического антитела против IgE по отношению к указанному IgE человека; и (b) определения связывания антитела против лекарственного средства с мутантным терапевтическим антителом.

В другом аспекте изобретение относится к применению (i) мутантного терапевтического антитела и (ii) полипептида FcεRIα, связывающегося с Fc-областью IgE человека, в получении набора для определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, где определение включает этапы: (a) приведения образца, который может содержать антитело против лекарственного средства, в контакт с (i) мутантным терапевтическим антителом и (ii) полипептидом FcεRIα, где мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека; (b) фиксации мутантного терапевтического антитела на поверхности; и (c) определения связывания антитела против лекарственного средства с мутантным терапевтическим антителом.

В другом аспекте изобретение относится к применению (i) терапевтического антитела против IgE или мутантного терапевтического антитела, содержащего по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и (ii) полипептида FcεRIα, связывающегося с Fc-областью IgE человека, в получении набора для определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, где определение включает этапы: (a) преинкубации образца, который может содержать антитело против лекарственного средства, с избыточным количеством полипептида FcεRIα; (b) инкубации преинкубированного на этапе (a) образца с терапевтическим антителом против IgE или мутантным терапевтическим антителом, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека снижена по сравнению с относительной аффинностью связывания терапевтического антитела против IgE с указанным IgE человека; и (c) определения связывания антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным терапевтическим антителом.

В другом аспекте изобретение относится к применению мутантного терапевтического антитела, содержащего по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, в получении набора для идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, где идентификация включает этапы: (a) приведения образца от пациента в контакт с мутантным терапевтическим антителом, где относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека; и (b) определения связывания антитела изотипа IgE против лекарственного средства с мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение относится к применению мутантного терапевтического антитела, содержащего по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE в получении набора для идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, где идентификация включает этапы: (a) приведения образца от пациента в контакт с мутантным терапевтическим антителом, где активность мутантного терапевтического антитела по отношению к IgE человека составляет приблизительно 10% или менее от активности терапевтического антитела против IgE по отношению к указанному IgE человека; и (b) определения связывания антитела изотипа IgE против лекарственного средства с мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение относится к применению (i) мутантного терапевтического антитела и (ii) полипептида FcεRIα, связывающегося с Fc-областью IgE человека в получении набора для идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, где идентификация включает этапы: (a) приведения образца от пациента в контакт с (i) мутантным терапевтическим антителом и (ii) полипептидом FcεRIα, где мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с указанным IgE человека; (b) фиксации мутантного терапевтического антитела на поверхности; и (c) определения связывания антитела изотипа IgE против лекарственного средства с мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение относится к применению (i) полипептида FcεRIα, связывающегося с Fc-областью IgE человека, и (ii) терапевтического антитела против IgE или мутантного терапевтического антитела, содержащего по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, в получении набора для идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, где идентификация включает этапы: (a) преинкубации образца от пациента с избыточным количеством полипептида FcεRIα; (b) инкубации преинкубированного на этапе (a) образца с терапевтическим антителом против IgE или мутантным терапевтическим антителом, и относительная аффинность связывания мутантного терапевтического антитела с IgE человека снижена по сравнению с относительной аффинностью связывания терапевтического антитела против IgE с указанным IgE человека; и (c) определения связывания антитела изотипа IgE против лекарственного средства с терапевтическим антителом против IgE или мутантным терапевтическим антителом, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

В другом аспекте изобретение также относится к композициям, содержащим терапевтическое антитело против IgE для лечения пациента, имеющего IgE-опосредованное нарушение, где определяют уровень антитела изотипа IgE против лекарственного средства к терапевтическому антителу против IgE в образце от пациента, и уровень антитела против лекарственного средства в образце не свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE. В другом аспекте изобретение относится к терапевтическому антителу против IgE для лечения пациента, имеющего IgE-опосредованное нарушение, где определяют уровень антитела изотипа IgE против лекарственного средства к терапевтическому антителу против IgE в образце от пациента, и уровень антитела против лекарственного средства в образце не свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

Следует понимать, что для получения других вариантов осуществления настоящего изобретения можно комбинировать одно, несколько или все свойства различных вариантов осуществления, описываемых в настоящем документе. Эти и другие аспекты изобретения будут очевидны специалисту в данной области.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фигуре 1A представлена аминокислотная последовательность легкой цепи антитела E25 (SEQ ID NO:1). На фигуре 1B представлена аминокислотная последовательность тяжелой цепи антитела E25 (SEQ ID NO:2). Области CDR, определяемые по Chothia, представлены жирным шрифтом, в то время как области CDR, определяемые по Kabat, подчеркнуты линией.

Фигура 2A является графическим представлением анализа ELISA для сравнения аффинности связывания E25 и мутантного E25-AAA с очищенным IgE человека. Фигура 2B является графиком, демонстрирующим связывание мутантного E25-AAA с IgE человека по сравнению со связыванием E25 с IgE человека. Мутантный E25-AAA имел приблизительно в 100 раз меньшую аффинность к IgE, чем E25.

Фигура 3 является графическим представлением анализа активности терапевтических антител против IgE.

Фигура 4A является графиком, демонстрирующим связывание AME2 с E25 по сравнению со связыванием AME2 с мутантным E25-AAA. Фигура 4B является графиком, демонстрирующим связывание AME10 с E25 по сравнению со связыванием AME10 с мутантным E25-AAA. Фигура 4C является графиком, демонстрирующим связывание AME1 с E25 по сравнению со связыванием AME1 с мутантным E25-AAA. Фигура 4D является графиком, демонстрирующим связывание AME7 с E25 по сравнению со связыванием AME7 с мутантным E25-AAA. Фигура 4E является графиком, демонстрирующим связывание AME9 с E25 по сравнению со связыванием AME9 с мутантным E25-AAA. Фигура 4F является графиком, демонстрирующим связывание AME13 с E25 по сравнению со связыванием AME13 с мутантным E25-AAA. Фигура 4G является графиком, демонстрирующим связывание AME4 с E25 по сравнению со связыванием AME4 с мутантным E25-AAA. Фигура 4H является графиком, демонстрирующим связывание AME5 с E25 по сравнению со связыванием AME5 с мутантным E25-AAA.

На фигуре 5 представлено E25-специфичное химерное антитело IgE, сконструированное в качестве антитела положительного контроля для системы анализа. Вариабельные области химерного антитела взяты из антитела AME2, специфически связывающегося с Fab-фрагментом E25, и константные области химерного антитела взяты из антитела IgE человека.

Фигура 6A является графическим представлением системы анализа для тестирования связывания химерного E25-специфичного антитела IgE положительного контроля с антителом E25 или мутантным антителом E25-AAA. Фигура 6B является графиком, демонстрирующим, что химерное E25-специфичное антитело IgE положительного контроля связывается с E25 и мутантным 25-AAA со схожей аффинностью.

Фигура 7 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением мутантного антитела E25-AAA.

На фигуре 8 представлена стандартная кривая E25-специфичного IgE для определения чувствительности анализа для определения E25-специфичных антител изотипа IgE с применением мутантного антитела E25-AAA. На данной фигуре представлены результаты применения формата анализа, описываемого на фигуре 7.

На фигуре 9 представлена устойчивость анализа к лекарственному средству для определения E25-специфичных антител изотипа IgE с применением мутантного антитела E25-AAA в присутствии повышающихся концентраций E25.

Фигура 10 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением полугомогенного формата ELISA.

Фигура 11 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением полугомогенного формата MSD-ECLA.

Фигура 12 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением "блокирующего" гомогенного формата ELISA.

Фигура 13 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением "блокирующего" гомогенного формата ELISA.

Фигура 14 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением гомогенного формата MSD-ECLA.

Фигура 15 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением полугомогенного формата ELISA. В левой части фигуры 15 представлен анализ с применением меченного биотином E25 (или меченного биотином мутантного E25). В правой части фигуры 15 представлен анализ с применением E25 (или мутантного E25).

Фигура 16 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением полугомогенного формата ELISA. В левой части фигуры 16 представлен анализ с применением меченного биотином E25 (или меченного биотином мутантного E25). В правой части фигуры 16 представлен анализ с применением E25 (или мутантного E25).

Фигура 17 является графическим представлением анализа для определения E25-специфичных антител изотипа IgE с применением полугомогенного формата MSD-ECLA. В левой части фигуры 17 представлен анализ с применением меченного биотином E25 (или меченного биотином мутантного E25). В правой части фигуры 17 представлен анализ с применением E25 (или мутантного E25).

ПОДРОБНОЕ ОПИСАНИЕ

Настоящее изобретение относится к способам и реагентам, применимым для определения антител изотипа IgE против лекарственного средства, специфичных к терапевтическому антителу против IgE (такому как омализумаб, XOLAIR®). Проблемы разработки такого анализа включают трудность различения эндогенного IgE (IgE с Fc-областью, доступной для связывания терапевтическим антителом против IgE) и IgE, специфичного к терапевтическому антителу против IgE, т.к. эндогенный IgE мешает определению IgE, специфичного к терапевтическому антителу против IgE. Изобретение относится к способу и реагентам, с помощью которых можно дифференцировать эндогенный IgE и IgE, специфичный к терапевтическому антителу против IgE, и специфически определять IgE, специфичный к терапевтическому антителу против IgE.

A. Общие способы

В практическом осуществлении настоящего изобретения, если не указано иначе, применяют общепринятые способы молекулярной биологии (включая рекомбинантные способы), микробиологии, клеточной биологии, биохимии и иммунологии, известные специалистам в данной области. Такие способы полностью описаны в литературе, такой как, "Molecular Cloning: A Laboratory Manual", second edition (Sambrook et al., 1989); "Oligonucleotide Synthesis" (M. J. Gait, ed., 1984); "Animal Cell Culture" (R. I. Freshney, ed., 1987); "Methods in Enzymology" (Academic Press, Inc.); "Current Protocols in Molecular Biology" (F. M. Ausubel et al., eds., 1987, and periodic updates); "PCR: The Polymerase Chain Reaction", (Mullis et al., eds., 1994).

Если не указано иначе, применяемые в настоящем документе технические и научные термины обладают тем же значением, которое общепринято среди специалистов в данной области, к которой принадлежит настоящее изобретение. В Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), and March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4th ed., John Wiley & Sons (New York, N.Y. 1992), специалисту в данной области представляют общее руководство по многим терминам, применяемым в настоящей заявке.

B. Определения

Как применяют в настоящем документе, "антитело против лекарственного средства" является антителом, где вариабельные области антитела связываются с терапевтическим антителом против IgE. Например, антитела с вариабельными областями, связывающимися с описываемым в настоящем документе терапевтическим антителом омализумабом (E25), являются антителами против лекарственного средства.

Термин "антитело" применяют в самом широком смысле, и он конкретно включает моноклональные антитела (включая полноразмерные моноклональные антитела), поликлональные антитела, полиспецифические антитела (например, биспецифические антитела) и фрагменты антител при условии, что они проявляют желательную биологическую активность или функцию.

"Фрагменты антител" включают часть полноразмерного антитела, как правило, его антигенсвязывающую или вариабельную область. Примеры фрагментов антител включают Fab-, Fab’-, F(ab’)2- и Fv-фрагменты; диатела; линейные антитела; одноцепочечные молекулы антител; и полиспецифические антитела, образованные из фрагментов антител.

"Fab"-фрагмент включает вариабельный и константный домен легкой цепи и вариабельный домен и первый константный домен (CH1) тяжелой цепи. F(ab)’2-фрагменты антител содержат пару Fab-фрагментов, как правило, ковалентно связанных вблизи их карбокси-концов посредством шарнирных цистеинов. Также известны другие химические соединения фрагментов антител.

"Fv" является минимальным фрагментом антитела, содержащим полный участок распознавания и связывания антигена. Данный фрагмент состоит из димера одного домена вариабельной области тяжелой цепи и одного домена вариабельной области легкой цепи в прочной нековалентной связи. При фолдинге данных двух доменов получают шесть гипервариабельных петель (3 петли, каждая из цепей H и L), представляющих аминокислотные остатки для связывания антигена и придающих специфичность связывания антигена с антителом. Однако даже один вариабельный домен (или половина Fv, содержащая только три CDR, специфичных к антигену) обладает способностью распознавать и связывать антиген, хотя и при более низкой аффинности, чем полный участок связывания.

Как применяют в настоящем документе, термин "моноклональное антитело" относится к антителу из популяции по существу гомогенных антител, т.е. отдельные антитела, составляющие популяцию, являются идентичными и/или связывают один и тот же эпитоп (эпитопы) за исключением возможных вариантов, которые можно получать при производстве моноклональных антител, как правило, такие варианты присутствуют в незначительных количествах. Как правило, такое моноклональное антитело включает антитело, содержащее полипептидную последовательность, связывающую мишень, где связывающую мишень полипептидную последовательность получали способом, включающим выбор полипептидной последовательности, связывающей одну мишень, из множества полипептидных последовательностей. Например, способ выбора может являться выбором уникального клона из множества клонов, таких как совокупность гибридомных клонов, фаговых клонов или клонов рекомбинантной ДНК. Следует понимать, что выбранную связывающую мишень последовательность можно дополнительно изменять, например, для улучшения аффинности к мишени, для гуманизации связывающей мишень последовательности, для улучшения ее производства в культуре клеток, для снижения ее иммуногенности in vivo, для получения полиспецифического антитела и т.д., и что антитело, содержащее измененную связывающую мишень последовательность, также является моноклональным антителом по данному изобретению. В отличие от препаратов поликлональных антител, как правило, включающих различные антитела, направленные против различных детерминант (эпитопов), каждое моноклональное антитело из препарата моноклонального антитела направлено против одной детерминанты на антигене. В дополнение к их специфичности препараты моноклональных антител обладают преимуществом в том, что они, как правило, неконтаминированы другими иммуноглобулинами. Определение "моноклональное" указывает на характер антитела, как получаемого по существу из гомогенной популяции антител, и не интерпретирует его, как требующего производства антитела любым конкретным способом. Например, моноклональные антитела, предназначенные для применения в соответствии с настоящим изобретением, можно получать различными способами, включая, например, гибридомный способ (например, Kohler et al., Nature, 256:495 (1975); Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al. в: Monoclonal Antibodies and T-Cell Hybridomas 563-681, (Elsevier, N.Y., 1981)), способ рекомбинантной ДНК (смотри, например, патент США № 4816567), технологию фагового дисплея (см., например, Clackson el al., Nature, 352:624-628 (1991); Marks et al., J. Mol. Biol, 222:581-597 (1991); Sidhu et al., J. Mol. Biol. 338(2):299-310 (2004); Lee et al., J. Mol. Biol, 340(5):1073-1093 (2004); Fellouse, Proc. Nat. Acad. Sei. USA 101(34):12467-12472 (2004); и Lee et al., J. Immunol. Methods 284(1-2):119-132 (2004); и технологии получения антител человека или подобных, обладающих частями или всеми локусами или генами иммуноглобулинов человека, кодирующими последовательности иммуноглобулинов человека (см., например, WO 1998/24893; WO 1996/34096; WO 1996/33735; WO 1991/10741; Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggemann et al., Year in Immuno., 7:33 (1993); патенты США №№ 5545806; 5569825; 5591669 (все GenPharm); 5545807; WO 1997/17852; патенты США №№ 5545807; 5545806; 5569825; 5625126; 5633425 и 5661016; Marks el al., Bio/Technolosv. 10:779-783 (1992); Lonberg et al., Nature. 368:856-859 (1994); Morrison, Nature, 368:812-813 (1994); Fishwild el al., Nature Biotechnology, 14:845-851 (1996); Neuberger, Nature Biotechnology. 14:826 (1996); и Lonberg and Huszar, Intern. Rev. Immunol. 13:65-93 (1995)) на животных.

Моноклональные антитела в настоящем документе конкретно включают "химерные" антитела. "Химерные" антитела (иммуноглобулины) обладают частью тяжелой и/или легкой цепи, идентичной или гомологичной соответствующим последовательностям антител, полученным из конкретных видов или принадлежащим конкретному классу или подклассу антител, в то время как оставшаяся часть цепи (цепей) идентична или гомологична соответствующим последовательностям антител, полученным из других видов или принадлежащим другому классу или подклассу антител, а также фрагментам таких антител, при условии, что они проявляют желательную биологическую активность (патент США № 4816567; и Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)). Как применяют в настоящем документе, гуманизированное антитело является подгруппой химерных антител.

"Гуманизированными" формами не принадлежащих человеку антител (например, мыши) являются химерные антитела, содержащие минимальную последовательность, полученную из не принадлежащего человеку иммуноглобулина. Преимущественно, гуманизированные антитела являются иммуноглобулинами человека (реципиентным или акцепторным антителом), в которых остатки гипервариабельной области реципиента заменяют остатками гипервариабельной области не являющихся человеком видов (донорное антитело), таких как мышь, крыса, кролик или не являющийся человеком примат, обладающими желаемой специфичностью, аффинностью и емкостью. В некоторых случаях остатки каркасной области Fv (FR) иммуноглобулина человека заменяют соответствующими не принадлежащими человеку остатками. Кроме того, гуманизированные антитела могут содержать остатки, не обнаруживаемые в реципиентном антителе или донорном антителе. Данные модификации осуществляют для дополнительного улучшения характеристики антитела, такой как аффинность связывания. Как правило, гуманизированное антитело будет содержать, по существу, все по меньшей мере один, и, как правило, два вариабельных домена, в которых все или по существу все из гипервариабельных петель соответствуют таковым в не принадлежащем человеку иммуноглобулине, и все или по существу все из областей FR являются таковыми из последовательности иммуноглобулина человека, хотя области FR могут включать одну или несколько замен аминокислот, улучшающих аффинность связывания. Количество данных замен аминокислот в FR, как правило, составляет не более чем 6 в H-цепи и не более чем 3 в L-цепи. Гуманизированное антитело, необязательно, также будет содержать по меньшей мере часть константной области иммуноглобулина (Fc), как правило, иммуноглобулина человека. Более подробно, см. Jones et al., Nature 321:522-525 (1986); Reichmann et al., Nature 332:323-329 (1988); и Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).

"Антитело человека" является антителом, обладающим аминокислотной последовательностью, соответствующей таковой антитела, продуцируемого человеком и/или полученного с применением любого из известных способов получения антител человека. Данное определение антитела человека конкретно исключает гуманизированное антитело, содержащее не принадлежащие человеку антигенсвязывающие остатки.

Как применяют в настоящем документе, термин "гипервариабельная область", "HVR" или "HV" относится к областям вариабельного домена антитела, являющимся гипервариабельными в последовательности и/или образующими структурно определяемые петли. Как правило, антитела содержат шесть HVR; три в VH (H1, H2, H3) и три в VL (L1, L2, L3). В нативных антителах H3 и L3 проявляют наибольшее разнообразие среди шести HVR, и, в частности, H3, как полагают, играет уникальную роль в придании точной специфичности антителам. См., например, Xu et al., Immunity 13:37-45 (2000); Johnson and Wu в Methods in Molecular biology 248:1-25 (Lo, ed., Human Press, Totowa, NJ, 2003). Фактически, природные антитела верблюдовых, состоящие только из тяжелой цепи, являются функциональными и стабильными в отсутствие легкой цепи. См., например, Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al., Nature Struct. Biol. 3:733-736 (1996).

Применяют ряд определений HVR, они включены в настоящий документ. Определяющие комплементарность области (CDR) по Kabat основаны на вариабельности последовательностей и являются наиболее общеупотребительными (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Альтернативно Chothia ссылается на положение структурных петель (Chothia и Lesk J. Mol. Biol. 196:901-917 (1987)). AbM HVR представляют собой компромисс между HVR по Kabat и структурными петлями по Chothia, и его применяют в программном обеспечении для моделирования антител AbM Oxford Molecular. "Контактные" HVR основываются на анализе доступных комплексных кристаллических структур. Остатки из каждого из данных HVR представлены ниже.

Петля Kabat AbM Chothia Контакт
L1 L24-L34 L24-L34 L26-L32 L30-L36
L2 L50-L56 L50-L56 L50-L52 L46-L55
L3 L89-L97 L89-L97 L91-L96 L89-L96
H1 H31-H35B H26-H35B H26-H32 H30-H35B
(Нумерация по Kabat)
H1 H31-H35 H26-H35 H26-H32 H30-H35
(Нумерация по Chothia)
H2 H50-H65 H50-H58 H53-H55 H47-H58

H3 H95-H102 H95-H102 H96-H101 H93-H101

HVR могут содержать "протяженные HVR", как указано ниже: 24-36 или 24-34 (L1), 46-56 или 50-56 (L2) и 89-97 или 89-96 (L3) в VL и 26-35 (H1), 50-65 или 49-65 (H2) и 93-102, 94-102 или 95-102 (H3) в VH. Остатки вариабельных доменов нумеруют по Kabat et al., выше, для каждого из данных определений.

Остатки "каркаса" или "FR" являются остатками вариабельного домена, иными, чем остатки HVR, как определяют в настоящем документе.

Термин "нумерация остатков вариабельного домена по Kabat" или "нумерация положений аминокислот по Kabat" и его варианты относятся к системе нумерации, применяемой для вариабельных доменов тяжелой цепи или вариабельных доменов легкой цепи совокупности антител в Kabat et al., выше. С применением данной системы нумерации фактическая линейная аминокислотная последовательность может содержать меньше аминокислот или дополнительные аминокислоты, соответствующие укорочению или инсерции в FR или HVR вариабельного домена. Например, вариабельный домен тяжелой цепи может включать инсерцию одной аминокислоты (остаток 52a по Kabat) после остатка 52 H2 и встроенные остатки (например, остатки 82a, 82b и 82c и т.д. по Kabat) после остатка 82 FR тяжелой цепи. Нумерацию остатков по Kabat можно определять для указанного антитела посредством выравнивания областей гомологии последовательности антитела со "стандартной" пронумерованной последовательностью по Kabat.

Как правило, систему нумерации по Kabat применяют по отношению к остатку в вариабельном домене (приблизительно остатки 1-107 легкой цепи и остатки 1-113 тяжелой цепи) (например, Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Как правило, "систему нумерации EU" или "индекс EU" применяют по отношению к остатку в константной области тяжелой цепи иммуноглобулина (например, индекс EU, приведенный в Kabat et al., выше). "Индекс EU по Kabat" относится к нумерации остатков антитела IgG1 человека EU. Если в настоящем документе не указано иначе, ссылки на номера остатков в вариабельных доменах антител означают нумерацию остатков по системе нумерации по Kabat. Если в настоящем документе не указано иначе, ссылки на номера остатков в константных доменах антител означают нумерацию остатков по системе нумерации EU (например, см. предварительную заявку США № 60/640323, фигуры по нумерации EU).

Термин "Fc-область" применяют для определения C-концевой области тяжелой цепи иммуноглобулина, которую можно получать расщеплением интактного антитела папаином. Fc-область может являться нативной последовательностью Fc-области или вариантом Fc-области. Хотя границы Fc-области тяжелой цепи иммуноглобулина могут варьировать, как правило, Fc-область тяжелой цепи IgG человека определяют как пролегающую от аминокислотного остатка приблизительно в положении Cys226, или приблизительно от положения Pro230, до карбоксильного конца Fc-области. Fc-область иммуноглобулина в основном содержит два константных домена, домен CH2 и домен CH3, и необязательно содержит домен CH4. "Цепь Fc-области" в настоящем документе означает одну из двух полипептидных цепей Fc-области.

Как правило, "связывание" или "специфичное связывание" относится к связыванию между двумя молекулами (такому как связывание между антителом и одной или несколькими мишенями, антителом против IgE и IgE и антителом против лекарственного средства и лекарственным средством) с достаточной аффинностью. Предпочтительно, степень связывания антитела с неродственной молекулой составляет менее чем приблизительно 10% от связывания антитела с мишенью, измеряемого, например, радиоиммунологическим анализом (RIA). В некоторых вариантах осуществления антитело, связывающееся с его мишенью, имеет константу диссоциации (Kd) ≤1 мкМ, ≤100 нМ, ≤10 нМ, ≤1 нМ или ≤0,1 нМ.

Как правило, "аффинность связывания" относится к силе суммы моновалентных взаимодействий между одним участком связывания молекулы (например, антитела) и его партнером по связыванию (например, антигеном). Как применяют в настоящем документе, если не указано иначе, "аффинность связывания" относится к действительной аффинности связывания, отражающей взаимодействие 1:1 между членами пары связывания (например, антителом и антигеном). Как правило, аффинность молекулы X к его партнеру Y можно представлять константой диссоциации (Kd). Аффинность можно измерять общеизвестными в данной области способами, включая описываемые в настоящем документе. Как правило, низкоаффинные антитела связывают антиген медленно и имеют тенденцию быстро диссоциировать, в то время как высокоаффинные антитела, как правило, связывают антиген быстрее и имеют тенденцию дольше оставаться связанными. В данной области известно множество способов измерения аффинности связывания, любой из которых можно применять в целях настоящего изобретения. Конкретные иллюстративные и примерные варианты осуществления для измерения аффинности связывания описывают ниже.

В одном из вариантов осуществления "Kd" или "величину Kd" по данному изобретению измеряют анализом связывания антигена с радиоактивной меткой (RIA), осуществляемым с Fab-версией интересующего антитела и его антигеном, как описывают в следующем ниже анализе. Аффинность связывания Fab к антигену в растворе измеряют уравновешиванием Fab с минимальной концентрацией меченого (125I) антигена в присутствии серии титрований немеченым антигеном, затем фиксацией связавшегося антигена на планшете, покрытом антителом против Fab (см., например, Chen, et al., J. Mol. Biol. 293:865-881(1999)). Для установления условий анализа многолуночные планшеты MICROTITER® (Thermo Scientific) в течение ночи покрывают 5 мкг/мл фиксирующего антитела против Fab (Cappel Labs) в 50 мМ карбонате натрия (pH 9,6) и затем блокируют 2% (масс./об.) бычьим сывороточным альбумином в PBS в течение от двух до пяти часов при комнатной температуре (приблизительно 23°C). В неабсорбирующем планшете (Nunc #269620) 100 пМ или 26 пМ [125I]-антигена смешивают с серийными разведениями интересующего Fab (например, в соответствии с оценкой антитела против VEGF, Fab-12, в Presta et al., Cancer Res. 57:4593-4599 (1997)). Затем интересующий Fab инкубируют в течение ночи; однако инкубацию можно продолжать в течение более долгого периода (например, приблизительно 65 часов) для обеспечения достижения равновесия. Затем смеси переносят на планшет для фиксации для инкубации при комнатной температуре (например, в течение одного часа). Затем раствор удаляют, и планшет промывают восемь раз 0,1% TWEEN-20™ в PBS. После высушивания планшетов добавляют 150 мкл/лунку сцинтиллятора (MICROSCINT-20™; Packard) и планшеты обрабатывают на счетчике гамма-излучения TOPCOUNT™ (Packard) в течение десяти минут. Для применения в анализах конкурентного связывания выбирают концентрации каждого Fab, демонстрирующего связывание менее чем или равное 20% от максимального связывания.

По другому варианту осуществления, Kd или величину Kd можно измерять с применением анализов поверхностного плазмонного резонанса с применением BIACORE®-2000 или BIACORE®-3000 (BIAcore, Inc., Piscataway, NJ) при 25°C с чипами с иммобилизованным антигеном CM5 при -10 единицах ответа (RU). В кратком изложении, биосенсорные чипы с карбоксиметилированным декстраном (CM5, BIACORE, Inc.) активируют N-этил-N’-(3-диметиламинопропил)карбодиимид гидрохлоридом (EDC) и N-гидроксисукцинимидом (NHS) по инструкциям производителя. Антиген разводят 10 мМ ацетатом натрия, pH 4,8, до 5 мкг/мл (-0,2 мкМ) до инъекции при скорости потока 5 мкл/минуту для достижения приблизительно 10 единиц ответа (RU) связанного белка. После инъекции антигена вводят 1 M этаноламина для блокирования непрореагировавших групп. Для измерений кинетики двукратные серийные разведения Fab (от 0,78 нМ до 500 нМ) вводят в PBS с 0,05% поверхностно-активным веществом TWEEN-20™ (PBST) при 25°C при скорости потока приблизительно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) вычисляют с применением простой модели связывания Ленгмюра один-к-одному (BIACORE® Evaluation Software version 3.2) посредством одновременного наложения сенсограмм ассоциации и диссоциации. Равновесную константу диссоциации (Kd) вычисляют как отношение koff/kon. См., например, Chen et al., J. Mol. Biol. 293:865-881 (1999). Если по результатам указанного выше анализа поверхностного плазмонного резонанса скорость прямой реакции превышает 106 М-1с-1, то скорость прямой реакции можно определять с применением способа гашения флуоресценции, которым измеряют повышение или снижение интенсивности флуоресценции (возмущение = 295 нм; эмиссия = 340 нм, полоса пропускания 16 нм) при 25°C 20 нМ антитела против антигена (Fab-форма) в PBS, pH 7,2, в присутствии повышающихся концентраций антигена, измеряемых на спектрофотометре, таком как спектрофотометр, снабженный ограничителем потока (Aviv Instruments), или спектрофотометр SLM-AMINCO™ серии 8000 (ThermoSpectronic) с кюветой для перемешивания.

"Скорость прямой реакции", "скорость ассоциации (rate of association)", "скорость ассоциации (association rate)" или "kon" по данному изобретению также можно определять, как описано выше, с применением системы BIACORE®-2000 или BIACORE®-3000 (BIAcore, Inc., Piscataway, NJ).

Как применяют в настоящем документе, термин "по существу схожий" или "по существу тот же" обозначает достаточно высокую степень схожести между двумя численными величинами (например, одной, связанной с антителом по изобретению, и другой, связанной с референсным/сравнительным антителом) таким образом, что специалист в данной области будет рассматривать различие между двумя величинами как небольшое или биологически и/или статистически не значимое по отношению к биологической характеристике, измеряемой указанными величинами (например, величинами относительной аффинности связывания). Различие между указанными двумя величинами составляет, например, менее чем приблизительно 50%, менее чем приблизительно 40%, менее чем приблизительно 30%, менее чем приблизительно 20% и/или менее чем приблизительно 10% в зависимости от стандартной/сравнительной величины.

Как применяют в настоящем документе, термин "образец" относится к композиции, получаемой (obtained) или получаемой (derived) от интересующего индивидуума. Образцы включают, в качестве неограничивающих примеров, цельную кровь, сыворотку или плазму от индивидуума.

"Общий IgE" относится к общему количеству IgE, присутствующему в образце, включая свободный, несвязанный IgE и IgE в комплексе с партнером по связыванию. "Свободный IgE" относится к IgE, не связанному с партнером по связыванию.

Как применяют в настоящем документе, "индивидуум (subject)", "индивидуум (individual)" или "пациент" представляет собой млекопитающего, более предпочтительно, человека. Млекопитающие включают, в качестве неограничивающих примеров, людей, приматов, сельскохозяйственное животное, спортивных животных (например, лошадей), грызунов и домашних животных (например, собак и кошек).

Как применяют в настоящем документе, способ для "помощи в оценке" относится к способам, помогающим осуществлять клиническое определение (например, риска анафилаксии), и могут являться или не являться решающими относительно окончательной оценки.

Как применяют в настоящем документе, "референсная величина" может являться абсолютной величиной; относительной величиной; величиной, имеющей верхний и/или нижний предел; диапазоном величин; средней величиной; срединной величиной; усредненной величиной; или величиной по сравнению с конкретным контролем или исходной величиной.

Термин "определение (detecting)" или "определение (detection)" применяют в самом широком смысле для включения качественных и количественных измерений конкретной молекулы, в настоящем документе измерений конкретной молекулы аналита, такой как IgE или антитело против лекарственного средства. В одном из аспектов описываемый в настоящем документе способ определения применяют для идентификации самого присутствия интересующей молекулы аналита в образце. В другом аспекте способ определения можно применять для количественного анализа молекулы аналита в образце. В другом аспекте способ можно применять для определения относительной аффинности связывания интересующей молекулы аналита с молекулой-мишенью.

Термин "средство детекции (detecting agent)", "средство детекции (detection agent)", "реагент для детекции (detecting reagent)" и "реагент для детекции (detection reagent)" взаимозаменяемо применяют по отношению к средству, которым определяют молекулу аналита напрямую посредством метки, такой как флуоресцентная, ферментная, радиоактивная или хемилюминесцентная метка, которую можно связывать со средством детекции, или косвенно посредством меченого партнера по связыванию, такого как антитело или рецептор, специфически связывающийся со средством детекции. Примеры средств детекции включают, в качестве неограничивающих примеров, антитело, фрагмент антитела, растворимый рецептор, фрагмент рецептора и т.п.

"Коррелирует" или "коррелирующий" означает сравнение каким-либо способом осуществления и/или результатов первого анализа или способа с осуществлением и/или результатами второго анализа или способа. Например, можно применять результаты первого анализа или способа в осуществлении вторых способов и/или можно применять результаты первого анализа или способа для определения того, нужно ли осуществлять второй анализ или способ.

Термин "поверхность для анализа" или "поверхность" означает субстрат, на котором можно иммобилизировать средство фиксации для применения в иммунологическом анализе. Подходящие поверхности для анализа включают полимерный планшет для анализа, чипы, карты для измерения текучести (fluidity cards), магнитные бусы, смолы, полимерную целлюлозную губку и т.п.

Термин "связывающий домен" относится к области полипептида, связывающейся с другой молекулой. В случае полипептида Fc-рецептора или FcR связывающий домен может содержать часть его полипептидной цепи (например, его α-цепь), ответственную за связывание Fc-области иммуноглобулина или другой содержащей Fc-область молекулы. Одним применимым связывающим доменом является внеклеточный домен (ECD) полипептида α-цепи Fc-рецептора. Как описано в настоящем документе, внеклеточный домен цепи FcεRIα содержит связывающий домен, связывающийся с Fc-областью Ig, например, IgE.

Термин "средство фиксации" или "реагент для фиксации" относится к средству, способному связывать и фиксировать молекулу-мишень или молекулу аналита в образце. Как правило, средство или реагент для фиксации иммобилизируют, например, на твердом субстрате, таком как микрочастица или бусина, планшет для микротитрования, смола в колонке, чип, fluidity card, магнитная бусина, целлюлозная полимерная губка и т.п. Средство фиксации может являться антигеном, растворимым рецептором, антителом, смесью различных антител и т.п.

"Химерными" полипептидами являются полипептиды, в которых часть полипептидной последовательности получают из одних видов, в то время как по меньшей мере одна другая часть соответствует последовательности, полученной из других видов.

Как применяют в настоящем документе, термин "метка" относится к соединению или композиции, конъюгированной или слитой прямо или косвенно с реагентом, таким как зонд нуклеиновой кислоты, полипептид или антитело, и облегчающей определение или фиксацию реагента, с которым оно конъюгировано или слито. Метка сама по себе может являться детектируемой (например, радиоактивный изотоп, флуоресцентные, фотолюминесцентные, хемилюминесцентные или электрохемилюминесцентные метки), детектируемой после связывания с другой молекулой или, в случае ферментативной метки, может катализировать химическое изменение соединения или композиции субстрата, являющееся определяемым.

Термин "молекула-мишень" относится к мишени специфичного связывания молекулой аналита. Молекула-мишень может являться, например, антигеном, если молекула аналита является антителом. Молекула-мишень может являться, например, полипептидом или антителом, обладающим терапевтической активностью. В одном из вариантов осуществления молекула-мишень является терапевтическим антителом, и молекула аналита является антителом против лекарственного средства, связывающим терапевтическое антитело.

Как применяют в настоящем документе, "аналит" и "молекула аналита" относится к молекуле, анализируемой способами по изобретению, и включает, в качестве неограничивающих примеров, антитела против лекарственного средства.

"Лечение (treating)" или "лечение (treatment)" относится к медицинскому вмешательству в попытке изменять естественное состояние индивидуума или клетки, подвергшейся лечению, и его можно осуществлять для профилактики или при клинической патологии. Желательные эффекты лечения включают предотвращение возникновения или рецидива заболевания, облегчение симптомов, снижение любых прямых или косвенных патологических следствий заболевания, снижение скорости прогрессирования заболевания, улучшение или смягчение состояния заболевания и ремиссию или улучшенный прогноз. В некоторых вариантах осуществления описываемые в настоящем документе терапевтические антитела применяют для задержки развития заболевания или нарушения или замедления прогрессирования заболевания или нарушения.

"Эффективное количество" относится к количеству, эффективному в дозировках и в течение необходимых периодов времени для достижения желательного терапевтического или профилактического результата. "Терапевтически эффективное количество" терапевтического средства может варьировать в зависимости от факторов, таких как состояние заболевания, возраст, пол и масса индивидуума и способность антитела вызывать у индивидуума желательный ответ. Терапевтически эффективное количество также является количеством, при котором терапевтически положительное воздействие превосходит любые токсические или неблагоприятные эффекты терапевтического средства. "Профилактически эффективное количество" относится к количеству, эффективному в дозировках и в течение необходимых периодов времени для достижения желательного профилактического результата. Как правило, но необязательно, профилактически эффективное количество будет меньшим, чем терапевтически эффективное количество, т.к. профилактическую дозу применяют у индивидуумов до развития заболевания или на его ранней стадии.

Как применяют в настоящем документе, "консервативной заменой" замещают выбранную аминокислоту другой, по существу не отличающейся по свойствам. Сгруппированные по свойствам аминокислоты включают положительно заряженные аминокислоты: Lys, Arg, His; отрицательно заряженные аминокислоты: Asp, Glu; амидные аминокислоты: Asn, Gin; ароматические аминокислоты: Phe, Tyr, Trp; гидрофобные аминокислоты: Pro, Gly, Ala, Val, Leu, Ile, Met; и незаряженные гидрофильные аминокислоты: Ser, Thr. Предпочтительные консервативные аминокислотные замены представлены ниже:

Термины, "белок", "пептид" и "полипептид" применяют взаимозаменяемо для обозначения аминокислотного полимера или набора двух или более взаимодействующих или связанных аминокислотных полимеров.

"Полипептид" относится к пептиду или белку, содержащему две или более аминокислот, соединенных пептидными связями, и включает пептиды, олигомеры, белки и т.п. Полипептиды могут содержать природные, модифицированные или синтетические аминокислоты. Полипептиды также можно модифицировать естественно, например, посттрансляционным процессингом, или химически, например, амидированием, ацилированием, поперечным сшиванием и т.п.

Как применяют в настоящем документе, формы единственного числа могут означать единственное или множественное число (т.е. могут означать один или несколько), если не указано иначе.

Указание на "приблизительную" величину или параметр в настоящем документе включает (и описывает) варианты осуществления, направленные на величину или параметр как таковой. Например, описание с указанием "приблизительно X" включает описание "X".

Следует понимать, что описываемые в настоящем документе аспекты и варианты изобретения включают "состоящие" и/или "по существу состоящие из" аспектов и вариантов.

C. Способы по изобретению

Изобретение относится к способам и реагентам, применимым для определения антител изотипа IgE против лекарственного средства, специфически связывающихся с терапевтическим антителом против IgE. Изобретение также относится к способам идентификации индивидуума, имеющего риск анафилаксии на лечение терапевтическим антителом против IgE, посредством измерения наличия и/или уровня антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом, в образце от индивидуума и оценки риска анафилаксии на основании наличия и/или уровня антител изотипа IgE против лекарственного средства в образце. Изобретение дополнительно относится к способам лечения индивидуума, имеющего IgE-опосредованные нарушения, включающим определение наличия и/или уровня антител против лекарственного средства к терапевтическому антителу против IgE в образце от индивидуума и введение индивидууму эффективного количества терапевтического антитела против IgE, если уровень антител против лекарственного средства в образце свидетельствует о том, что индивидуум не обладает риском анафилактической реакции на терапевтическое антитело против IgE.

Терапевтические антитела против IgE и мутантные терапевтические антитела

Способы по изобретению применимы для определения антител изотипа IgE против лекарственного средства, специфически связывающихся с терапевтическим антителом против IgE. Трудности разработки такого анализа включают способность различать связывание с эндогенным IgE, на который направлено антитело против IgE, и с IgE, специфически связывающимся с антителом против IgE (т.е. антителом изотипа IgE против лекарственного средства). В некоторых вариантах осуществления IgE является IgE человека.

Как применяют в настоящем документе, "антителом против IgE" или "терапевтическим антителом против IgE" является антитело, связывающееся с IgE таким образом, что ингибирует или по существу снижает связывание такого IgE с высокоаффинным рецептором (FcεRI). Примеры антител против IgE включают, например, E25 (омализумаб), E26, E27, а также CGP-5101 (Hu-901) и антитело HA. Аминокислотные последовательности вариабельных доменов тяжелой и легкой цепи и полноразмерные тяжелые и легкие цепи гуманизированного антитела против IgE E25, E26 и E27 описывают, например, в патенте США № 6172213 (фигуры 2 и 12) и WO 99/01556. Антитело CGP-5101 (Hu-901) описывают в Corne et al., 1997, J. Clin. Invest. 99(5):879-887, WO 92/17207 и депозитах в ATTC №№ BRL-10706, 11130, 11131, 11132 и 11133. На фигуре 1 представлены полноразмерные аминокислотные последовательности антитела против IgE E25 (омализумаба). Антителом HA является антитело MAb2 (CL-2C), представленное в таблице 2, примере 10 в WO2004/070011 и WO2004/070010. Клеточную линию, продуцирующую антитело HA, хранят в American Type Culture Collection (ATCC) на 3 декабря 2003 года с ATCC № PTA-5678.

В некоторых вариантах осуществления в способах по изобретению применяют мутантное антитело против IgE, имеющее значимо меньшую аффинность связывания (включая относительную аффинность связывания) и/или активность по отношению к IgE (такому как IgE человека), чем немодифицированное терапевтическое антитело против IgE. Мутантное терапевтическое антитело против IgE можно конструировать таким образом, что оно будет иметь одну или несколько из следующих характеристик: a) аффинность связывания (включая относительную аффинность связывания) мутантного антитела с IgE составляет приблизительно 10% или менее от аффинности связывания (включая относительную аффинность связывания) терапевтического антитела против IgE с IgE; b) активность мутантного антитела по отношению к IgE составляет приблизительно 10% или менее от активности терапевтического антитела против IgE; c) мутантное антитело обладает той же или схожей третичной структурой, как и терапевтическое антитело против IgE; d) мутантное антитело обладает теми же или схожими уровнями гликанов, что и терапевтическое антитело против IgE; и e) мутантное антитело обладает той же или схожей аффинностью связывания с одним или несколькими контрольными антителами против лекарственного средства по сравнению с терапевтическим антителом против IgE. Для применения в описываемых в настоящем документе анализах можно выбирать мутантное терапевтическое антитело, обладающее минимальным количеством мутаций аминокислот в вариабельных областях, эффективным для снижения относительной аффинности связывания и/или активности по отношению к IgE. В некоторых вариантах осуществления мутантное антитело содержит одну, две, три, четыре, пять или шесть мутаций аминокислот (например, замен, делеций или вставок) в одной или нескольких CDR (например, одну, две или три в CDR1, CDR2 и CDR3) тяжелой и/или легкой цепи терапевтического антитела против IgE.

В некоторых вариантах осуществления активность мутантного антитела по отношению к IgE составляет приблизительно 10% или менее, приблизительно 7,5% или менее, приблизительно 5% или менее, приблизительно 2,5% или менее, приблизительно 2,0% или менее, приблизительно 1,5% или менее, приблизительно 1% или менее, приблизительно 0,9% или менее, приблизительно 0,8% или менее, приблизительно 0,7% или менее, приблизительно 0,5% или менее, приблизительно 0,25% или менее или приблизительно 0,1% или менее от активности терапевтического антитела против IgE по отношению к IgE.

В некоторых вариантах осуществления относительная аффинность связывания мутантного терапевтического антитела с IgE составляет приблизительно 10% или менее, приблизительно 7,5% или менее, приблизительно 5% или менее, приблизительно 2,5% или менее, приблизительно 2,0% или менее, приблизительно 1,5% или менее, приблизительно 1% или менее, приблизительно 0,9% или менее, приблизительно 0,8% или менее, приблизительно 0,7% или менее, приблизительно 0,5% или менее, приблизительно 0,25% или менее или приблизительно 0,1% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE.

В некоторых вариантах осуществления терапевтическое антитело против IgE является омализумабом, и мутантное антитело содержит одну, две или три мутации аминокислот в первой CDR легкой цепи и/или одну, две или три мутации аминокислот в третьей CDR тяжелой цепи. В некоторых вариантах осуществления терапевтическое антитело против IgE является омализумабом, и мутантное антитело содержит аминокислотную последовательность вариабельной области тяжелой цепи SEQ ID NO:2 и аминокислотную последовательность вариабельной области легкой цепи SEQ ID NO:1, где заменяют аминокислоту Asp в положении 34, положениях 30 и 34, положениях 32 и 34 или положениях 30, 32 и 34 SEQ ID NO:1. В некоторых вариантах осуществления аминокислоту Asp в положении 30, 32 и/или 34 SEQ IN NO:1 заменяют на Ala. В некоторых вариантах осуществления мутантное антитело содержит аминокислотную последовательность тяжелой цепи SEQ ID NO:2 и аминокислотную последовательность легкой цепи SEQ ID NO:1 с заменами аминокислот Asp на Ala в положениях 30, 32 и 34 SEQ ID NO:1. В описываемых в настоящем документе способах в качестве мутантного терапевтического антитела можно применять любые антитела против IgE, описываемые в Presta et al. (J. Immunol. 151:2623-2632, 1993), обладающие относительной аффинностью связывания и/или активностью по отношению к IgE приблизительно 10% или менее от относительной аффинности связывания или активности терапевтического антитела E25.

Антитела против лекарственного средства можно получать и применять в качестве контроля для скрининга мутантных антител. Данные контрольные антитела могут связываться со схожей или равной аффинностью с мутантным антителом и немодифицированным терапевтическим антителом против IgE. В некоторых вариантах осуществления контрольное антитело против лекарственного средства связывается с Fab-фрагментом антитела против IgE. В некоторых вариантах осуществления контрольное антитело против лекарственного средства связывается с одной или несколькими CDR антитела против IgE. Описываемый в примере 2 анализ связывания можно применять для тестирования и скрининга мутантных антител с применением контрольного антитела против лекарственного средства (такого как контрольное антитело, представленное на фигуре 5). Способы анализа см. на фигуре 6A.

Активность терапевтического антитела против IgE или мутантного терапевтического антитела определяют измерением способности терапевтического антитела против IgE или мутантного терапевтического антитела связываться с IgE при конкуренции с высокоаффинным рецептором (FcεRI) по сравнению со стандартным контролем. Типичные способы анализа включают иммунологические анализы, такие как ELISA, ECLA и т.п., включающие средство фиксации, связанное с поверхностью для анализа для фиксации и иммобилизации желательной молекулы-мишени. Фиксированные молекулы-мишени определяют средством детекции, связывающимся с молекулой-мишенью и представляющим метку для определения для количественного анализа.

В некоторых вариантах осуществления активность терапевтического антитела против IgE или мутантного терапевтического антитела определяют ELISA с ингибированием, как показано на фигуре 3. Повышающиеся концентрации антитела против IgE или мутантного антитела инкубируют с меченым IgE. Смесь добавляют на планшет, содержащий иммобилизированный полипептид FcεRIα в качестве средства фиксации. Антитело против IgE или мутантное антитело, связывающее меченый IgE, эффективно ингибирует связывание меченого IgE со средством фиксации, снижая определяемый сигнал. Таким образом, активность образца против IgE обратно пропорциональна определяемому сигналу.

В таких анализах в качестве средств фиксации, связывающих IgE, можно применять описываемые в настоящем документе полипептиды FcεRIα. Количество фиксированного IgE можно сравнивать с контролем, например, стандартным лотом или другим стандартом, имеющим известное количество антитела против IgE; и/или с контролем без антитела против IgE. Сниженный сигнал, определяемый от меченого IgE, сравнивают с контролем, и степень ингибирования коррелирует с активностью антитела против IgE или мутантного антитела.

Аффинность связывания (включая относительную аффинность связывания) мутантного терапевтического антитела или терапевтического антитела против IgE с IgE можно измерять с применением ELISA или системы поверхностного плазмонного резонанса (SPR) BIAcore™ (BIAcore, INC, Piscataway NJ). Относительная аффинность связывания является сравнением связывания лекарственного средства с его мишенью относительно другого лекарственного средства. Например, применяя анализ ELISA, терапевтическое антитело против IgE или мутантное антитело, или его фрагмент (такой как Fab), иммобилизируют на поверхности, и затем очищенный IgE (такой как IgE человека) с повышающейся концентрацией (например, от 0,1 нг/мл до 10000 нг/мл) инкубируют с иммобилизированным терапевтическим антителом против IgE или мутантным антителом. Средство детекции (такое как антитело козы против IgE человека), меченное HRP, позволяет связывать любой IgE, связанный с иммобилизированным терапевтическим антителом против IgE или мутантным антителом. Измеряют сигнал, генерируемый HRP. См., например, фигуры 2A и 2B. Определяют относительное снижение аффинности связывания мутантного терапевтического антитела по сравнению с терапевтическим антителом против IgE. Дополнительно, относительную аффинность связывания можно измерять иммобилизацией IgE (такого как IgE человека) прямо на поверхности (планшет для ELISA), инкубацией с различными концентрациями терапевтического антитела против IgE или мутантного антитела и затем определением связавшегося терапевтического антитела против IgE или мутантного антитела с применением меченного HRP антитела против IgG человека. Альтернативно, анализы BIAcore можно применять для измерения аффинности связывания IgE человека с иммобилизированным терапевтическим антителом против IgE или мутантным антителом (таким как Fab-фрагменты).

Другие свойства терапевтического антитела против IgE и мутантного антитела, такие как первичные и третичные структуры и уровни гликанов, тестируют с применением известного способа.

Полипептиды FcεRIα

Полипептид FcεRIα можно применять в качестве средства фиксации, средства детекции и/или блокирующего средства в описываемых в настоящем документе анализах. Термин "полипептид FcεRI" применяют для описания полипептида, связывающегося с Fc-областью IgE или содержащей Fc-область IgE молекулой, и полипептида, образующего рецептор, связывающийся с Fc-областью IgE или содержащей Fc-область IgE молекулой. Рецептор FcεRI может включать полипептид α-цепи Fc-рецептора и гомо- или гетеродимер полипептида ε-цепи Fc-рецептора. α-цепи FcεRI содержат внеклеточный домен ("ECD"), связывающийся с содержащим Fc-домен средством, например, иммуноглобулином (Ig). FcR описывают в Ravetch и Kinet, 1991, Annu. Rev. Immunol. 9:457-492; Capel et al., 1994, Immunomethods 4:25-34; и de Haas et al., 1995 J. Lab. Clin. Med. 126:330-341. Физиологию и патологию высокоаффинного рецептора IgE (FcεRI) описывают в Kinet, 1999, Annu. Rev. Immunol. 17:931-972.

В некоторых вариантах осуществления полипептид FcεRI может содержать последовательности Fc-связывающего домена (такие как последовательности внеклеточного домена) полипептида FcεRIα человека или не являющегося человеком примата (такого как макак-крабоед, макак-резус, шимпанзе). Полипептид FcεRIα также может включать синтетический полипептид FcεRIα, варианты полипептида FcεRIα, слитые белки, содержащие полипептид FcεRIα, и химерные белки, содержащие полипептид FcεRIα. В некоторых вариантах осуществления полипептид FcεRIα связывает IgE человека с аффинностью, схожей с FcεRIα человека дикого типа или не являющегося человеком примата, и не блокирует связывание эпитопов CDR IgE человека с терапевтическим антителом против IgE.

Незрелые полипептиды FcεRIα содержат нативную сигнальную последовательность, и в зрелых полипептидах отсутствует сигнальная последовательность. Полипептиды FcεRIα включают незрелые полипептиды FcεRIα, содержащие нативную сигнальную последовательность, и зрелые полипептиды без сигнальной последовательности. В некоторых вариантах осуществления полипептиды FcεRIα могут включать полипептиды, обладающие аминокислотной последовательностью SEQ ID NO:3 (макака-крабоеда), SEQ ID NO:4 (макака-резуса), SEQ ID NO:5 (шимпанзе) или SEQ ID NO:6 (человека), а также их варианты, обладающие по меньшей мере 90% (например, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) идентичностью последовательности с последовательностью SEQ ID NO:3, 4, 5 или 6.

IgE-связывающие фрагменты полипептидов FcεRIα

В некоторых вариантах осуществления полипептид FcεRIα содержит IgE-связывающий фрагмент FcεRIα. IgE-связывающие фрагменты FcεRIα, предпочтительно, сохраняют высокую аффинность к IgE. В одном примере IgE-связывющий фрагмент содержит внеклеточный домен ("ECD") FcεRIα человека или не являющегося человеком примата и может являться ECD SEQ ID NO:3, 4, 5 или 6, или их вариантом, обладающим по меньшей мере 90% идентичностью последовательности с SEQ ID NO:3, 4, 5 или 6.

Аминокислотные последовательности FcεRIα макака-крабоеда, макака-резуса, шимпанзе и человека представлены в таблице 1 ниже. Можно применять любые полипептиды FcεRIα не являющегося человеком примата, описываемые в WO 08/028068.

ECD FcεRIα может пролегать, например, от остатка V1 до K171, A172, P173, H/R174, D/E175 или K176 полипептидов FcεRIα, пронумерованных, как представлено в таблице 1. В некоторых вариантах осуществления полипептид FcεRI содержит любой из следующих фрагментов ECD FcεRIα: V1-K171, V1-A172, V1-Q/P173, V1-H/R174, V1-D/E 175 или V1-K176. Примеры полипептидов ECD FcεRIα, таким образом, включают полипептиды, содержащие остатки с V1 по K171, с V1 по A172, с V1 по P173, с V1 по H/R174, с V1 по D/E175 или с V1 по K176 SEQ ID NO:3, 4, 5 или 6, и их варианты, обладающие по меньшей мере 90% (например, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) идентичностью с SEQ ID NO:3, 4, 5 или 6.

Дополнительные фрагменты включают мутанты ECD с укорочениями и делециями, сохраняющими высокоаффинное связывание с IgE.

Варианты полипептидов FcεRIα

В некоторых вариантах осуществления полипептид FcεRIα включает вариант полипептида FcεRIα. Варианты полипептидов FcεRIα обладают по меньшей мере одной заменой аминокислоты, делецией или инсерцией по сравнению с нативным полипептидом. Варианты FcεRIα могут иметь одну или несколько консервативных замен аминокислот (как определено в настоящем документе), заменяя целевой остаток соответствующим остатком с тем же общим свойством, например, Lys вместо Arg. Такие замены аминокислот можно осуществлять без изменения общей функции полипептида. Вариант полипептида FcεRIα также может включать неконсервативные замены.

Вариант полипептида FcεRIα может иметь одну или несколько замен аминокислот FcεRIα первых видов соответствующей аминокислотой FcεRIα вторых видов. Например, кодируемый полипептид может содержать одну или несколько (но не более чем 14) замен аминокислот в положениях 29, 37, 48, 49, 59, 73, 74, 75, 80, 141, 155, 160, 173, 174 или 175, как представлено в таблице 1. Можно включать одну или несколько замен, например, одну или несколько (и меньше чем 14) из следующих замен аминокислот:

S29N M37T V48E A49T D59K

F73V D74N D75E H80V T141A

L155V C160Y Q173P H174R D175E

Информация о структуре, полученная из кристаллической структуры FcεRI человека в комплексе с Fc-доменом IgE человека, свидетельствует о том, что Tyr 160 находится рядом с областью контакта рецептора и лиганда. Т.к. Cys в данной области контакта может затруднять связывание, полипептиды FcεRIα можно подвергать мутагенезу для замены Cys 160 тирозином для улучшения связывания FcεRIα макака-крабоеда и макака-резуса в IgE человека. В некоторых вариантах осуществления полипептид FcεRIα включает полипептид FcεRIα, подвергнутый мутагенезу для включения замены Cys 160 на Тирозин. Например, мутантная последовательность макака-крабоеда представлена ниже.

Химерные полипептиды FcεRIα

В некоторых вариантах осуществления полипептид FcεRIα является химерным полипептидом, например, химерным полипептидом, образованным из двух или более частей различных полипептидов FcεRIα. Например, химерный полипептид FcεRIα могут образовывать две или более частей, полученных из двух или более SEQ ID NO:3, 4, 5 и 6. Примером химерного полипептида является химерный полипептид макака-крабоеда/макака-резуса, содержащий остатки 1-141 ECD FcεRIα макака-резуса и остатки 142-171 ECD FcεRIα макака-крабоеда, и обладающий аминокислотной последовательностью SEQ ID NO:12 (см. ниже). Дополнительные предполагаемые химерные полипептиды включают химеры человека/макака-крабоеда, человека/макака-резуса, человека/шимпанзе, макака-крабоеда/шимпанзе, макака-резуса/шимпанзе и т.п., каждый из которых содержит часть ECD FcεRIα указанных видов.

Слитые белки

В некоторых вариантах осуществления полипептидом FcεRIα является слитый белок, например, полипептид FcεRIα, слитый с одним или несколькими гетерологичными полипептидами. Такие слитые белки могут содержать по меньшей мере IgE-связывающий фрагмент FcεRIα, например, по меньшей мере ECD FcεRIα, слитый у карбокси- или амино-конца с гетерологичным полипептидом. Гетерологичным полипептидом может являться любой полипептид, и, как правило, им является полипептид, придающий слитому белку конкретное свойство.

Гетерологичные полипептиды могут обуславливать секрецию, улучшенную стабильность или облегчать очистку полипептидов FcεRIα. Неограничивающие примеры таких пептидных меток включают метку 6-His, метку Gly/His6/GST, тиоредоксиновую метку, гемагглютининовую метку, метку Glylhl56 и метку сигнальной последовательности OmpA. Например, внеклеточный домен полипептида FcεRIα может являться слитым с меткой His, например (His)6, включая метку Gly(His)6-gst. Метка Gly(His)6-gst обуславливает облегчение очистки полипептидов, кодируемых нуклеиновой кислотой.

С применением ECD каждого вида, как описано выше, можно конструировать и экспрессировать в клетках млекопитающих различные формы полипептида FcεRIα, например, мономерные формы, содержащие внеклеточный домен (остатки 1-176) рецептора, шесть C-концевых гистидиновых остатков и сигнальную последовательность. Например, полипептид FcεRIα может включать мономерную форму, содержащую нативную сигнальную последовательность на N-конце ECD, и метку HIS6:

Полипептид FcεRIα также может содержать ECD, слитый с сигнальной последовательностью и первыми 27 аминокислотами gD белка вируса простого герпеса (HSV), представленными ниже.

MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRFRGKDLPVLDQLLE (SEQ ID NO:14)

В некоторых вариантах осуществления полипептид FcεRIα может являться любым из трех специфичных слитых белков, каждый из которых содержит сигнальную последовательность gD HSV (подчеркнута ниже), слитую с ECD FcεRIα и меткой 6XHis:

gDcyno FcεRIα 1-176 6Xhis (SEQ ID NO:15),

gDrhesus FcεRIα 1-176 6Xhis (SEQ ID NO:16), и

gDchimp FcεRIα 1-176 6Xhis (SEQ ID NO:17).

Полипептиды FcεRIα также могут являться слитыми с константным доменом иммуноглобулина антитела с образованием молекул иммуноадгезина. Например, слитый полипептид содержит внеклеточный домен полипептида FcεRIα и Fc-часть IgG, который можно применять в любых способах, предоставляемых в настоящем документе. В некоторых вариантах осуществления слитый полипептид FcεRIα-IgG содержит следующую последовательность:

В некоторых вариантах осуществления полипептид FcεRIα является слитым белком, содержащим полипептид FcεRIα, слитый с Fc-доменом IgG, образующим димерную форму FcεRIα. Остатки цистеина, присутствующие в Fc-домене IgG, делают возможной димеризацию слитого полипептида. Например, фрагмент кодирующей FcεRIα нуклеиновой кислоты может являться слитым с Fc-доменом IgG, представленным ниже:

Полипептид FcεRIα может содержать нативную сигнальную последовательность (SS) макака-резуса, часть ECD FcεRIα макака-резуса (остатки V1-A141) и часть ECD FcεRIα макака-крабоеда (остатки T142-K171), слитые с Fc-доменом белка иммуноглобулина G. Остатки цистеина домена IgG позволяют дисульфидным связям образовать димер полипептида FcεRIα. В некоторых вариантах осуществления полипептид FcεRI содержит слитый белок FcεRIα-IgG с представленной ниже последовательностью:

Дополнительные химерные слитые белки FcεRIα-IgG макака-резуса/макака-крабоеда включают слитые белки, получаемые изменением длины химерного полипептида FcεRIα от 1-171 до 1-178 с повышением длин последовательности 171KAQHDKYW178. Они включают:

Слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-172) (SEQ ID NO:21)

Слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-173) (SEQ ID NO:22)

Слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-174) (SEQ ID NO:23)

Слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-175) (SEQ ID NO:24)

Слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-176) (SEQ ID NO:25)

Слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-177) (SEQ ID NO:26)

Слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-178) (SEQ ID NO:27)

Например, полипептид FcεRIα может являться слитым белком FcεRIα-IgG макака-резуса/макака-крабоеда (1-178) с представленной ниже последовательностью:

слитый белок FcεRIα-IgG макака-резуса/макака-крабоеда (1-178)

Полипептиды FcεRIα включают полипептиды, полученные различными сочетаниями полипептидов FcεRIα макака-крабоеда, макака-резуса, шимпанзе и человека, приводящими к образованию множества химерных полипептидов FcεRIα. Например, полипептид FcεRIα может включать FcεRIα-IgG макака-крабоеда/человека (1-178), представленный ниже:

FcεRIα-IgG макака-крабоеда/человека (1-178)

В некоторых вариантах осуществления метят полипептид FcεRIα (например, биотином, дигоксигенином, рутением, радиоактивной, фотолюминесцентной, хемилюминесцентной, флуоресцентной или электрохемилюминесцентной меткой).

Изобретение также относится к полинуклеотидам, кодирующим любые полипептиды FcεRIα, описываемые в настоящем документе. Кроме того, изобретение также относится к вариантам полинуклеотидных последовательностей, на по меньшей мере приблизительно 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичным последовательности нуклеиновой кислоты, кодирующей полноразмерную нативную последовательность, зрелую последовательность без сигнальной последовательности или внеклеточный домен полипептида SEQ ID NO:3, 4, 5 или 6, и менее чем на 100% идентичной последовательности нуклеиновой кислоты, кодирующей полноразмерную нативную последовательность, зрелую последовательность без сигнальной последовательности или внеклеточный домен нативной последовательности.

Изменения нуклеиновой кислоты и аминокислотных последовательностей FcεRIα можно осуществлять рядом известных способов. Например, мутации можно встраивать в конкретные положения способами, известными специалистам в данной области, такими как сайт-специфический мутагенез, например, описываемый в Walder et al., 1986, Gene, 42:133; Bauer et al., 1985, Gene 37:73; Craik, 1985, BioTechniques, 12-19; Smith et al., 1981, Genetic Engineering: Principles and Methods, Plenum Press; патент США № 4518584 и патент США № 4737462.

Способы получения нуклеотидов, кодирующих полипептиды FcεRI, и экспрессии полипептидов FcεRI в клетках млекопитающих известны специалисту в данной области. Например, плазмиды, кодирующие описываемые выше сконструированные формы полипептидов FcεRI, можно трансфицировать в эмбриональные клетки почки человека 293S с применением способов трансфекции осаждением фосфатом кальция или Fugene® (Roche, Indianapolis, IN). Супернатанты трансфицированных культур клеток собирают после нескольких дней выращивания, и полипептид FcεRI можно очищать аффинной хроматографией с применением антител, иммобилизированных на матрице колонки, направленных против метки gD HSV (MAb5B6, присоединенные к стеклу с контролируемым размером пор), или с применением металл-хелатирующих смол, направленных против слитой гистидиновой метки 6X (Ni-NTA-Agarose, Qiagen, Valencia, CA).

Описываемые в настоящем документе полипептиды и белки (такие как антитела против IgE, мутантные антитела, контрольные антитела против лекарственного средства, полипептиды FcεRI и т.д.) можно получать и выделять или очищать с применением известных в данной области способов. "Очищенные" означает, что молекула присутствует в образце в концентрации по меньшей мере 95% по массе, или по меньшей мере 96%, 97%, 98% или 99% по массе образца, в котором она содержится. Для получения клетки-хозяина, экспрессирующей целевые полипептиды по изобретению, можно применять любой способ рекомбинантной ДНК или РНК, включая, в качестве неограничивающих примеров, трансфекцию, трансформацию или трансдукцию. Способы и векторы для генно-инженерного изменения клеток-хозяев полинуклеотидами по настоящему изобретению, включая их фрагменты и варианты, хорошо известны в данной области, и их можно найти, например, в Current Protocols in Molecular biology, Ausubel et al., eds. (Wiley & Sons, New York, 1988 и дополнениях). Примеры векторов и клеток-хозяев описаны в примерах ниже.

Клетки-хозяева получают способами генной инженерии для экспрессии описываемых в настоящем документе полипептидов. Векторы включают ДНК, кодирующие любой из описываемых в настоящем документе полипептидов, функционально связанные с подходящими регулирующими транскрипцию или трансляцию последовательностями, например, полученными из гена млекопитающего, микроорганизма, вируса или насекомого. Примеры регуляторных последовательностей включают транскрипционные промоторы, операторы или энхансеры, рибосомальные участки связывания мРНК и подходящие последовательности, контролирующие транскрипцию и трансляцию. Нуклеотидные последовательности функционально связаны, если регуляторная последовательность функционально относится к ДНК, кодирующей целевой белок.

Можно включать такие полипептиды, делая возможной, например, секрецию, улучшенную стабильность или облегчая очистку полипептида. Полинуклеотидную последовательность, кодирующую подходящий сигнальный пептид, можно встраивать в экспрессирующие векторы. Последовательность ДНК для сигнального пептида (секреторная лидерная последовательность) может быть слитой в рамке считывания с целевой последовательностью таким образом, что целевой белок транслируется как слитый белок, содержащий сигнальный пептид. Последовательность ДНК для сигнального пептида может заменять нативную нуклеиновую кислоту, кодирующую сигнальный пептид или, в дополнение к последовательности нуклеиновой кислоты, кодирующую нативную последовательность сигнального пептида. Сигнальный пептид, функциональный в предполагаемой клетке-хозяине, способствует внеклеточной секреции полипептида. Предпочтительно, сигнальную последовательность отщепляют от целевого полипептида после секреции из клетки. Неограничивающие примеры сигнальных последовательностей, которые можно применять в практическом осуществлении изобретения, включают I-фактор дрожжей и лидерный пептид мелатина пчелы в клетках насекомых Sf9.

Выбор подходящих векторов для применения в клонировании полинуклеотидных молекул, кодирующих полипептиды, будет зависеть от клетки-хозяина, в которую трансформируют вектор, и, при необходимости, клетки-хозяина, из которой экспрессируют целевой полипептид. Подходящие для экспрессии полипептидов клетки-хозяева включают прокариоты, дрожжи и клетки высших эукариот.

Экспрессирующие векторы для применения в прокариотических клетках-хозяевах, как правило, содержат один или несколько генов фенотипически селективных маркеров. Как правило, такие гены кодируют, например, белок, придающий устойчивость к антибиотику или восполняющий ауксотрофные потребности. Широкий диапазон таких векторов легко доступен из коммерческих источников. Примеры включают векторы pSPORT, векторы pGEM (Promega), векторы pPROEX (LTI, Bethesda, MD), векторы Bluescript (Stratagene) и векторы pQE (Qiagen).

Полипептиды или белки, продуцируемые клетками-хозяевами, можно дополнительно очищать с применением известных способов.

Способы определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE

В одном из аспектов изобретение относится к способам определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце от индивидуума, включающим этапы: (a) приведения образца, который может содержать антитела против лекарственного средства, в контакт с мутантным терапевтическим антителом, содержащим по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела к IgE (такого как IgE человека) составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE; и (b) определения связывания антител против лекарственного средства с мутантным терапевтическим антителом.

В другом аспекте изобретение относится к способам определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце от индивидуума, включающим этапы: (a) приведения образца, который может содержать антитела против лекарственного средства, в контакт с мутантным терапевтическим антителом, содержащим по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где активность мутантного терапевтического антитела составляет приблизительно 10% или менее от активности терапевтического антитела против IgE; и (b) определения связывания антител против лекарственного средства с мутантным терапевтическим антителом.

Для определения связывания между антителами против лекарственного средства и мутантным терапевтическим антителом можно применять известные в данной области способы. Можно применять анализы ELISA, BIAcore®, Immunocap®, RIA (радиоиммунологический анализ). Анализы могут являться гомогенными, полугомогенными или негомогенными. Например, в большинстве ELISA применяют антитела и/или лиганды для фиксации и определения целевого белка. В данных ELISA могут применять гомогенные, полугомогенные или негомогенные форматы анализа для максимизации чувствительности или снижения влияния матрицы.

В гомогенных анализах применяют формат, где средство фиксации и средство детекции (или лиганды) преинкубируют одновременно с образцом матрицы, содержащим целевой белок в реакции жидкой фазы. Затем комплекс средство фиксации-целевой белок-средство детекции фиксируют на твердой фазе (такой как покрытый стрептавидином планшет для ELISA), промывают и проводят количественный анализ, определяя количество средства детекции, фиксированного на поверхности (например, добавлением раствора соответствующего субстрата, если средство детекции метят ферментом). В полугомогенных анализах применяют формат, где в реакции жидкой фазы с образцом матрицы преинкубируют только средство фиксации. Затем данный комплекс средство фиксации-целевой белок фиксируют на твердой фазе, промывают, затем инкубируют со средством детекции, промывают и проводят количественный анализ. В негомогенных анализах не применяют какой-либо этап преинкубации в жидкой фазе, но, вместо этого, применяют следующие этапы. Средство фиксации фиксируют на твердой фазе, промывают, затем добавляют образец матрицы, содержащий целевой белок, и связывают средством фиксации, промывают, связывают реагентом для детекции, промывают и проводят конечный количественный анализ.

Например, в негомогенном анализе описываемое в настоящем документе мутантное терапевтическое антитело иммобилизируют на поверхности и применяют в качестве средства фиксации для связывания с антителами IgE против лекарственного средства. Мутантное терапевтическое антитело можно прямо или косвенно иммобилизировать на поверхности. В некоторых вариантах осуществления мутантное терапевтическое антитело конъюгируют с меткой и фиксируют на поверхности через средство фиксации, специфически связывающееся с меткой, где средство фиксации иммобилизируют на поверхности. Прямо или косвенно иммобилизированное мутантное терапевтическое антитело инкубируют с образцом от индивидуума, который может содержать антитела изотипа IgE против лекарственного средства. Т.к. мутантное антитело конструируют таким образом, что оно имеет сниженную аффинность связывания или активность по отношению к IgE, количество антител IgE, связанных с мутантным терапевтическим антителом, коррелирует с антителами против лекарственного средства в образце. Связывание антител IgE против лекарственного средства с иммобилизированным мутантным антителом определяют с применением средства детекции (такого как полипептид FcεRI, связывающийся с Fc-областью IgE). Пример таких анализов представлен на фигуре 7.

Для определения антител изотипа IgE против лекарственного средства в образце также можно применять полугомогенные анализы. В некоторых вариантах осуществления определение включает этапы: 1) преинкубации образца от индивидуума, который может содержать антитела изотипа IgE против лекарственного средства, с меченым мутантным терапевтическим антителом; 2) инкубации преинкубированного образца с иммобилизированной молекулой (такой как стрептавидин), связывающейся с меткой на мутантном терапевтическом антителе; и 3) определения связывания антител изотипа IgE против лекарственного средства с мутантным терапевтическим антителом с применением средства детекции (такого как полипептид FcεRI, связывающийся с Fc-областью IgE). Для удаления несвязавшихся с твердой фазой молекул между этапами инкубации можно включать этапы промывки. Примеры таких анализов представлены на фигурах 11 и 12.

Для определения антител изотипа IgE против лекарственного средства в образце также можно применять "блокирующие" гомогенные анализы. Например, изобретение относится к способам определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, включающим этапы: (a) преинкубации образца, который может содержать антитело против лекарственного средства, с (i) мутантным терапевтическим антителом против IgE и (ii) полипептидом FcεRIα, связывающимся с Fc-областью IgE (таким как полипептид FcεRIα, содержащий внеклеточный домен субъединицы FcεRIα); (b) фиксации мутантного терапевтического антитела на этапе (a) на поверхности; и (c) определения связывания антитела против лекарственного средства с мутантным терапевтическим антителом.

"Блокирующие" полугомогенные анализы также можно применять для определения антител изотипа IgE против лекарственного средства в образце от индивидуума. Например, изобретение относится к способам определения антитела изотипа IgE против лекарственного средства, связывающегося с терапевтическим антителом против IgE, в образце, включающим этапы: (a) преинкубации образца, который может содержать антитело против лекарственного средства, с полипептидом FcεRIα, связывающимся с Fc-областью IgE, (b) инкубации преинкубированного образца из этапа (a) с терапевтическим антителом против IgE или его мутантом; и (c) определения связывания антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным антителом. Мутантное терапевтическое антитело можно фиксировать на поверхности до или после инкубации с преинкубированным образцом.

В некоторых вариантах осуществления в блокирующих анализах образец преинкубируют с избыточным количеством полипептида FcεRIα. Как применяют в настоящем документе, "избыточное" количество полипептида FcεRIα означает, что добавляемое количество полипептида FcεRIα выше наибольшего уровня исходного общего IgE, ожидаемого в образце. Например, исходный общий IgE может составлять от 30 МЕ/мл до 700 МЕ/мл для пациентов с массой тела 30-150 кг. В некоторых вариантах осуществления добавляемое количество полипептида FcεRIα составляет по меньшей мере приблизительно 2-кратное, по меньшей мере приблизительно 3-кратное, по меньшей мере приблизительно 4-кратное, по меньшей мере приблизительно 5-кратное, по меньшей мере приблизительно 6-кратное, по меньшей мере приблизительно 7-кратное, по меньшей мере приблизительно 8-кратное, по меньшей мере приблизительно 9-кратное или по меньшей мере 10-кратное количество общего IgE в образце. В некоторых вариантах осуществления мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE снижена по сравнению с относительной аффинностью связывания терапевтического антитела против IgE с IgE. В некоторых вариантах осуществления относительная аффинность связывания мутантного терапевтического антитела с IgE составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE. Можно применять любые описываемые в настоящем документе мутантные терапевтические антитела.

В некоторых вариантах осуществления способ включает этапы: 1) преинкубации образца от индивидуума, который может содержать антитела изотипа IgE против лекарственного средства, с меченым мутантным терапевтическим антителом в присутствии по меньшей мере приблизительно 10-кратного избытка немеченого или меченого полипептида FcεRIα; 2) инкубации преинкубированного образца с иммобилизированной молекулой (такой как стрептавидин), связывающейся с меткой (такой как биотин) на мутантном терапевтическом антителе; и 3) определения связывания антител изотипа IgE против лекарственного средства с мутантным терапевтическим антителом с применением средства детекции (такого как меченое антитело против IgE человека или меченое антитело, специфичное к метке на полипептиде FcεRI). Для удаления несвязавшихся с твердой фазой молекул (таких как эндогенный неспецифичный к лекарственному средству IgE) между этапами инкубации включают этапы промывки. Примеры таких анализов представлены на фигурах 12, 13 и 14.

В некоторых вариантах осуществления способ включает этапы: 1) инкубации образца от индивидуума, который может содержать антитела изотипа IgE против лекарственного средства, с по меньшей мере приблизительно 10-кратным избытком немеченого или меченого полипептида FcεRIα; 2) инкубации преинкубированного образца из этапа 1) с иммобилизированным терапевтическим антителом против IgE или иммобилизированным мутантным терапевтическим антителом; 3) определения связывания антител изотипа IgE против лекарственного средства с терапевтическим антителом или мутантным терапевтическим антителом с применением средства детекции (такого как меченое антитело против IgE человека или меченое антитело, специфичное к метке на полипептиде FcεRIα, связывающимся с Fc-областью IgE). Для удаления несвязавшихся с твердой фазой молекул (таких как эндогенный неспецифичный к лекарственному средству IgE) между этапами инкубации включают этапы промывки. Примеры таких анализов представлены на фигурах 15, 16 и 17.

В любых описываемых в настоящем документе способах терапевтическое антитело против IgE или мутантное антитело может содержать метку, или его можно конъюгировать с меткой. В некоторых вариантах осуществления способы включают этап фиксации меченого терапевтического антитела против IgE или мутантного антитела на поверхности до определения связывания антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным антителом, где средство фиксации, специфически связывающееся с меткой, иммобилизируют на поверхности. Можно применять любые описываемые в настоящем документе твердые фазы или поверхности (такие как небольшие листы, сефадекс, поливинилхлорид, пластиковые бусы, микрочастицы, планшеты для анализа или пробирки, производимые из полиэтилена и полистирола). В некоторых вариантах осуществления поверхность является полимерной целлюлозной губкой (ImmunoCAP®, Phadia). В некоторых вариантах осуществления поверхность не является полимерной целлюлозной губкой (ImmunoCAP®, Phadia). В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное антитело метят биотином, и средством фиксации является стрептавидин. В некоторых вариантах осуществления полипептид FcεRIα содержит метку, и связывание антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным антителом определяют посредством определения связывания полипептида FcεRIα с антителом против лекарственного средства.

В некоторых вариантах осуществления описываемых в настоящем документе способов полипептид FcεRIα применяют в качестве средства детекции для определения связывания антител против лекарственного средства с терапевтическим антителом против IgE или мутантным терапевтическим антителом. В некоторых вариантах осуществления полипептид FcεRIα содержит метку, или его конъюгируют с меткой. В некоторых вариантах осуществления метка на полипептиде FcεRIα является дигоксигенином, и связывание полипептида FcεRIα с антителом против лекарственного средства определяют с применением конъюгированного с HRP антитела против дигоксигенина. В некоторых вариантах осуществления метка на полипептиде FcεRIα является рутением, и связывание полипептида FcεRIα с антителом против лекарственного средства определяют с применением электрохемилюминесценции.

В некоторых вариантах осуществления описываемых в настоящем документе способов полипептид FcεRIα применяют в качестве блокирующего средства для блокирования связывания неспецифичного к лекарственному средству IgE в образце с терапевтическим антителом против IgE или мутантным терапевтическим антителом. В некоторых вариантах осуществления связывание антитела против лекарственного средства с терапевтическим антителом против IgE или мутантным антителом определяют посредством определения с применением конъюгированного с HRP антитела против IgE человека.

Образцы, которые можно применять в описываемых в настоящем документе способах, включают образцы крови от индивидуума до лечения терапевтическим антителом против IgE или после лечения терапевтическим антителом против IgE. В некоторых вариантах осуществления образцы крови собирают у индивидуумов, прерывавших лечение антителом против IgE по меньшей мере в течение 16 недель. В некоторых вариантах осуществления образцы крови собирают у индивидуумов, прерывавших лечение антителом против IgE по меньшей мере в течение 16 недель, но не более чем 18 месяцев с момента введения последних доз терапевтического антитела против IgE. В некоторых вариантах осуществления образцы являются образцами сыворотки или плазмы. Образцы сыворотки или плазмы можно получать с применением стандартной технологии, известной в данной области.

Положительный контроль можно применять для разработки анализа, оценки чувствительности анализа и устойчивости к лекарственному средству и/или применять в качестве контроля для анализа. Положительный контроль можно применять в любых описываемых в настоящем документе способах. В некоторых вариантах осуществления анализ включает тестирование антитела положительного контроля против лекарственного средства. Можно применять антитело положительного контроля, связывающееся и с терапевтическим антителом против IgE, и с мутантным терапевтическим антителом. В некоторых вариантах осуществления антитело положительного контроля против лекарственного средства связывается с Fab-фрагментом антитела против IgE. В некоторых вариантах осуществления антитело положительного контроля против лекарственного средства связывается с одной или несколькими CDR антитела против IgE. В некоторых вариантах осуществления антитело положительного контроля связывается и с терапевтическим антителом против IgE, и с мутантным терапевтическим антителом со схожей аффинностью. В некоторых вариантах осуществления относительная аффинность связывания антитела положительного контроля с терапевтическим антителом против IgE находится в диапазоне приблизительно 10-кратного, в диапазоне приблизительно 9-кратного, в диапазоне приблизительно 8-кратного, в диапазоне приблизительно 7-кратного, в диапазоне приблизительно 6-кратного, в диапазоне приблизительно 5-кратного, в диапазоне приблизительно 4-кратного, в диапазоне приблизительно 3-кратного или в диапазоне приблизительно 2-кратного различия по сравнению с относительной аффинностью связывания антитела положительного контроля с мутантным терапевтическим антителом. В некоторых вариантах осуществления различие между относительными аффинностями связывания антитела положительного контроля с терапевтическим антителом против IgE и с мутантным терапевтическим антителом составляет менее чем приблизительно 50%, менее чем приблизительно 40%, менее чем приблизительно 30%, менее чем приблизительно 20% и/или менее чем приблизительно 10%. Например, антитело положительного контроля является химерным антителом, содержащим вариабельные области из антитела против лекарственного средства (включая CDR-специфичное антитело против лекарственного средства) и константные области из IgE (такого как IgE человека). В некоторых вариантах осуществления антитело положительного контроля против лекарственного средства является антителом мыши против омализумаба (E25). Примеры антител против E25, которые можно применять в качестве положительного контроля (такие как AME2), описывают в примере 2. В некоторых вариантах осуществления определяют и сравнивают связывание антител против лекарственного средства в образце с иммобилизированным мутантным антителом и связывание антитела положительного контроля с иммобилизированным мутантным антителом.

Последовательности аминокислот и нуклеиновой кислоты вариабельных областей тяжелой и легкой цепи антитела AME2 представлены ниже.

Аминокислотная последовательность вариабельной области тяжелой цепи AME2 (SEQ ID NO:7)

Аминокислотная последовательность вариабельной области легкой цепи AME2 (SEQ ID NO:8)

Последовательность нуклеиновой кислоты вариабельной области тяжелой цепи AME2 (SEQ ID NO:9)

Последовательность нуклеиновой кислоты вариабельной области легкой цепи AME2 (SEQ ID NO:10)

В некоторых вариантах осуществления вариабельная область тяжелой цепи антитела AME2 слита с константной областью тяжелой цепи IgE человека и вариабельная область легкой цепи антитела AME2 слита с константной областью легкой цепи IgE человека для образования химерного антитела. Например, в химерном антителе можно применять следующие константные области тяжелой и легкой цепи IgE человека.

Аминокислотная последовательность константной области тяжелой цепи IgE человека (SEQ ID NO:29)

Аминокислотная последовательность константной области легкой цепи IgE человека (SEQ ID NO:30)

В некоторых вариантах осуществления реагент для фиксации (например, мутантное антитело, антитело против IgE, полипептид FcεRIα или стрептавидин) иммобилизируют на твердой фазе посредством понижения растворимости реагента для фиксации до анализа, например, посредством адсорбции на водонерастворимой матрице или поверхности (патент США № 3720760) или нековалентным или ковалентным соединением, например, с применением перекрестного сшивания глутаральдегидом или карбодиимидом, с предшествующей активацией подложки, например, азотной кислотой и восстановителем или без нее, как описано в патенте США № 3645852 или в Rotmans et al., 1983, J. Immunol. Methods, 57:87-98, или после анализа. В некоторых вариантах осуществления реагент для фиксации (например, мутантное антитело) после иммобилизации способен связывать молекулу-мишень (например, антитела против лекарственного средства) из образца.

Применяемая для иммобилизации твердая фаза или поверхность может являться любой инертной подложкой или носителем, по существу водонерастворимыми и применимыми в иммунологических анализах, включая подложки в форме, например, поверхностей, частиц, пористых матриц, полимерной целлюлозной губки (ImmunoCAP®, Phadia) и т.п. Примеры общеупотребительных подложек включают небольшие листы, сефадекс, поливинилхлорид, пластиковые бусы, микрочастицы, планшеты для анализа или пробирки, производимые из полиэтилена, полипропилена, полистирола и т.п. В некоторых вариантах осуществления твердая фаза или поверхность является полимерной целлюлозной губкой (ImmunoCAP®, Phadia). В некоторых вариантах осуществления твердая фаза или поверхность не является полимерной целлюлозной губкой (ImmunoCAP®, Phadia). Такие подложки включают 96-луночные планшеты для микротитрования, а также дисперсные материалы, такие как фильтровальная бумага, агароза, декстран с поперечными сшивками и другие полисахариды. Альтернативно, реагирующие водонерастворимые матрицы, такие как цианогенные активируемые бромидом углеводы, и реагирующие субстраты, описываемые в патентах США №№ 3969287; 3691016; 4195128; 4247642; 4229537 и 4330440, соответствующим образом применяют для иммобилизации реагента для фиксации. В варианте осуществления планшет для микротитрования покрывают иммобилизированным реагентом для фиксации. Предпочтительной твердой фазой является многолуночный планшет для микротитрования, который можно применять для одновременного анализа нескольких образцов.

Твердую фазу покрывают реагентом для фиксации (таким как описываемое в настоящем документе мутантное терапевтическое антитело), который можно связывать нековалентным или ковалентным взаимодействием или физической связью, по желанию. Техники для прикрепления включают описываемые в патенте США № 4376110 и цитируемые в них ссылки. Если применяют ковалентное прикрепление реагента для фиксации на планшет, планшет или другую твердую фазу можно инкубировать со сшивающим средством совместно с реагентом для фиксации. Общеупотребительные сшивающие средства для прикрепления реагента для фиксации на субстрате твердой фазы включают, например, 1,1-бис(диазоацетил)-2-фенилэтан, глутаральдегид, сложные эфиры N-гидроксисукцинимида, например, сложные эфиры с 4-азидосалициловой кислотой, гомобифункциональные имидоэфиры, включая дисукцинимидиловые сложные эфиры, такие как 3,3’-дитиобис(сукцинимидилпропионат), и бифункциональные малеимиды, такие как бис-N-малеимидо-1,8-октан. Средства для получения производных, такие как метил-3-[(п-азидофенил)дитио]пропиоимидат, вызывают образование фотоактивируемых продуктов, способных образовывать перекрестные сшивки в присутствии света.

Если применяют полистироловые планшеты, лунки планшета предпочтительно покрывают реагентом для фиксации (как правило, разведенном в буфере, таком как 0,05 M карбонат натрия или 0,15 M фосфатно-солевой буфер (PBS), pH 7,2 или 7,4), посредством инкубации в течение по меньшей мере приблизительно 10 часов, более предпочтительно - по меньшей мере в течение ночи, при температурах приблизительно 4-20°C, более предпочтительно - приблизительно 4-8°C, и при pH приблизительно 8-12, более предпочтительно - приблизительно 9-10, и наиболее предпочтительно приблизительно - 9,6. Если желательны более короткие периоды покрытия (1-2 часа), планшет покрывают при 37°C, или применяют планшеты с дном из нитроцеллюлозного фильтра, например, Millipore MULTISCREEN™. Планшеты можно складывать и покрывать перед анализом, делая возможным иммунологический анализ, проводимый одновременно на нескольких образцах вручную, полуавтоматическим или автоматическим образом, например, с применением робототехнического оборудования. Полистироловые планшеты можно покрывать стрептавидином с применением описываемого выше способа.

Покрытые планшеты, как правило, обрабатывают блокирующим средством, неспецифически связывающимся с участками связывания и насыщающим их для предотвращения нежелательного связывания свободных молекул аналита с избытком участков связывания в лунках планшета. Примеры подходящих блокирующих средств включают, например, желатин, бычий сывороточный альбумин, яичный альбумин, казеин и нежирное молоко. Как правило, блокирование проводят в условиях температуры окружающей среды в течение приблизительно 1-4 часов, предпочтительно - приблизительно от 1,5 до 3 часов.

После нанесения покрытия и блокирования подлежащий анализу образец разводят по мере необходимости и добавляют к иммобилизированной фазе. Предпочтительная степень разбавления составляет приблизительно 5-15%, предпочтительно - приблизительно 10% по объему. Буферы, которые можно применять для разбавления, включают, например, (a) фосфатно-солевой буфер (PBS), содержащий 0,5% BSA, 0,05% TWEEN 20™, детергент (P20), 5 мМ ЭДТА, 0,25% поверхностно-активного вещества Chaps, 0,2% бета-гамма глобулина и 0,35 M NaCl, pH 7,0; (b) PBS, содержащий 0,5% BSA и 0,05% P20; (c) PBS, содержащий 0,5% BSA, 0,05% P20, 5 мМ ЭДТА и 0,35 M NaCl, pH 6,35; (d) PBS, содержащий 0,5% BSA, 0,05% P20, 5 мМ ЭДТА, 0,2% бета-гамма глобулина и 0,35 M NaCl; (e) PBS, содержащий 0,5% BSA, 0,05% P20, 5 мМ ЭДТА, 0,25% Chaps и 0,35 M NaCl; и (f) PBS, содержащий 0,5% P20.

Для достаточной чувствительности, предпочтительно, чтобы иммобилизированный реагент для фиксации находился в молярном избытке относительно максимальной молярной концентрации аналита (такого как антитела изотипа IgE против лекарственного средства), предполагаемой в образце после соответствующего разведения. В зависимости от аналита реагент для фиксации может конкурировать за участки связывания с антителом для детекции, давая неточные результаты. Таким образом, конечную концентрацию реагента для фиксации, как правило, будут определять эмпирически для максимизации чувствительности анализа в интересующем диапазоне.

В некоторых вариантах осуществления система анализа обладает чувствительностью к IgE против лекарственного средства приблизительно от 0,1 МЕ/мл до приблизительно 0,5 МЕ/мл (например, приблизительно 0,1 МЕ/мл, приблизительно 0,2 МЕ/мл, приблизительно 0,3 МЕ/мл, приблизительно 0,4 МЕ/мл или приблизительно 0,5 МЕ/мл). В некоторых вариантах осуществления система анализа обладает устойчивостью к общему IgE 700 МЕ/мл или выше. В некоторых вариантах осуществления система анализа обладает устойчивостью к общему IgE 800 МЕ/мл или выше. В некоторых вариантах осуществления система анализа обладает устойчивостью к лекарственному средству (такой как устойчивость к омализумабу) по меньшей мере приблизительно 50 нг/мл (например, приблизительно от 50 нг/мл до приблизительно 200 нг/мл). В некоторых вариантах осуществления устойчивость системы анализа к лекарственному средству составляет по меньшей мере приблизительно 50 нг/мл, по меньшей мере приблизительно 75 нг/мл, по меньшей мере приблизительно 100 нг/мл, по меньшей мере приблизительно 125 нг/мл или по меньшей мере приблизительно 150 нг/мл.

Условия инкубации образца и реагента для фиксации выбирают для максимизации чувствительности анализа и для минимизации диссоциации. Время инкубации зависит, главным образом, от температуры. Например, время инкубации составляет приблизительно от 0,5 до 3 часов (включая 1,5-3 часа) при 20-38°C (включая 36-38°C) или в течение ночи при комнатной температуре. Для максимизации чувствительности IgE против лекарственного средства и устойчивости анализа к лекарственному средству против IgE, по возможности, применяют время инкубации больше чем приблизительно 10 часов. Если образец является биологической жидкостью (такой как кровь или сыворотка), время инкубации можно увеличивать добавлением к образцу ингибитора протеазы для предотвращения деградации аналита протеазами в биологической жидкости.

pH буфера для инкубации выбирают для поддержания значимого уровня специфичного связывания реагента для фиксации с фиксированным аналитом. В некоторых вариантах осуществления pH буфера для инкубации составляет приблизительно 6-9,5 (включая pH приблизительно 6-7). В некоторых вариантах осуществления pH буфера для инкубации составляет приблизительно 7,2. Для достижения и поддержания желательного pH в течение данного этапа можно применять различные буферы, включая боратный, фосфатный, карбонатный, Трис-HCl или Tns-фосфатный, ацетатный, барбитуратный и т.п. Как правило, конкретный применяемый буфер не является критичным, однако, и в отдельных анализах один буфер может быть предпочтительнее другого.

Образец отделяют от иммобилизированного реагента для фиксации промывочным раствором для удаления нефиксированного аналита (такого как антитела против лекарственного средства) из системы. Как правило, промывочный раствор является буфером. Описываемые выше буферы для инкубации являются подходящими промывочными растворами. pH промывочного раствора определяют, как описано выше для буфера для инкубации. В варианте осуществления pH промывочного раствора составляет приблизительно 6-9, более предпочтительно - приблизительно 6-7. Промывки можно осуществлять один или несколько раз. Однако минимизация числа промывок для сохранения молекул, связывающих молекулу-мишень с низкой аффинностью, повышает фоновые помехи анализа. В некоторых вариантах осуществления систему промывают три раза. Как правило, температура промывочного раствора составляет приблизительно 0-40°C, более предпочтительно - приблизительно 4-30°C. Можно применять автоматический промыватель планшетов. Для ковалентного прикрепления фиксированного аналита к реагенту для фиксации сшивающее средство или другое подходящее средство можно добавлять к промывочному раствору.

После удаления нефиксированных молекул аналита из системы фиксированные молекулы аналита приводят в контакт со средством детекции, таким как антитело или полипептид FcεRIα, например, при температуре приблизительно 20-40°C, приблизительно 36-38°C, или комнатной температуре. В некоторых вариантах осуществления аналит является антителом изотипа IgE против лекарственного средства, средство детекции является меченым химерным рецептором FcεRIα-IgG.

Температура и время контакта молекулы аналита со средством детекции, главным образом, зависит от применяемых средств детекции. Например, если в качестве средства детекции применяют пероксидазу хрена (HRP), конъюгированную со стрептавидином (SA-HRP), средство детекции, предпочтительно, инкубируют с фиксированным аналитом в течение приблизительно 0,5-2 часов, более предпочтительно - приблизительно 1 часа. Систему промывают, как описано выше, для удаления несвязавшегося средства детекции из системы и обрабатывают добавлением субстрата пероксидазы и инкубацией планшета в течение приблизительно 15 минут при комнатной температуре или до достижения хорошего окрашивания. В варианте осуществления молярный избыток средства детекции добавляют в систему после промывки несвязавшегося аналита из системы.

Аффинность средства детекции должна являться достаточно высокой, чтобы определять небольшие количества аналита. Средство флуориметрического или хемилюминесцентного мечения обладает большей чувствительностью в иммунологических анализах по сравнению с общепринятой колориметрической меткой. Аффинность связывания выбранного средства детекции необходимо учитывать, принимая во внимание аффинность связывания средства фиксации, чтобы средство детекции не удаляло аналит из реагента для фиксации.

Средство мечения является любой определяемой функциональной группой, не мешающей связыванию фиксированного аналита со средством детекции. Примеры подходящих средств мечения включают средства, которые можно определять напрямую, такие как флуорохром, хемилюминесцентные и радиоактивные метки, а также средства, такие как ферменты, которые должны прореагировать или образовывать производное, чтобы их определяли. Примеры таких меток включают радиоактивные изотопы 32P, 14C, 125I, 3H и 131I, флуорофоры, такие как хелаты редкоземельных металлов или флуоресцеин и его производные, родамин и его производные, дансил, умбеллиферон, люциферазы, например, люцифераза светлячка и бактериальная люцифераза (патент США № 4737456), люциферин, 2,3-дигидрофталазиндионы, пероксидазу хрена (HRP), щелочную фосфатазу, бета-галактозидазу, глюкоамилазу, лизоцим, оксидазы сахаридов, например, глюкозоксидазу, галактозоксидазу и глюкоза-6-фосфатдегидрогеназу, гетероциклические оксидазы, такие как уриказа и ксантиноксидаза, соединенные с ферментом, использующим пероксид водорода для окисления предшественника красителя, такого как HPP, лактопероксидазу или микропероксидазу, биотин/авидин, биотин/стрептавидин, биотин/стрептавидин-бета-галактозидазу с MUG, дигоксигенин, рутений, спиновые метки, бактериофаговые метки, стабильные свободные радикалы и т.п.

Конъюгация средства мечения со средством детекции, таким как, например, антитело или полипептид FcεRIα, является стандартным способом иммунологического анализа. См., например, O’Sullivan et al. "Methods for Preparation of Enzyme-antibody Conjugates for Use in Enzyme Immunoassay" в Methods in Enzymology, ed. J. J. Langone and H. Van Vunakis, Vol. 73 (Academic Press, New York, N.Y., 1981), pp. 147-166. Доступны общепринятые способы ковалентного связывания средства мечения с белками или полипептидами. Например, для мечения антител описываемыми выше флуоресцентными, хемилюминесцентными и ферментными метками можно применять связующие средства, такие как диальдегиды, карбодиимиды, дималеимиды, бис-имидаты, бис-диазотированный бензидин и т.п. См., например, патент США № 3940475 (флуориметрия) и патент США № 3645090 (ферменты); Hunter et al., 1962, Nature, 144:945; David et al., 1974, Biochemistry, 13:1014-1021; Pain et al., 1981, J. Immunol Methods, 40:219-230; and Nygren J., 1982, Histochem. and Cytochem., 30:407-412. Предпочтительные в настоящем документе метки являются флуоресцентными или хемилюминесцентными для повышения амплификации и чувствительности до приблизительно 5-10 пг/мл. В варианте осуществления средство мечения является HRP.

Количество аналита, связавшегося с реагентом для фиксации, определяют промывкой несвязавшегося средства детекции от иммобилизированной фазы и измерением количества средства детекции, связавшегося с аналитом с применением способа определения, соответствующего метке. В варианте осуществления средство мечения является ферментом. В случае ферментных средств мечения, степень проявившегося цвета является прямым измерением количества фиксированного аналита. Например, если HRP является средством мечения, цвет определяют количественным анализом оптической плотности (O.D.) поглощения (например, при 450 нм). В другом варианте осуществления количество аналита, связавшегося с реагентом для фиксации, определяют косвенно. Сигнал немеченого средства детекции можно усиливать для определения посредством антитела против средства детекции, конъюгированным со средством мечения. Например, сигнал немеченого антитела мыши, связывающегося с молекулой-мишенью, можно усиливать антителом IgG овцы против мыши, меченным HRP. Средство мечения определяют с применением способа определения, соответствующего метке. Например, HRP можно определять посредством реакции HRP с калориметрическим субстратом и измерения оптической плотности поглощения прореагировавшего субстрата при 450 нм.

Для идентификации молекул, связывающихся с молекулой-мишенью, можно варьировать pH и/или температуру системы.

Способы оценки или облегчения оценки риска анафилаксии на лечение терапевтическим антителом против IgE

Описываемые в настоящем документе способы можно применять для оценки или облегчения оценки риска анафилактической реакции на введение терапевтического антитела против IgE. Описываемые в настоящем документе способы также можно применять для идентификации пациентов, имеющих риск анафилактической реакции на введение терапевтического антитела против IgE.

Собирают образцы крови пациентов, подвергнутых лечению терапевтическим антителом против IgE (таким как E25, омализумаб), с анафилаксией и пациентов без реакций гиперчувствительности. Собирают данные, включая истории болезни, результаты кожных аллергических тестов и исследований иммуногенности. Количество антител изотипа IgE против лекарственного средства в образцах тестируют с применением описываемых в настоящем документе анализов. Устанавливают корреляцию между кожным аллергическим тестом, анафилаксией и уровнем антител изотипа IgE против лекарственного средства. Образцы будут собирать после анафилаксии или после того, как все участники, включая контроли, прервут лечение средствами против IgE по меньшей мере на 16 недель, но не более чем 18 месяцев. Установленную корреляцию можно применять для определения референсного уровня и можно применять для оценки или облегчения оценки риска анафилаксии на терапевтическое антитело против IgE до лечения пациента терапевтическим антителом против IgE.

В одном из аспектов изобретение относится к способу оценки или облегчения оценки риска анафилактической реакции у пациента на введение терапевтического антитела против IgE, включающему этапы: a) определения уровня антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE в образце от пациента до лечения антителом против IgE; и b) сравнения уровня, определяемого на этапе a), с референсным уровнем. В некоторых вариантах осуществления пациентов, имеющих уровень антитела изотипа IgE против лекарственного средства выше, чем референсный уровень, исключают из лечения антителом против IgE.

В другом аспекте изобретение относится к способам идентификации пациента, имеющего риск анафилактической реакции на терапевтическое антитело против IgE, включающим определение наличия и/или уровня антител изотипа IgE против лекарственного средства в образце от пациента с применением любых описываемых в настоящем документе способов, где наличие и/или уровень антитела против лекарственного средства в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

Способы лечения IgE-опосредованных нарушений

Антитела изотипа IgE против лекарственного средства у пациента можно оценивать с применением описываемых в настоящем документе способов анализа до или после лечения пациента антителом против IgE. Изобретение относится к способу лечения IgE-опосредованных нарушений у индивидуума антителом против IgE, включающему сравнение уровня антител изотипа IgE против лекарственного средства в образце от индивидуума с референсным уровнем; и введение индивидууму эффективного количества антитела против IgE, если уровень антител против лекарственного средства в образце ниже, чем референсный уровень. В одном из аспектов изобретение относится к способу идентификации пациента, обладающего высоким риском анафилаксии, включающему сравнение уровня антител изотипа IgE против лекарственного средства в образце от индивидуума с референсным уровнем, где индивидуума идентифицируют как обладающего высоким риском анафилаксии, если уровень антител против лекарственного средства в образце выше, чем референсный уровень. В другом аспекте изобретение относится к способам лечения пациента, имеющего IgE-опосредованное нарушение, включающим этапы: (a) определения уровня антитела изотипа IgE против лекарственного средства к терапевтическому антителу против IgE в образце от пациента с применением любых описываемых в настоящем документе способов; (b) введения пациенту эффективного количества терапевтического антитела против IgE, если уровень антитела против лекарственного средства в образце не свидетельствует о том, что пациент обладает риском анафилактической реакции на терапевтическое антитело против IgE.

Для предотвращения или лечения IgE-опосредованных нарушений соответствующая дозировка антитела против IgE будет зависеть от типа подвергаемого лечению заболевания, тяжести и течения заболевания, вводят ли антитело против IgE в профилактических или терапевтических целях, предшествующей терапии, истории болезни пациента и ответа на средство, и на усмотрение лечащего врача. Антитело против IgE соответствующим образом вводят пациенту единовременно или как серию введений. В некоторых вариантах осуществления антитело против IgE является омализумабом. Антитело против IgE может находиться в жидких составах, или его можно получать из лиофилизированных составов. Подходящие для антител против IgE составы описывают в патенте США № 6875432; и патентных публикациях США №№ 2004/0197324 и 2005/0158303.

Антитело против IgE вводят нуждающемуся в лечении индивидууму, предпочтительно человеку, в соответствии с известными способами, такими как внутривенное введение в виде болюса или непрерывное вливание в течение периода времени, внутримышечным, интраперитонеальным, интрацереброспинальным, подкожным, внутрисуставным (intra-articular), внутрисуставным (intrasynovial), интратрахеальным, пероральным, местным или ингаляционным путями.

IgE-опосредованные нарушения включают аллергические риниты, астму (например, аллергическую астму и неаллергическую астму), атопический дерматит, аллергическую гастроэнтеропатию, гиперчувствительность (например, анафилаксию, крапивницу, пищевые аллергии и т.д.), аллергический бронхолегочный аспергиллез, паразитарные заболевания, интерстициальный цистит, синдром гипериммуноглобулинемии E, атаксию-телеангиэктазию, синдром Вискотта-Олдрича, тяжелый комбинированный иммунодефицит, IgE-миелома и реакцию трансплантат против хозяина. В еще одном конкретном дополнительном аспекте IgE-опосредованное нарушение является пищевой аллергией, анафилаксией, контактным дерматитом и аллергической пурпурой.

IgE-опосредованные нарушения, которые можно лечить способом по изобретению, также включают атаксию-телеангиэктазию, синдром Черджа-Стросса, экзему, энтериты, гастроэнтеропатию, реакцию трансплантат против хозяина, синдром гипериммуноглобулинемии E (синдром Джобса), гиперчувствительность (например, анафилактическую гиперчувствительность, кандидоз, васкулит), IgE-миелому, воспалительное заболевание кишечника (например, болезнь Крона, язвенный колит, неопределенный колит и инфекционный колит), мукозит (например, мукозит слизистой оболочки полости рта, мукозит желудочно-кишечного тракта, назальный мукозит и проктит), некротический энтероколит и эзофагит, паразитарные заболевания (например, трипаносомоз), лейкоцитокластический васкулит, крапивницу и Синдром Вискотта-Олдрича.

IgE-опосредованные нарушения, которые можно лечить способом по изобретению, также включают болезнь Аддисона (хроническую недостаточность коры надпочечников), алопецию, наследственный ангионевротический отек, ангионевротический отек (болезнь Баннистера, ангионевротический отек), анкилозирующий спондилит, апластическую анемию, артериит, амилоидоз, иммунологические нарушения, такие как аутоиммунная гемолитическая анемия, аутоиммунный оофорит, аутоиммунный орхит, аутоиммунная полиэндокринопатия, аутоиммунная гемолитическая анемия, аутоиммунная цитопения, аутоиммунный гломерулонефрит, болезнь Бехчета, бронхит, облитерирующий тромбангиит, буллезный пемфигоид, синдром Каплана (ревматоидный пневмокониоз), кардит, целиакию-спру, синдром Чедиак-Хигаши, хроническую обструктивную болезнь легких (COPD), синдром Когана-Риза (иридокорнеальный эндотелиальный синдром), CREST-синдром, герпетиформный дерматит (болезнь Дюринга), сахарный диабет, эозинофильный фасцит, эозинофильный нефрит, эписклерит, экзогенный аллергический альвеолит, периодическую болезнь, синдром Фелти, фиброзирующий альвеолит, гломерулонефрит, синдром Гудпасчера, гранулоцитопению, гранулему, гранулематоз, гранулематозный миозит, болезнь Грейвса, синдром Гийена-Барре (полиневрит), тиреоидит Хашимото (хронический лимфоматозный тиреоидит), гемохроматоз, гистиоцитоз, гиперэозинофильный синдром, синдром раздраженного кишечника, ювенильный артрит, кератит, проказу, красную волчанку, синдром Лайелла, болезнь Лайма, смешанную болезнь соединительной ткани, мононеврит, множественный мононеврит, синдром Макла-Уэлса, кожно-слизистый лимфатический синдром (синдром Кавасаки), множественный ретикулогистиоцитоз, рассеянный склероз, миастению gravis, фунгоидный микоз, панникулит, пемфигоид, пемфигус, перикардит, полиневрит, узелковый полиартериит, псориаз, псориатический артрит, легочный артериит, аденоматоз легких, легочный фиброз, рецидивирующий полихондрит, острую ревматическую лихорадку, ревматоидный артрит, риносинусит (синусит), саркоидоз, склерит, склерозирующий холангит, сывороточную болезнь, синдром Сезари, синдром Шегрена, синдром Стивенса-Джонсона, системный мастоцитоз, отторжение трансплантата, тромбоцитопеническую пурпуру, тяжелый комбинированный иммунодефицит, увеит, витилиго, гранулематоз Вегенера.

IgE-опосредованные нарушения можно лечить антителом против IgE в сочетании с известными способами лечения IgE-опосредованных нарушений в качестве комбинированных или дополнительных этапов лечения или в качестве дополнительных компонентов терапевтического состава. Например, лечение включает антитело против IgE в сочетании с антигистаминным средством, симпатомиметиком, бронходилататором, глюкокортикоидом, нестероидным противовоспалительным лекарственным средством, антиконгестантом, средством от кашля или анальгетиком. В другом конкретном аспекте антитело против IgE вводят в сочетании со схемой лечения покрытия аллергеном.

D. Наборы

Изобретение также относится к наборам для применения в описываемых в настоящем документе способах.

В одном из аспектов изобретение относится к наборам для определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце, содержащим мутантное терапевтическое антитело, содержащее по меньшей мере одну мутацию аминокислоты из терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE (таким как IgE человека) составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE. В некоторых вариантах осуществления наборы дополнительно содержат средство детекции, связывающееся с Fc-областью IgE человека (такое как описываемый в настоящем документе полипептид FcεRIα).

В другом аспекте изобретение относится к наборам для определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце, содержащим мутантное терапевтическое антитело, содержащее по меньшей мере одну мутацию аминокислоты из терапевтического антитела против IgE, где активность мутантного терапевтического антитела по отношению к IgE составляет приблизительно 10% или менее от активности терапевтического антитела против IgE по отношению к IgE. В некоторых вариантах осуществления наборы дополнительно содержат средство детекции, связывающееся с Fc-областью IgE человека (такое как описываемый в настоящем документе полипептид FcεRIα).

В другом аспекте изобретение относится к наборам для определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце, содержащим (a) мутантное терапевтическое антитело, содержащее по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE (таким как IgE человека) составляет приблизительно 10% или менее от относительной аффинности связывания терапевтического антитела против IgE с IgE; и (b) полипептид FcεRIα, связывающийся с Fc-областью IgE человека.

В другом аспекте изобретение относится к наборам для определения антител изотипа IgE против лекарственного средства, связывающихся с терапевтическим антителом против IgE, в образце, содержащим (a) терапевтическое антитело против IgE или его мутантное терапевтическое антитело, где мутантное терапевтическое антитело содержит по меньшей мере одну мутацию аминокислоты терапевтического антитела против IgE, где относительная аффинность связывания мутантного терапевтического антитела с IgE (таким как IgE человека) снижена по сравнению с относительной аффинностью связывания терапевтического антитела против IgE с IgE; и (b) полипептид FcεRIα, связывающийся с Fc-областью IgE человека.

В некоторых вариантах осуществления наборы дополнительно содержат антитело положительного контроля, связывающееся и с терапевтическим антителом против IgE, и с мутантным терапевтическим антителом. В некоторых вариантах осуществления антитело положительного контроля связывается и с терапевтическим антителом против IgE, и с мутантным терапевтическим антителом со схожей аффинностью. В некоторых вариантах осуществления антитело положительного контроля содержит вариабельные области тяжелой и легкой цепей антитела, специфично связывающегося с Fab-фрагментом антитела против IgE, и константные области IgE человека. В некоторых вариантах осуществления антитело положительного контроля содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:7, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO:8. В некоторых вариантах осуществления антитело положительного контроля связывается с комплексом Fab-фрагмента антитела против IgE и IgE.

Реагенты наборов (такие как терапевтическое антитело против IgE, мутантное терапевтическое антитело, антитело положительного контроля и/или полипептид FcεRIα) могут находиться в контейнере. В некоторых вариантах осуществления терапевтическое антитело против IgE, мутантное терапевтическое антитело, антитело положительного контроля и/или полипептид FcεRIα содержат метку.

В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное терапевтическое антитело иммобилизируют прямо или косвенно на поверхности. В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное терапевтическое антитело конъюгируют с меткой (такой как биотин). В некоторых вариантах осуществления терапевтическое антитело против IgE или мутантное терапевтическое антитело конъюгируют с меткой, фиксируют на поверхности посредством иммобилизированного средства фиксации, специфически связывающегося с меткой. В некоторых вариантах осуществления метка является биотином, и средство фиксации является стрептавидином.

В некоторых вариантах осуществления средство детекции или полипептид FcεRIα конъюгируют с меткой (такой как биотин, дигоксигенин или рутений). В некоторых вариантах осуществления средство детекции является меченым полипептидом FcεRI. В некоторых вариантах осуществления набор дополнительно содержит стрептавидин-HRP или Amdex SA-HRP. В некоторых вариантах осуществления набор дополнительно содержит конъюгированное с HRP антитело против дигоксигенина для определения меченного дигоксигенином полипептида FcεRI. В некоторых вариантах осуществления набор дополнительно содержит меченое антитело против IgE человека (такое как поликлональное антитело или моноклональное антитело). В некоторых вариантах осуществления меченое антитело против IgE человека является конъюгированным с HRP антителом против IgE человека.

Наборы по изобретению могут дополнительно содержать любые инструкции по применению в соответствии с любыми описываемыми в настоящем документе способами. В некоторых вариантах осуществления данные инструкции содержат описание тестирования количества антител изотипа IgE против лекарственного средства в образце от пациента в соответствии с любыми описываемыми в настоящем документе способами. Наборы могут дополнительно содержать описание оценки риска анафилаксии у пациента до лечения антителом против IgE. Инструкции можно предоставлять на ярлыке или вкладыше в упаковку. Наборы необязательно могут содержать дополнительные компоненты, такие как буферы и реагенты для осуществления описываемых в настоящем документе способов.

Наборы по изобретению находятся в подходящей упаковке. Подходящая упаковка включает, в качестве неограничивающих примеров, сосуды, бутыли, фляги, гибкую упаковку (например, запаиваемый майлар или пластиковые мешки) и т.п. Также включают упаковки для применения в сочетании с конкретным устройством, таким как устройство для определения сигнала в анализе ELISA.

Ниже приводят примеры способов и композиций по изобретению. Следует понимать, что можно практически осуществлять различные другие варианты осуществления с учетом приведенного выше общего описания.

ПРИМЕРЫ

Пример 1. Получение мутантного антитела из антитела против IgE омализумаба

Антитело омализумаб (E25 или rhuMAbE25) является гуманизированным антителом против IgE человека, описываемым в патентной публикации США № 2005/0158303 и патенте США № 6172213. Аминокислотные последовательности вариабельной области тяжелой и легкой цепи E25 представлены на фигуре 2 в патенте США № 6172213, и аминокислотные последовательности полноразмерных тяжелых и легких цепей E25 представлены на фигуре 12 в патенте США № 6172213. Аминокислотные последовательности тяжелой цепи и легкой цепи антитела E25 представлены на фигурах 1A и 1B. Получали мутантное E25, обозначаемое как мутантное E25-AAA, содержащее три замены аминокислот в CDR1 легкой цепи. Мутации являются заменами D на A в положениях 30, 32, 34, представленными в SEQ ID NO:1. Данное мутантное антитело описывают в Presta et al., J. Immunol. 151:2623-2632, 1993.

Аффинность связывания данного мутантного антитела с IgE человека тестировали относительно E25, как представлено на фигуре 2A. E25 или мутантное E25-AAA иммобилизировали на планшете для ELISA, повышающиеся концентрации очищенного IgE человека добавляли на планшет. Связывание IgE человека с E25 или с мутантным E25-AAA определяли конъюгированным с HRP антителом козы против IgE человека. Измеряли OD при 450 нм. Данные эксперименты осуществляли с применением известных способов. См., например, Engvall et al., Immunochemistry 8:871-4, 1971; Presta et al., J. Immunol. 151:2623-2632, 1993. Как показано на фигуре 2B, мутантное E25-AAA имеет приблизительно в 100 раз меньшую аффинность связывания с IgE человека, чем E25.

Для сравнения первичной структуры E25 с мутантным E25-AAA применяли пептидное картирование Lys-C. Фермент Lys-C применяли для расщепления таким образом, что все 3 замены аминокислот находились в одном пептиде (легкая цепь 1-43). Профили пептидного картирования демонстрировали только два различия пиков в мутанте, принадлежащие исчезнувшему родительскому пептиду LC 1-43, и новых пиков в E25 не было. Осуществляли LC-MS и массу, соответствующую новому пику в мутанте, подтверждали как LC 1-43 с 3 Ala, заменяющими 3 Asp. Таким образом, данный анализ подтверждал, что мутант имеет первичную структуру E25 за исключением 3 Ala, заменяющих 3 Asp в LC.

Также изучали распределение заряда мутантного E25-AAA. Распределение заряда моноклональных антител, как правило, специфично для молекулы. В данном случае замены аминокислот в мутанте значимо изменяют pI молекулы (от 7,6 до ~9), таким образом, время миграции мутанта сильно отличалось. Дополнительно, ожидают различия в профилях по причине замены Asp32, вносящей вклад в гетерогенность (оно изомеризуется) распределения заряда E25. Профили iCIEF (каппилярного изоэлектрофокусирования) для E25 и мутантного E25-AAA являлись схожими, хотя и не идентичными, со схожими количествами кислых и основных вариантов.

Пример 2. Сравнение связывания антител против лекарственного средства с E25 и мутантным E25-AAA

Получали специфичные к E25 моноклональные антитела мыши. Как показано в таблице 2 ниже, AME1, AME7, AME9, AME2, AME10, AME13, AME4 и AME5 являются антителами, связывающимися с E25. AME1, AME7, AME9, AME2, AME10, AME4 и AME5 являются IgG1 мыши, и AME13 является антителом IgG2 мыши. E25 является гуманизированным антителом, полученным из MAE11, как описано в примере 1 и Presta et al., J. Immunol. 151:2623-2632, 1993. MAE1 является контрольным моноклональным антителом против IgE человека и имеет различные CDR из MAE11. MAE 1 и MAE11 являются антителами IgG мыши. Контрольное антитело (полноразмерное) является антителом IgG с каркасными остатками, схожими с E25, но связывающим другой антиген. Отрицательное связывание с MAE1 свидетельствует о том, что AME являлись специфичными только к последовательностям E25. Для тестирования того, одинаково ли хорошо антитела против лекарственного средства связываются с E25 и мутантным E25-AAA, анализы связывания осуществляли с применением известных в данной области способов. См., например, Engvall et al., Immunochemistry 8:871-4, 1971. E25 или мутантный E25-AAA иммобилизировали на планшете для ELISA, на планшет добавляли повышающиеся концентрации очищенного антитела против лекарственного средства (AME1, AME7, AME9, AME2, AME10, AME14, AME4 или AME5). Связывание антитела против лекарственного средства с E25 или мутантным E25-AAA определяли посредством антитела против IgG мыши, конъюгированного с HRP. Измеряли OD при 450 нм. Как показано на фигурах 4A-4H и таблице 2 ниже, AME2, AME10, AME4 и AME5 специфичны к Fab-фрагменту E25 и специфичны к каркасной области E25; AME1, AME7 и AME9 специфичны к CDR E25; AME13 специфичны к каркасной области E25. Т.к. AME2, AME10, AME13, AME4, AME5 и AME7 связываются и с E25, и с мутантным E25-AAA, данные антитела можно применять для тестирования и скрининга мутантных антител против IgE, которые можно применять в описываемом в настоящем документе анализе.

Пример 3. Получение E25-специфичного IgE антитела положительного контроля

На фигуре 5 представлено антитело положительного контроля, которое можно применять в описываемой в настоящем документе системе анализа. Данное антитело имеет вариабельные области тяжелой и легкой цепи AME2 и константные области IgE человека.

Антитело положительного контроля тестировали с применением анализа, представленного на фигуре 6A. Поверхность планшета для ELISA покрывали химерным рецептором FcεRIα IgG человека. E25-специфичное IgE антитело положительного контроля добавляли на планшет и инкубировали, делая возможным связывание с иммобилизированным рецептором. На планшет добавляли E25 или мутантное E25-AAA с повышающимися концентрациями и инкубировали, делая возможным связывание E25 или мутантного E25-AAA. Связывание E25 или мутантного E25-AAA с планшетом измеряли с применением HRP-антитела против IgG человека. Результаты представлены на фигуре 6B. Эксперимент свидетельствует о том, что антитело положительного контроля, представленное на фигуре 3, одинаково хорошо связывается с E25 и мутантным E25-AAA, и его можно применять в описываемой в настоящем документе системе анализа в качестве положительного контроля для анализа или скрининга дополнительных мутантных антител.

Пример 4. Определение антител против лекарственного средства изотипа IgE в образце с применением прямого формата ELISA

На фигуре 7 представлена система анализа для определения E25-специфичного IgE. Мутантное антитело E25-AAA применяют для покрытия поверхности планшета для ELISA. Альтернативно, мутантное антитело иммобилизируют на поверхности полимерной целлюлозной губки (ImmunoCAP® design, Phadia). Образец сыворотки пациента добавляют на поверхность и инкубируют в условиях, делающих возможным связывание любого E25-специфичного IgE с мутантным E25-AAA. Меченный биотином химерный рецептор FcεRIα-IgG человека (например, как описано в WO 08/028068) добавляют на планшет для ELISA (или ImmunoCAP®) для определения любого E25-специфичного IgE, связавшегося с мутантным E25-AAA. SA-HRP (конъюгат стрептавидин-пероксидаза хрена) добавляют для определения биотин-FcεRI-IgG.

Альтернативно, другую систему определения применяют для определения связывания E25-специфичного IgE с мутантным E25-AAA. Для прямого анализа ELISA применяют следующие этапы: a) покрытие планшета мутантным E25-AAA в течение ночи при 2-8°C; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на планшет и его инкубация в течение 2 часов при комнатной температуре со встряхиванием; c) добавление разведенных 1:2 образцов сыворотки, содержащих E25-специфичное IgE и не-E25-специфичное IgE, на планшет и его инкубация в течение ночи при комнатной температуре со встряхиванием; d) добавление меченного биотином FcεRI-IgG на планшет и его инкубация в течение 1 часа при комнатной температуре со встряхиванием; e) добавление Amdex-стрептавидин-HRP на планшет и его инкубация в течение 1 часа при комнатной температуре со встряхиванием; f) добавление субстрата тетраметилбензидина (TMB) на планшет и его инкубация в течение приблизительно 15 минут; и g) добавление 1 M фосфорной кислоты на планшет и считывание поглощения при A450-A650. Планшет также промывают три раза между каждыми этапами до этапа f).

Пример 5. Определение антител изотипа IgE против лекарственного средства в образце с применением полугомогенных и гомогенных анализов

На фигуре 10 представлен полугомогенный формат ELISA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE, с меченным биотином мутантным E25-AAA в течение ночи при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием или с применением предварительно блокированного покрытого стрептавидином планшета (такого как покрытый стрептавидином 96-луночный планшет (планшеты) Reacti-Bind с высокой емкостью связывания (HBC) с Super Blocker BSA, Pierce, кат. № 15500); c) добавление преинкубированных образцов сыворотки на планшет и их инкубация в течение 0,5-2 часов (например, 1 час) при комнатной температуре со встряхиванием; d) добавление меченного дигоксигенином FcεRI-IgG на планшет и его инкубация в течение 1 часа при комнатной температуре со встряхиванием; e) добавление меченного HRP антитела против дигоксигенина на планшет и его инкубация в течение 1 часа при комнатной температуре со встряхиванием; f) добавление субстрата TMB на планшет и его инкубация в течение приблизительно 15 минут; и g) добавление 1 M фосфорной кислоты на планшет и считывание поглощения при A450-A650. Планшет промывают три раза между этапами, например, после каждого из этапов с b) по e).

Например, 1 мкг/мл меченного биотином мутантного E25-AAA в разбавителе для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20, 0,05% ProClin 300) разводят 1:1 сывороткой человека и совместно преинкубируют в течение ночи при комнатной температуре со встряхиванием. Затем преинкубированный образец сыворотки 1:2 добавляют на покрытый стрептавидином планшет для микротитрования (Pierce кат. № 15500), инкубируют в течение 1 часа при комнатной температуре со встряхиванием, затем промывают. Связавшийся E25-специфичный IgE определяют посредством инкубации с ~250 нг/мл DIG-меченного FcεRI-IgG в разбавителе для анализа в течение 1 часа при комнатной температуре со встряхиванием. Планшет промывают и инкубируют с ~1:6000 HRP-меченным MAb мыши против DIG (Jackson ImmunoResearch кат. № 200-032-156) в разбавителе для анализа в течение 1 часа при комнатной температуре со встряхиванием. Планшет промывают последний раз и инкубируют с субстратом TMB в течение 15-30 минут для проявления цвета и измерения.

На фигуре 11 представлен полугомогенный формат MSD-ECLA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE с меченным биотином мутантным E25 (таким как мутантный E25-AAA) в течение ночи при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на покрытый стрептавидином планшет для MSD (Meso Scale Discovery (MSD), Gaithersburg, MD, USA) и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; c) добавление преинкубированных образцов сыворотки на покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; d) добавление меченного рутением FcεRI-IgG и инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; и e) добавление буфера для считывания MSD TPA и немедленное считывание сигнала. Планшет промывают между этапами, например, после каждого из этапов с b) по d).

На фигуре 12 представлен "блокирующие" гомогенный формат ELISA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE, с меченным биотином мутантным E25 (таким как мутантный E25-AAA) и более чем 10-кратным избытком FcεRI-IgG в течение ночи при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; c) добавление преинкубированных образцов сыворотки на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; d) добавление HRP-меченного антитела против IgE человека на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; e) добавление субстрата TMB на планшет и его инкубация в течение приблизительно 15 минут; и f) добавление 1 M фосфорной кислоты на планшет и считывание поглощения при A450-A650. Планшет промывают между этапами, например, после каждого из этапов с b) по d).

На фигуре 13 представлен "блокирующий" гомогенный формат ELISA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE, с меченным биотином мутантным E25 (таким как мутантный E25-AAA) и более чем 10-кратным избытком меченного дигоксигенином FcεRI-IgG в течение ночи при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; c) добавление преинкубированных образцов сыворотки на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; d) добавление HRP-меченного антитела против дигоксигенина на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; e) добавление субстрата TMB на планшет и инкубация в течение приблизительно 15 минут; и f) добавление 1 M фосфорной кислоты на планшет и считывание поглощения при A450-A650. Планшет промывают между этапами, например, после каждого из этапов с b) по d).

На фигуре 14 представлен гомогенный "блокирующий" формат MSD-ECLA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE, с меченным биотином мутантным E25 (таким как мутантный E25-AAA) и более чем 10-кратным избытком меченного рутением FcεRI-IgG в течение ночи при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; c) добавление преинкубированных образцов сыворотки на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; d) добавление буфера для считывания MSD TPA и немедленное считывание сигнала. Планшет промывают между этапами, например, после каждого из этапов с b) по c).

На фигуре 15 представлен полугомогенный "блокирующий" формат ELISA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) покрытие планшета E25 (или мутантным E25 (таким как мутантное E25-AAA)) в течение ночи при 2-8°C (фиг. 15, правая часть) или добавление меченного биотином E25 (или меченного биотином мутантного E25 (такого как мутантное E25-AAA)) (фиг. 15, левая часть) на предварительно покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на планшет и его инкубация в течение 2 часов при комнатной температуре со встряхиванием; c) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE, с более чем 10-кратным избытком немеченого FcεRI-IgG и их инкубация в течение ночи при комнатной температуре со встряхиванием; d) добавление преинкубированных образцов сыворотки на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; e) добавление HRP-меченного антитела против IgE человека на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; f) добавление субстрата TMB на планшет и инкубация в течение приблизительно 15 минут; и g) добавление 1 M фосфорной кислоты на планшет и считывание поглощения при A450-A650. Планшет промывают между этапами, например, после каждого из этапов a), b), d) и e).

На фигуре 16 представлен полугомогенный "блокирующий" формат ELISA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) покрытие планшета E25 (или мутантным E25 (таким как мутантный E25-AAA)) в течение ночи при 2-8°C (фиг. 16, правая часть) или добавление меченного биотином E25 (или меченного биотином мутантного E25 (такого как мутантное E25-AAA)) (фиг. 16, левая часть) на предварительно покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на планшет и его инкубация в течение 2 часов при комнатной температуре со встряхиванием; c) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE, с более чем 10-кратным избытком меченного дигоксигенином FcεRI-IgG в течение ночи при комнатной температуре со встряхиванием; d) добавление преинкубированных образцов сыворотки на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; e) добавление HRP-меченного антитела против дигоксигенина на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; f) добавление субстрата TMB на планшет и инкубация в течение приблизительно 15 минут; и g) добавление 1 M фосфорной кислоты на планшет и считывание поглощения при A450-A650. Планшет промывают между этапами, например, после каждого из этапов a), b), d) и e).

На фигуре 17 представлен полугомогенный "блокирующий" формат MSD-ECLA для определения E25-специфичного IgE в образце. Применяют следующие этапы: a) покрытие планшета E25 (или мутантным E25 (таким как мутантный E25-AAA)) в течение ночи при 2-8°C (фиг. 17, правая часть) или добавление меченного биотином E25 (или меченного биотином мутантного E25) (фиг. 17, левая часть) на предварительно покрытый стрептавидином планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; b) добавление разбавителя для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300) на планшет и его инкубация в течение 2 часов при комнатной температуре со встряхиванием; c) преинкубация образцов сыворотки, содержащих E25-специфичный IgE и не-E25-специфичный IgE, с более чем 10-кратным избытком меченного рутением FcεRI-IgG в течение ночи при комнатной температуре со встряхиванием; d) добавление преинкубированных образцов сыворотки на планшет и его инкубация в течение 1-2 часов при комнатной температуре со встряхиванием; и e) добавление буфера для считывания MSD TPA и немедленное считывание сигнала. Планшет промывают между этапами, например, после каждого из этапов a), b) и d).

Пример 6. Чувствительность анализа для антитела изотипа IgE против лекарственного средства

Определяли чувствительность системы анализа для E25-специфичных антител IgE, описываемой в примере 4 (фигура 7). Планшет для микротитрования покрывали мутантным E25-AAA в течение ночи при 4°C в 0,05 M буфере карбоната натрия, pH 9,6, 3 раза промывали промывочным буфером (PBS, 0,05% полисорбата 20, pH 7,2) и затем блокировали разбавителем для анализа (PBS, 0,05% полисорбата 20, 0,5% BSA, 0,05% ProClin 300, pH 7,2) в течение двух часов при комнатной температуре. Стандартную кривую E25-специфичного IgE (положительный контроль, представленный на фигуре 5) получали добавлением 0,4-1000 нг/мл положительного контроля (PC) к совокупности неразведенной нормальной сыворотке человека (совокупность NHS) и затем разведением каждого стандартного образца 1:2 разбавителем для анализа. Образцы для стандартной кривой положительного контроля 1:2 добавляли на покрытый мутантным E25-AAA планшет для микротитрования и позволяли инкубироваться в течение ночи при комнатной температуре со встряхиванием. Затем планшет для микротитрования 6 раз промывали промывочным буфером.

Меченный биотином rhuFcεRI-IgG, разведенный разбавителем для анализа (PBS, 0,5% BSA, 0,05% полисорбата 20 и 0,05% ProClin 300), добавляли на планшет для микротитрования и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 6 раз промывали промывочным буфером. Стрептавидин-пероксидазу хрена Amdex (Amdex SA-HRP), разведенный разбавителем для анализа, добавляли на планшет для микротитрования и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 6 раз промывали промывочным буфером. Затем на планшет для микротитрования добавляли субстрат TMB и позволяли инкубироваться в течение 15 минут при комнатной температуре. Затем на планшет для микротитрования добавляли фосфорную кислоту для остановки проявления цвета и считывали сигнал поглощения с каждой лунки с применением спектрофотометра для чтения планшетов при 450 нм с референсным значением 650 нм.

Стандартная кривая для E25-специфичного IgE (PC) представлена на фигуре 8. Минимальная измеряемая концентрация (MQC) E25-специфичных антител IgE составляла 0,2 МЕ/мл (0,48 нг/мл) для данной системы анализа.

Определяли чувствительность системы анализа для E25-специфичных антител IgE, описываемых на фигуре 10. Стандартную кривую для E25-специфичного IgE (положительный контроль, представленный на фигуре 5) получали добавлением 0,1-100 МЕ/мл положительного контроля (PC) к совокупности неразведенной нормальной сыворотки человека (совокупности NHS) и затем разведением каждого стандартного образца 1:2 в разбавителе для анализа (PBS, 0,05% полисорбата 20, 0,5% BSA, 0,05% ProClin 300, pH 7,2), содержащем 1 мкг/мл меченного биотином мутантного E25-AAA. Образцам для стандартной кривой положительного контроля 1:2 позволяли преинкубироваться в течение ночи при комнатной температуре со встряхиванием. Планшет для микротитрования, предварительно покрытый стрептавидином (Pierce кат. № 15125), 3 раза промывали промывочным буфером (PBS, 0,05% полисорбата 20, pH 7,2). Преинкубированные образцы для стандартной кривой положительного контроля 1:2 добавляли на покрытый стрептавидином планшет для микротитрования и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. Меченный дигоксигенином rhuFcεRI-IgG, разведенный разбавителем для анализа, добавляли на планшет для микротитрования и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. На планшет для микротитрования добавляли моноклональное антитело против дигоксигенина с пероксидазой хрена (HRP-Anti DIG MAb, Jackson ImmunoResearch Laboratories Inc. кат. № 200-032-156), разведенное разбавителем для анализа, и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. Затем на планшет для микротитрования добавляли субстрат TMB и позволяли инкубироваться в течение 15 минут при комнатной температуре. Затем на планшет для микротитрования добавляли фосфорную кислоту для остановки проявления цвета и считывали сигнал поглощения с каждой лунки с применением спектрофотометра для чтения планшетов при 450 нм с референсным значением 650 нм. Стандартная кривая для E25-специфичного IgE (PC) представлена в таблице 3 ниже. Минимальная измеряемая концентрация (MQC) E25-специфичных антител IgE составляла 0,1 МЕ/мл (0,24 нг/мл) для данной системы анализа. Способ для таблицы 4 ниже являлся тем же, что и описанный выше для таблицы 3 со следующими изменениями: 1) стандартную кривую для E25-специфичного IgE (положительный контроль представлен на фигуре 5) получали добавлением 0,1-6,4 МЕ/мл вместо 0,1-100 МЕ/мл положительного контроля (PC) к совокупности неразведенной нормальной сыворотки человека (совокупности NHS); и 2) предварительно покрытый стрептавидином планшет представлял собой Pierce кат. № 15500 вместо Pierce кат. № 15125.

Пример 7. Устойчивость системы анализа для определения антитела изотипа IgE против лекарственного средства к лекарственному средству

Тестировали устойчивость системы анализа, описываемой в примере 4 (фигура 7), к лекарственному средству в присутствии 0,8 МЕ/мл (2 нг/мл) положительного контроля (E25-специфичный IgE, представленный на фигуре 5) и повышающихся концентраций E25. Планшеты для микротитрования покрывали мутантным E25-AAA, как описано в примере 6. Образцы для теста устойчивости к лекарственному средству E25 получали добавлением 1-1000 нг/мл E25 к неразведенной совокупности NHS, содержащей 2 нг/мл PC, и затем разведением каждого образца для анализа устойчивости к лекарственному средству 1:2 разбавителем для анализа. Затем образцы для анализа устойчивости к лекарственному средству E25 1:2 добавляли на покрытый мутантным E25-AAA планшет для микротитрования и дополнительно обрабатывали для определения E25-специфичного антитела, как описано в примере 6. Результаты данного анализа представлены на фигуре 9. В присутствии 0,8 МЕ (2 нг/мл) E25-специфичных антител устойчивость анализа к E25 составляла ~130 нг/мл E25.

Тестировали устойчивость системы анализа, описываемой на фигуре 10, к лекарственному средству в присутствии 0,2, 1 и 5 МЕ/мл (0,48, 2,4 и 12 нг/мл) положительного контроля (E25-специфичного IgE, представленного на фигуре 5) и концентраций E25 0, 10, 50 и 150 нг/мл. Стандартную кривую для E25-специфичного IgE (положительного контроля) получали добавлением 0,1-6,4 МЕ/мл положительного контроля (PC) к совокупности неразведенной нормальной сыворотки человека (совокупности NHS). Образцы для тестирования устойчивости к лекарственному средству E25 получали добавлением 0, 10, 50, и 150 нг/мл E25 к неразведенной совокупности NHS или 3 отдельным сывороткам человека с аллергической астмой с до 812 МЕ/мл неспецифичного IgE, содержащих 0,2, 1 и 5 МЕ/мл PC. Затем и образцы для стандартной кривой, и для анализа устойчивости к лекарственному средству разводили 1:2 в разбавителе для анализа (PBS, 0,05% полисорбата 20, 0,5% BSA, 0,05% ProClin 300, pH 7,2), содержащем 1 мкг/мл меченного биотином мутантного E25-AAA. Образцам 1:2 позволяли преинкубироваться в течение ночи при комнатной температуре со встряхиванием. Планшет для микротитрования, предварительно покрытый стрептавидином (Pierce кат. № 15500), 3 раза промывали промывочным буфером (PBS, 0,05% полисорбата 20, pH 7,2). Преинкубированные образцы 1:2 добавляли на покрытый стрептавидином планшет для микротитрования и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. Меченный дигоксигенином rhuFcεRI-IgG, разведенный разбавителем для анализа, добавляли на планшет для микротитрования и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. Моноклональное антитело против дигоксигенина с пероксидазой хрена (HRP-Anti DIG MAb, Jackson ImmunoResearch Laboratories Inc. кат. № 200-032-156), разведенное разбавителем для анализа, добавляли на планшет для микротитрования и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. Затем на планшет для микротитрования добавляли субстрат TMB и позволяли инкубироваться в течение 15 минут при комнатной температуре. Затем на планшет для микротитрования добавляли фосфорную кислоту для остановки проявления цвета и считывали сигнал поглощения с каждой лунки с применением спектрофотометра для чтения планшетов при 450 нм с референсным значением 650 нм. Результаты данного анализа представлены в таблице 5 ниже. В присутствии 0,2 МЕ (0,48 нг/мл) E25-специфичных антител устойчивость анализа к E25 составляла ~50 нг/мл E25.

Также тестировали помехи общего IgE для системы анализа, описываемого на фигуре 10. Стандартную кривую для E25-специфичного IgE (положительного контроля) получали добавлением 0,1-6,4 МЕ/мл положительного контроля (PC) к совокупности неразведенной нормальной сыворотки человека (совокупности NHS). Для анализа выбирали десять образцов для анализа помех общего IgE, состоящих из 9 образцов сыворотки человека от индивидуумов с диагнозом аллергическая астма (сыворотки предоставлены компанией Bioreclamation, Westbury, NY) и совокупность нормальной сыворотки человека, с различными уровнями общего IgE 107-2446 МЕ/мл. Затем образцы для стандартной кривой и десять образцов для анализа помех общего IgE разводили 1:2 разбавителем для анализа (PBS, 0,05% полисорбата 20, 0,5% BSA, 0,05% ProClin 300, pH 7,2), содержащем 1 мкг/мл меченного биотином мутантного E25-AAA. Образцам 1:2 позволяли преинкубироваться в течение ночи при комнатной температуре со встряхиванием. Предварительно покрытый стрептавидином планшет для микротитрования (Pierce кат. № 15500) 3 раза промывали промывочным буфером (PBS, 0,05% полисорбат 20, pH 7,2). На покрытый стрептавидином планшет для микротитрования добавляли преинкубированные образцы 1:2 и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. На планшет для микротитрования добавляли меченный дигоксигенином rhuFcεRI-IgG, разведенный разбавителем для анализа, и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. На планшет для микротитрования добавляли моноклональное антитело против дигоксигенина с пероксидазой хрена (HRP-Anti DIG MAb, Jackson ImmunoResearch Laboratories Inc. кат. № 200-032-156), разведенное разбавителем для анализа, и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. Затем на планшет для микротитрования добавляли субстрат TMB и позволяли инкубироваться в течение 15 минут при комнатной температуре. Затем на планшет для микротитрования добавляли фосфорную кислоту для остановки проявления цвета и считывали сигнал поглощения с каждой лунки с применением спектрофотометра для чтения планшетов при 450 нм с референсным значением 650 нм.

В таблице 6 ниже показано, что не наблюдали помех от общего IgE, если общий IgE в образце составлял ≤800 МЕ/мл.

Также тестировали точность системы анализа, описываемой на фигуре 10. Точность системы анализа, описываемой на фигуре 10, тестировали в присутствии 0, 0,2, 1 и 5 МЕ/мл (0,48, 2,4 и 12 нг/мл) положительного контроля (E25-специфичного IgE, представленного на фигуре 5). Стандартную кривую для E25-специфичного IgE (положительного контроля) получали добавлением 0,1-6,4 МЕ/мл положительного контроля (PC) к совокупности неразведенной нормальной сыворотки человека (совокупности NHS). Образцы для тестирования точности получали добавлением 0, 0,2, 1 и 5 МЕ/мл PC к неразведенной совокупности NHS или 3 сывороток человека от индивидуумов с аллергической астмой с до 812 МЕ/мл неспецифичного IgE. Затем образцы для стандартной кривой и анализа точности разводили 1:2 разбавителем для анализа (PBS, 0,05% полисорбата 20, 0,5% BSA, 0,05% ProClin 300, pH 7,2), содержащем 1 мкг/мл меченного биотином мутантного E25-AAA. Образцам 1:2 позволяли преинкубироваться в течение ночи при комнатной температуре со встряхиванием. Предварительно покрытый стрептавидином планшет для микротитрования (Pierce кат. № 15500) 3 раза промывали промывочным буфером (PBS, 0,05% полисорбата 20, pH 7,2). На покрытый стрептавидином планшет для микротитрования добавляли преинкубированные образцы 1:2 и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. На планшет для микротитрования добавляли меченный дигоксигенином rhuFcεRI-IgG, разведенный разбавителем для анализа, и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. На планшет для микротитрования добавляли моноклональное антитело против дигоксигенина с пероксидазой хрена (HRP-Anti DIG MAb, Jackson ImmunoResearch Laboratories Inc. кат. № 200-032-156), разведенное разбавителем для анализа, и позволяли инкубироваться в течение 1 часа при комнатной температуре со встряхиванием. Затем планшет для микротитрования 3 раза промывали промывочным буфером. Затем на планшет для микротитрования добавляли субстрат TMB и позволяли инкубироваться в течение 15 минут при комнатной температуре. Затем на планшет для микротитрования добавляли фосфорную кислоту для остановки проявления цвета и считывали сигнал поглощения с каждой лунки с применением спектрофотометра для чтения планшетов при 450 нм с референсным значением 650 нм. Результаты представлены в таблице 7 ниже. По-видимому, существует тенденция избыточного выхода IgE с повышающимися уровнями общего IgE.

Уровни общего IgE (неспецифичного IgE) в сыворотках индивидуумов с аллергической астмой определял поставщик сывороток (Bioreclamation) с применением коммерческого анализа общего IgE Phadia.

Уровень общего IgE совокупности NHS определяли с применением способа определения общего свободного IgE в образце сыворотки человека. Образцы, взятые до введения E25, инкубировали с покрытым rhuFcεRI-IgG планшетом. Связывание между IgE в образце и rhuFcεRI-IgG определяли добавлением конъюгированных с биотином антител против IgE человека на планшет с последующим добавлением реагента стрептавидин-конъюгированной-бета-галактозидазы. Планшет промывали и инкубировали с 0,34 мг/мл MUG (4-метилумбеллиферил b-D-галактозидазой) в 0,1 M фосфате натрия, 1 мМ MgCl2, pH 7,5. Затем данную реакцию останавливали добавлением 0,3 M глицина, pH 10,5, и считывали флуоресцентный сигнал. Сигнал коррелирует с уровнем IgE в образце сыворотки.

Хотя вышеизложенное изобретение описано в некоторых подробностях посредством иллюстраций и примером в целях четкости понимания, описание и примеры нельзя истолковывать как ограничение объема изобретения.

1. Способ обнаружения человеческого антитела изотипа IgE против омализумаба, имеющего вариабельные области, которые связываются с омализумабом в образце от индивидуума, включающий этапы:

(a) приведения образца, который может содержать антитело против омализумаба, в контакт с мутантным антителом, содержащим аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala, и

(b) обнаружения связывания вариабельных областей антитела против омализумаба с мутантным антителом, где связывание обнаруживают с использованием средства детекции, которое специфически связывается с Fc-областью антитела IgE человека, и где обнаружение связывания показывает наличие и/или уровень антитела изотипа IgE против омализумаба в образце.

2. Способ по п.1, где мутантное антитело фиксируют на поверхности.

3. Способ по п.2, где мутантное антитело напрямую иммобилизируют на поверхности.

4. Способ по п.2, где мутантное антитело метят и фиксируют на поверхности средством фиксации, которое специфически связывается с меткой, где средство фиксации иммобилизируют на поверхности.

5. Способ по п.4, где метка является биотином и средство фиксации является стрептавидином.

6. Способ по п.4, где метка является дигоксигенином и средство фиксации является антителом против дигоксигенина.

7. Способ по п.1, где образец приводят в контакт с мутантным антителом, которое фиксируют на поверхности.

8. Способ по п.1, где образец приводят в контакт с мутантным антителом до фиксации мутантного антитела на поверхности.

9. Способ по п.1, где средство детекции является полипептидом FcεRIα, связывающимся с Fc-областью IgE человека.

10. Способ по п.9, где полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα.

11. Способ по п.9, где полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα, слитый с константной областью IgG.

12. Способ по п.9, где метят полипептид FcεRIα.

13. Способ по п.12, где метка на полипептиде FcεRIα выбрана из группы, состоящей из биотина, дигоксигенина, рутения, радиоактивной метки, фотолюминесцентной метки, хемилюминесцентной метки, флуоресцентной метки, электрохемилюминесцентной метки и ферментной метки.

14. Способ по п.12, где метку на полипептиде FcεRIα определяют вторым средством детекции, которое специфически связывается с меткой на полипептиде FcεRIα.

15. Способ по любому из пп.1-14, где образец включает сыворотку или плазму человека.

16. Способ по п.15, где сыворотка или плазма содержит омализумаб.

17. Способ по п.15, где сыворотка или плазма не содержит омализумаб.

18. Способ по любому из пп.1-14, дополнительно включающий этап сравнения связывания антител против омализумаба с мутантным антителом, определяемым на этапе (b), с референсным значением.

19. Способ по п.18, где референсное значение является определяемым связыванием между мутантным антителом и контрольным антителом.

20. Способ по п.19, где контрольное антитело является антителом положительного контроля, связывающимся и с омализумабом, и с мутантным антителом со схожей аффинностью.

21. Способ по п.20, где антитело положительного контроля содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO: 7, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO: 8.

22. Набор для обнаружения в образце от индивидуума человеческого антитела изотипа IgE против омализумаба, имеющего вариабельные области, которые связываются с омализумабом, содержащий:

(a) мутантное антитело, содержащее аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala;

(b) средство детекции, связывающееся с Fc-областью IgE человека, и

(c) антитело положительного контроля, имеющее вариабельные области, которые связываются и с омализумабом, и с мутантным антителом, где различие между относительными аффинностями связывания вариабельных областей антитела положительного контроля с омализумабом и с мутантным антителом составляет менее чем приблизительно 50%.

23. Набор по п.22, где средство детекции является полипептидом FcεRIα, содержащим внеклеточный домен субъединицы FcεRIα.

24. Набор по п.23, где полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα, слитый с константной областью IgG.

25. Набор по любому из пп.22-24, где антитело положительного контроля содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO: 7, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, представленную в SEQ ID NO: 8.

26. Способ обнаружения человеческого антитела изотипа IgE против омализумаба, имеющего вариабельные области, которые связываются с омализумабом, в образце от индивидуума, включающий этапы:

(а) приведения образца, который может содержать антитело против омализумаба, в контакт с (i) мутантным антителом и (ii) полипептидом FcεRIα, связывающимся с Fc-областью IgE человека, где мутантное антитело содержит аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala;

(b) фиксации мутантного антитела на поверхности и

(c) обнаружения связывания вариабельных областей антитела против омализумаба с мутантным антителом, где обнаружение связывания показывает наличие и/или уровень антитела изотипа IgE против омализумаба в образце.

27. Способ по п.26, где избыточное количество полипептида FcεRIα приводят в контакт с образцом на этапе (а).

28. Способ по п.27, где по меньшей мере приблизительно 10-кратный избыток полипептида FcεRIα приводят в контакт с образцом на этапе (а).

29. Способ по любому из пп.26-28, где полипептид FcεRIα содержит внеклеточный домен субъединицы FcεRIα.

30. Способ по любому из пп.26-28, где мутантное антитело метят и фиксируют на поверхности средством фиксации, специфически связывающимся с меткой.

31. Способ по п.30, где метка является биотином и поверхность покрывают стрептавидином.

32. Способ по любому из пп.26-28, где связывание антитела против омализумаба с мутантным антителом определяют меченым антителом против IgE человека.

33. Способ по любому из пп.26-28, где метят полипептид FcεRIα и связывание антитела против омализумаба с мутантным антителом определяют средством детекции, специфически связывающимся с меткой на полипептиде FcεRIα.

34. Набор для определения человеческого антитела изотипа IgE против омализумаба, имеющего вариабельные области, которые связываются с омализумабом в образце от индивидуума, содержащий:

(a) мутантное антитело, содержащее аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala;

(b) полипептид FcεRIα, связывающийся с Fc-областью IgE человека, и

(c) антитело положительного контроля, имеющее вариабельные области, которые связываются и с омализумабом, и с мутантным антителом, где различие между относительными аффинностями связывания вариабельных областей антитела положительного контроля с омализумабом и с мутантным антителом составляет менее чем приблизительно 50%.

35. Набор по п.34, дополнительно содержащий антитело против IgE человека.

36. Набор по п.35, где метят антитело против IgE человека.

37. Набор по любому из пп.34-36, где метят полипептид FcεRIα.

38. Набор по п.37, дополнительно содержащий средство детекции, специфически связывающееся с меткой на полипептиде FcεRIα.

39. Способ обнаружения человеческого антитела изотипа IgE против омализумаба, имеющего вариабельные области, которые связываются с омализумабом в образце, включающий этапы:

(а) преинкубации образца, который может содержать антитело против омализумаба, с избыточным количеством полипептида FcεRIα, связывающегося с Fc-областью IgE человека;

(b) инкубации преинкубированного образца из этапа (а) с омализумабом или мутантным антителом, содержащим аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala, и

(c) обнаружения связывания вариабельных областей антитела против омализумаба с омализумабом или мутантным антителом, где обнаружение связывания показывает присутствие и/или уровень антитела изотипа IgE против омализумаба в образце.

40. Способ по п.39, где по меньшей мере приблизительно 10-кратный избыток полипептида FcεRIα преинкубируют с образцом на этапе (а).

41. Способ по п.39 или 40, где омализумаб или мутантное антитело фиксируют на поверхности до или после инкубации с образцом на этапе (b).

42. Способ по п.39 или 40, где омализумаб или мутантное антитело напрямую иммобилизируют на поверхности до инкубации с образцом на этапе (b).

43. Способ по любому из пп.39 или 40, где омализумаб или мутантное антитело метят и фиксируют на поверхности иммобилизированным средством фиксации, специфически связывающимся с меткой.

44. Способ по п.43, где омализумаб или мутантное антитело метят биотином и фиксируют на покрытой стрептавидином поверхности.

45. Способ по п.39 или 40, где связывание антитела против омализумаба с омализумабом или мутантным антителом определяют конъюгированным с HRP антителом против IgE человека.

46. Способ по п.39 или 40, где метят полипептид FcεRIα и определяют связывание антитела против омализумаба с омализумабом или мутантным антителом посредством определения метки.

47. Способ по п.46, где полипептид FcεRIα метят дигоксигенином и связывание антитела против омализумаба с омализумабом или мутантным антителом определяют конъюгированным с HRP антителом против дигоксигенина.

48. Способ по п.46, где полипептид FcεRIα метят рутением и связывание антитела против омализумаба с омализумабом или мутантным антителом определяют электрохемилюминесценцией.

49. Способ идентификации пациента, имеющего риск анафилактической реакции на омализумаб, включающий этапы:

(a) приведения образца от пациента в контакт с мутантным антителом, содержащим аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala, и

(b) определения связывания вариабельных областей человеческого антитела изотипа IgE против омализумаба с мутантным антителом, где связывание обнаруживают с использованием средства детекции, которое специфически связывается с Fc-областью антитела IgE человека, где обнаружение специфического связывания показывает наличие и/или уровень антитела изотипа IgE против омализумаба у пациента, и где наличие и/или уровень человеческого антитела против омализумаба свидетельствует о том, что пациент обладает риском анафилактической реакции на омализумаб.

50. Способ идентификации пациента, имеющего риск анафилактической реакции на омализумаб, включающий этапы:

(a) приведения образца от пациента в контакт с (i) мутантным антителом, содержащим аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala, и (ii) полипептидом FcεRIα, связывающимся с Fc-областью IgE человека;

(b) фиксации мутантного антитела на поверхности и

(c) определения связывания вариабельных областей человеческого антитела изотипа IgE против омализумаба с мутантным антителом, где обнаружение связывания показывает наличие и/или уровень антитела изотипа IgE против омализумаба в образце и где наличие и/или уровень человеческого антитела против омализумаба в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на омализумаб.

51. Способ идентификации пациента, имеющего риск анафилактической реакции на омализумаб, включающий этапы:

(a) преинкубации образца от пациента с избыточным количеством полипептида FcεRIα, связывающегося с Fc-областью IgE человека;

(b) инкубации преинкубированного образца из этапа (а) с омализумабом или мутантным антителом, содержащим аминокислотную последовательность тяжелой цепи, приведенную в SEQ ID NO: 2, и аминокислотную последовательность легкой цепи, приведенную в SEQ ID NO: 1, где остатки Asp в положениях 30, 32 и 34 в SEQ ID NO: 1 замещены остатками Ala, и

(с) определения связывания вариабельных областей человеческого антитела изотипа IgE против омализумаба с омализумабом или мутантным антителом, где обнаружение связывания показывает наличие и/или уровень антитела изотипа IgE против омализумаба в образце и где наличие и/или уровень человеческого антитела против омализумаба в образце свидетельствует о том, что пациент обладает риском анафилактической реакции на омализумаб.

52. Способ лечения пациента, имеющего IgE-опосредованное нарушение, включающий этапы:

(a) определения уровня человеческого антитела изотипа IgE против омализумаба в образце от пациента способом по любому из пп.49-51;

(b) введения пациенту эффективного количества омализумаба для лечения IgE-опосредованного нарушения, если уровень человеческого антитела против омализумаба в образце не свидетельствует о том, что пациент обладает риском анафилактической реакции на омализумаб.



 

Похожие патенты:

Изобретение относится к аналитической химии, а именно к способам стандартизации лекарственных препаратов, лекарственного растительного сырья, фитопрепаратов и биологически активных добавок по содержанию моносахаридов (глюкозы, ксилозы и рамнозы), и может быть использовано в фармацевтическом анализе, в химико-фармацевтической промышленности.

Лизиметр // 2642261
Изобретение относится к приборам, применяемым в сельском хозяйстве при балансовых исследованиях на мелиорируемых землях, в частности для определения инфильтрации поливных, талых и дождевальных вод.

Изобретение относится к области испытаний полимерных материалов, входящих в состав конструкций космических аппаратов (КА). В предлагаемом способе образцы материалов экспонируют в течение заданного срока на поверхности КА, затем помещают в контейнер, который, в свою очередь, укладывают в транспортный контейнер (герметизируемый в условиях космоса) и возвращают их на Землю.

Предложенная группа изобретений относится к области медицины, в частности к онкологии. Предложены способ диагностики рака предстательной железы и способ мониторинга реакции на терапию рака предстательной железы, включающие контактирование раковых клеток эпителиального происхождения с анти-STEAP-l антителом, которое специфически связывается с простата-специфическим маркером STEAP-1 с KD≤1000 нМ, где анти-STEAP-1 антитело представляет собой антитело 15А5, продуцированное клеткой гибридомы, имеющей номер депонирования микроорганизмов РТА-12259.

Изобретение относится к области медицины, в частности к педиатрии. Предложен способ определения показаний к проведению противогерпетической терапии при инфекции ВГЧ-6 у детей с острыми респираторными заболеваниями.

Изобретение относится к обнаружению текучей среды в теле человека, в частности к обнаружению гидравлической текучей среды и жидкого топлива внутри тела человека. Способ обнаружения проникновения текучей среды в пациента включает этапы обеспечения емкости для хранения текучей среды, обеспечения текучей среды для использования в машинном оборудовании и ее добавления в указанную емкость; и обеспечения флуоресцентного красителя и его добавления в текучую среду с обеспечением флуоресценции текучей среды в присутствии голубого или ультрафиолетового света.

Изобретение относится к области измерительной техники, предназначено для определения параметров стационарного и нестационарного теплообмена в системе «человек-одежда-окружающая среда».

В заявке описаны способы, системы и устройства контроля качества (КК) с использованием датчиков, предназначенные для применения с устройствами для проведения биологических/экологических диагностических экспресс-тестов (ДЭТ).

Изобретение относится к медицине, а именно к гинекологии и патологической анатомии, предназначено для ранней диагностики серозных карцином яичника высокой степени злокачественности.

Изобретение относится к области медицины и предназначено для идентификации Mycobacterium leprae. ДНК выделяют из соскоба со слизистой оболочки полости носа в 5% растворе сывороточного бычьего альбумина.

Изобретение относится к медицине, в частности к средствам исследования и диагностики с помощью биочипов. Способ селективного анализа на основе иммунологических реакций с использованием биочипов включает подготовку пробы, смешение антигенов пробы с суперпарамагнитными частицами, соединенными с антителами к указанным антигенам пробы, транспортировку смеси в зону селективного детектирования по имуннологическим реакциям через капилляры и воздействие на смесь магнитным полем.

Изобретение относится к медицине, в частности к средствам исследования и диагностики с помощью биочипов. Способ селективного анализа на основе иммунологических реакций с использованием биочипов включает подготовку пробы, смешение антигенов пробы с суперпарамагнитными частицами, соединенными с антителами к указанным антигенам пробы, транспортировку смеси в зону селективного детектирования по имуннологическим реакциям через капилляры и воздействие на смесь магнитным полем.

Предложенная группа изобретений относится к области медицины, в частности к онкологии. Предложены способ диагностики рака предстательной железы и способ мониторинга реакции на терапию рака предстательной железы, включающие контактирование раковых клеток эпителиального происхождения с анти-STEAP-l антителом, которое специфически связывается с простата-специфическим маркером STEAP-1 с KD≤1000 нМ, где анти-STEAP-1 антитело представляет собой антитело 15А5, продуцированное клеткой гибридомы, имеющей номер депонирования микроорганизмов РТА-12259.
Изобретение относится к области медицины и может быть использовано для определения степени индивидуального генетического риска атеросклероза, ишемической болезни сердца и инфаркта миокарда.

Изобретение относится к медицине, в частности к неврологии, патологической анатомии, а также к гистологии, цитологии и клеточной биологии, и может быть использовано в диагностике в миопатии центрального стержня.

Изобретение относится к области медицины, в частности к акушерству и гинекологии. Предложен способ морфологической диагностики тяжести преэклампсии.

Изобретение относится к области биотехнологии, конкретно к бис-Met-гистонам, и может быть использовано в медицине. Молекула нуклеиновой кислоты кодирует полипептид, состоящий из двух остатков метионина в качестве первого и второго N-концевых аминокислотных остатков, соединенных через пептидную связь со зрелым эукариотическим гистоном H1.
Изобретение используют в медицине, педиатрии, инфекционных болезнях и касается способа оценки активности инфекции, вызванной вирусами герпеса 4, 5, 6 типа у детей. Сущность способа: у детей с подозрением на герпесвирусную инфекцию (ГВИ) 4, 5, 6 типа определяют количество ДНК вируса методом полимеразной цепной реакции (ПЦР) в соскобе из эпителия ротоглотки и при количестве ДНК более 1000 копий на 105 клеток для 4 типа ГВИ, и более 10000 копий на 105 клеток для 5 и 6 типа ГВИ, определяют активную стадию инфекции.

Изобретение относится к области иммунологии. Предложено гуманизированное антитело, специфичное к STEAP-1, и его антигенсвязывающий фрагмент.

Настоящее изобретение относится к иммунологии. Предложены антитело и его фрагмент, которые связываются с фосфо-эпитопом на белке Тау, а также кодирующие их полинуклеотиды; линии клеток, продуцирующие антитела; вектор, содержащая его клетка-хозяин и способ получения антитела и его функционального фрагмента.
Изобретение относится к лабораторной диагностике и представляет собой способ диагностики эндогенной интоксикации у лабораторных мышей для разработки нетоксичного криопротектора, включающий внутрибрюшинное введение испытуемого антифриза, забор крови, высушивание капель сыворотки крови объемом 4 мкл при +37°C, анализ структурности фации дегидратированных капель под микроскопом по показателям: индекс структурности, кристаллизуемость, степень деструкции фации и выраженность краевой зоны фации, отличающийся тем, что фации испытуемых веществ сравнивают с паттерном эндогенной интоксикации низкой выраженности, и вещества, у которых структурность фации аналогична паттерну с высокой выраженностью, относят к высокотоксичным и неперспективным, а вещества, у которых структурность фации аналогична паттерну с низкой выраженностью, относят к малотоксичным и перспективным для разработки криопротектора.

Изобретение относится к биохимии. Предложены способы обнаружения человеческого антитела изотипа IgE против омализумаба. Также рассмотрены наборы, способы идентификации пациента, имеющего риск анафилактической реакции на омализумаб, и способ лечения пациента, имеющего IgE-опосредованное нарушение. Данное изобретение позволяет своевременно обнаруживать аллергические реакции на омализумаб и может найти применение в терапии и предупреждении развития анафилаксии. 9 н. и 43 з.п. ф-лы, 27 ил., 7 табл., 7 пр.

Наверх